[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:AAZ21175.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wcv1.bssp"
#ERROR : Can't open dsspfile "2bejA.bssp"
#ERROR : Can't open dsspfile "2bekB.bssp"
#ERROR : Can't open dsspfile "2bekA.bssp"
#ERROR : Can't open dsspfile "1g3qA.bssp"
#ERROR : Can't open dsspfile "2ozeA.bssp"
#ERROR : Can't open dsspfile "1ionA.bssp"
#ERROR : Can't open dsspfile "3ez2B.bssp"
#ERROR : Can't open dsspfile "3ez2A.bssp"
#ERROR : Can't open dsspfile "3ezfA.bssp"
#ERROR : Can't open dsspfile "3ez7A.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "3ez9B.bssp"
#ERROR : Can't open dsspfile "1xdbA.bssp"
#ERROR : Can't open dsspfile "1rw4A.bssp"
#ERROR : Can't open dsspfile "1nipA.bssp"
#ERROR : Can't open dsspfile "1m34E.bssp"
#ERROR : Can't open dsspfile "1g5pA.bssp"
#ERROR : Can't open dsspfile "1g21F.bssp"
#ERROR : Can't open dsspfile "1g21E.bssp"
#ERROR : Can't open dsspfile "1g20H.bssp"
#ERROR : Can't open dsspfile "1g20G.bssp"
#ERROR : Can't open dsspfile "1g20F.bssp"
#ERROR : Can't open dsspfile "1g20E.bssp"
#ERROR : Can't open dsspfile "1g1mA.bssp"
#ERROR : Can't open dsspfile "1fp6C.bssp"
#ERROR : Can't open dsspfile "1fp6A.bssp"
#ERROR : Can't open dsspfile "1de0A.bssp"
#ERROR : Can't open dsspfile "3bfvA.bssp"
#ERROR : Can't open dsspfile "2afkH.bssp"
#ERROR : Can't open dsspfile "2afkG.bssp"
#ERROR : Can't open dsspfile "2afkF.bssp"
#ERROR : Can't open dsspfile "2afkE.bssp"
#ERROR : Can't open dsspfile "2afiP.bssp"
#ERROR : Can't open dsspfile "2afiO.bssp"
#ERROR : Can't open dsspfile "2afiN.bssp"
#ERROR : Can't open dsspfile "2afiM.bssp"
#ERROR : Can't open dsspfile "2afiH.bssp"
#ERROR : Can't open dsspfile "2afiF.bssp"
#ERROR : Can't open dsspfile "2afiE.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3cioA.bssp"
#ERROR : Can't open dsspfile "3ez9A.bssp"
#ERROR : Can't open dsspfile "1xd8A.bssp"
#ERROR : Can't open dsspfile "2vedB.bssp"
#ERROR : Can't open dsspfile "2vedA.bssp"
#ERROR : Can't open dsspfile "1hyqA.bssp"
#ERROR : Can't open dsspfile "3cwqB.bssp"
#ERROR : Can't open dsspfile "3cwqA.bssp"
#ERROR : Can't open dsspfile "1ii9B.bssp"
#ERROR : Can't open dsspfile "1ii9A.bssp"
#ERROR : Can't open dsspfile "1ii0B.bssp"
#ERROR : Can't open dsspfile "1ii0A.bssp"
#ERROR : Can't open dsspfile "1ihuA.bssp"
#ERROR : Can't open dsspfile "1f48A.bssp"

## Summary of PDB Search
:264
    5e-52  46%  1wcv1  [x.x.x] SEGREGATION PROTEIN
    5e-52  46%  2bejA  [x.x.x] SEGREGATION PROTEIN
    5e-51  46%  2bekB  [x.x.x] SEGREGATION PROTEIN
    5e-51  46%  2bekA  [x.x.x] SEGREGATION PROTEIN
    2e-15  30%  1g3qA  [c.37.1] CELL DIVISION INHIBITOR
    2e-12  27%  2ozeA  [x.x.x] ORF DELTA'
    5e-11  30%  1ionA  [c.37.1] PROBABLE CELL DIVISION INHIBITOR MIND
    1e-10  28%  3ez2B  [x.x.x] PLASMID PARTITION PROTEIN A
    1e-10  28%  3ez2A  [x.x.x] PLASMID PARTITION PROTEIN A
    3e-08  34%  3ezfA  [x.x.x] PARA
    5e-08  26%  3ez7A  [x.x.x] PLASMID PARTITION PROTEIN A
    2e-07  26%  1cp2A  [c.37.1] NITROGENASE IRON PROTEIN
    7e-07  28%  3ez9B  [x.x.x] PARA
    9e-07  50%  1xdbA  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  1rw4A  [c.37.1] NITROGENASE IRON PROTEIN 1
    9e-07  50%  1nipA  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1m34E  [c.37.1] NITROGENASE IRON PROTEIN 1
    9e-07  50%  1g5pA  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g21F  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g21E  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g20H  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g20G  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g20F  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g20E  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1g1mA  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1fp6C  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1fp6A  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  50%  1de0A  [c.37.1] NITROGENASE IRON PROTEIN
    9e-07  31%  3bfvA  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    9e-07  50%  2afkH  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afkG  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afkF  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afkE  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiP  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiO  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiN  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiM  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiH  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiF  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-07  50%  2afiE  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-06  29%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-06  29%  3cioA  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    2e-06  33%  3ez9A  [x.x.x] PARA
    3e-06  47%  1xd8A  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-06  30%  2vedB  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    5e-06  30%  2vedA  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    6e-06  24%  1hyqA  [c.37.1] CELL DIVISION INHIBITOR (MIND-1)
    6e-06  52%  3cwqB  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    6e-06  52%  3cwqA  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    6e-04  47%  1ii9B  [c.37.1 - c.37.1] ARSENICAL PUMP-DRIVING ATPASE
    6e-04  47%  1ii9A  [c.37.1 - c.37.1] ARSENICAL PUMP-DRIVING ATPASE
    6e-04  47%  1ii0B  [c.37.1 - c.37.1] ARSENICAL PUMP-DRIVING ATPASE
    6e-04  47%  1ii0A  [c.37.1 - c.37.1] ARSENICAL PUMP-DRIVING ATPASE
    6e-04  47%  1ihuA  [c.37.1 - c.37.1] ARSENICAL PUMP-DRIVING ATPASE
    6e-04  47%  1f48A  [c.37.1 - c.37.1] ARSENITE-TRANSLOCATING ATPASE
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
1wcv1           ---IALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNATSGLGVRAERG----VYHLLQG-EPL
2bejA           ---IALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNATSGLGVRAERG----VYHLLQG-EPL
2bekB           ---IALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNATSGLGVRAERG----VYHLLQG-EPL
2bekA           ---IALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNATSGLGVRAERG----VYHLLQG-EPL
1g3qA           --------------------NLSVALGDRGRKVLAVDGDTMANLSLVLGVDDPDV---TLHDVLAGEANV
2ozeA           -EAIVILNNKGGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTKVELPRVNFYEGLKNGNLA
1ionA           --------------------NLSVALGEG-RKVLAVDGDLTANLSLVLGVDDVN---ITLHDVLAGDAKL
3ez2B           --VIFISNLKGGVSKTVSTVSLAHAMRAHDLRILVIDLDPQSSATMSIGIVNATSAQAMLQNV-SREELL
3ez2A           --VIFISNLKGGVSKTVSTVSLAHAMRAHDLRILVIDLDPQSSATMSIGIVNATSAQAMLQNV-SREELL
3ezfA           -------------------------LLRHDLRILVIDLDPQASSTMFLG-SILETAAQAMLNNLDAETLR
3ez7A           --VIFISNLKGGVSQTTSTVSLAHAMRAHDLRILVIDLDPXXXXXXXXXXXMLQN--------VSREELL
1cp2A           ---------KGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADSTRLLGLAQ-KSVLDTLRE--EGEDVE
3ez9B           --VIFVVNLTVSTVTLAHALRVHQDLLRHDLRILVIDLDPQASST-----MFLETAAQAMLNNLDAETLR
1xdbA           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1rw4A           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1nipA           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1m34E           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g5pA           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g21F           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g21E           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g20H           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g20G           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g20F           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g20E           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1g1mA           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1fp6C           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1fp6A           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
1de0A           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
3bfvA           VQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYINLPNNEG----LSSLLLNWSTY
2afkH           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afkG           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afkF           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afkE           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiP           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiO           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiN           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiM           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiH           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiF           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
2afiE           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
3cioD           --ILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADRRGYSHNLFTVSNEHGLSE----YLAGKDEL
3cioA           --ILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADRRGYSHNLFTVSNEHGLSE----YLAGKDEL
3ez9A           -------------------------LLRHDLRILVIDLDPQASST-----MFLETAAQAMLNNLDAETLR
1xd8A           ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCNPKADST-------------------------
2vedB           VQSIVITSEAPGAGMSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYINLPNNEG----LSSLLLNWSTY
2vedA           VQSIVITSEAPGAGMSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYINLPNNEG----LSSLLLNWSTY
1hyqA           --------------------NLGVALAQLGHDVTIVDADTMANLELILGM---EGLPVTLQNVLAGEARI
3cwqB           --IITVASFKGGVGKTTTAVHLSAYLAL-QGETLLIDGDPNRSAT-------------------------
3cwqA           --IITVASFKGGVGKTTTAVHLSAYLAL-QGETLLIDGDPNRSAT-------------------------
1ii9B           ---------KGGVGKTSISCATAIRLAEQGKRVLLVSTDPASN---------------------------
1ii9A           ---------KGGVGKTSISCATAIRLAEQGKRVLLVSTDPASN---------------------------
1ii0B           ---------KGGVGKTSISCATAIRLAEQGKRVLLVSTDPASN---------------------------
1ii0A           ---------KGGVGKTSISCATAIRLAEQGKRVLLVSTDPASN---------------------------
1ihuA           ---------KGGVGKTSISCATAIRLAEQGKRVLLVSTDPASN---------------------------
1f48A           ---------KGGVGKTSISCATAIRLAEQGKRVLLVSTDPASN---------------------------


                         .         .         *         .         .         .         .:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
1wcv1           EGLVHPVD--GFHLLPATPDLVGATVELAG-------APTALREALRDEG--YDLVLLDAPPSLSPLTLN
2bejA           EGLVHPVD--GFHLLPATPDLVGATVELAG-------APTALREALRDEG--YDLVLLDAPPSLSPLTLN
2bekB           EGLVHPVD--GFHLLPATPDLVGATVELAG-------APTALREALRDEG--YDLVLLDAPPSLSPLTLN
2bekA           EGLVHPVD--GFHLLPATPDLVGATVELAG-------APTALREALRDEG--YDLVLLDAPPSLSPLTLN
1g3qA           EDAIYMTQFDNVYVLPGAVDWE--HVLKADP--------RKLPEVIKSLKDKFDFILIDCPAGLQLDAMS
2ozeA           SSIVHLTD--NLDLIPGTFDLMLLPKLT-----RSWTFENELATLLAPLKSDYDLIIIDTVPTPSVYTNN
1ionA           EDAIY-TQFENVYILPGAVDWE--HVIKADP--------RKLPEVIKSLKGKYDFILIDCPAGLQ-LRAS
3ez2B           EEFIVPSVVPGVDVMPASIDDAFIASDWRE-LCNEHLPGQNIHAVLKENKSDYDFILVDSGPHLDAFLKN
3ez2A           EEFIVPSVVPGVDVMPASIDDAFIASDWRE-LCNEHLPGQNIHAVLKENKSDYDFILVDSGPHLDAFLKN
3ezfA           KEVIRPTIVPGVDVIPASIDWRELVEEHLPGQNQYEILRRNIIDRVADD---YDFIFIDTGPHL------
3ez7A           EEFIVPSVVPGVDVMPASIDDAFIASDWR-ELCNEHLPGQNIHAVLKENKSDYDFILVDSGPHLDAFLKN
1cp2A           LDSILKEGYGGIRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDD----LDYVFYDVLGDVGFAMPI
3ez9B           KEVIRPTIVPGVDVIPASIDWRELVEEHLPGQNQYEILRRNIIDRVADD---YDFIFIDTGPHL------
1xdbA           ----------------------------------------------------------------------
1rw4A           ----------------------------------------------------------------------
1nipA           ----------------------------------------------------------------------
1m34E           ----------------------------------------------------------------------
1g5pA           ----------------------------------------------------------------------
1g21F           ----------------------------------------------------------------------
1g21E           ----------------------------------------------------------------------
1g20H           ----------------------------------------------------------------------
1g20G           ----------------------------------------------------------------------
1g20F           ----------------------------------------------------------------------
1g20E           ----------------------------------------------------------------------
1g1mA           ----------------------------------------------------------------------
1fp6C           ----------------------------------------------------------------------
1fp6A           ----------------------------------------------------------------------
1de0A           ----------------------------------------------------------------------
3bfvA           QDSIISTEIEDLDVLTSG---------PIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP--------
2afkH           ----------------------------------------------------------------------
2afkG           ----------------------------------------------------------------------
2afkF           ----------------------------------------------------------------------
2afkE           ----------------------------------------------------------------------
2afiP           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
2afiN           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2afiH           ----------------------------------------------------------------------
2afiF           ----------------------------------------------------------------------
2afiE           ----------------------------------------------------------------------
3cioD           NKVIQHFGKGGFDVITRG------QVPPNPSELLMRDRMRQLLEWANDH---YDLVIVDTPPMLAVSD--
3cioA           NKVIQHFGKGGFDVITRG------QVPPNPSELLMRDRMRQLLEWANDH---YDLVIVDTPPMLAVSD--
3ez9A           KEVIRPTIVPGVDVIPASIDWRELVEEHLPGQNQYEILRRNIIDRVADD---YDFIFIDTGPHL------
1xd8A           ----------------------------------------------------------------------
2vedB           QDSIISTEIEDLDVLTSG---------PIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP--------
2vedA           QDSIISTEIEDLDVLTSG---------PIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP--------
1hyqA           DEAIYXXXXXXXXXXXXX-SLEGLRKANPE----------KLEDVLTQIMESTDILLLDAPAGLERSAVI
3cwqB           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
1ii9B           ----------------------------------------------------------------------
1ii9A           ----------------------------------------------------------------------
1ii0B           ----------------------------------------------------------------------
1ii0A           ----------------------------------------------------------------------
1ihuA           ----------------------------------------------------------------------
1f48A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNE
1wcv1           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
2bejA           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
2bekB           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
2bekA           ALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGE
1g3qA           AMLSGEEALLVTNPE---ISCLTDTMKVGIVLK---KAGLAILGFVLNRYGRSDR---DIPPEAAEDVME
2ozeA           AIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSTIKSNLEELYKQHKED
1ionA           ALSGEEAILV-TNPEISCL--------TDTKVGVLKKAGLAILGFILNRYGRSER---DIPPEAAQDVDV
3ez2B           ALASANILFTPL----------------------------------------------------------
3ez2A           ALASANILFTPL----------------------------------------------------------
3ezfA           ----------------------------------------------------------------------
3ez7A           ALASANILFTPL----------------------------------------------------------
1cp2A           REGKAQEIYIVASGEMMALYAANNISKGIQ--KYAKSGGVRLGGIIC------NSRKVANEYELLDAFAK
3ez9B           ----------------------------------------------------------------------
1xdbA           ----------------------------------------------------------------------
1rw4A           ----------------------------------------------------------------------
1nipA           ----------------------------------------------------------------------
1m34E           ----------------------------------------------------------------------
1g5pA           ----------------------------------------------------------------------
1g21F           ----------------------------------------------------------------------
1g21E           ----------------------------------------------------------------------
1g20H           ----------------------------------------------------------------------
1g20G           ----------------------------------------------------------------------
1g20F           ----------------------------------------------------------------------
1g20E           ----------------------------------------------------------------------
1g1mA           ----------------------------------------------------------------------
1fp6C           ----------------------------------------------------------------------
1fp6A           ----------------------------------------------------------------------
1de0A           ----------------------------------------------------------------------
3bfvA           ----------------------------------------------------------------------
2afkH           ----------------------------------------------------------------------
2afkG           ----------------------------------------------------------------------
2afkF           ----------------------------------------------------------------------
2afkE           ----------------------------------------------------------------------
2afiP           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
2afiN           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
2afiH           ----------------------------------------------------------------------
2afiF           ----------------------------------------------------------------------
2afiE           ----------------------------------------------------------------------
3cioD           AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLE---QAGVNIKGAILNGVIKR-----------------
3cioA           AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLE---QAGVNIKGAILNGVIKR-----------------
3ez9A           ----------------------------------------------------------------------
1xd8A           ----------------------------------------------------------------------
2vedB           ----------------------------------------------------------------------
2vedA           ----------------------------------------------------------------------
1hyqA           AIAAAQELLLVVNPEISSITDGLKTKIVAERLGT------KVLGVVV---NRITTLGIEMAKNEIEAILE
3cwqB           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
1ii9B           ----------------------------------------------------------------------
1ii9A           ----------------------------------------------------------------------
1ii0B           ----------------------------------------------------------------------
1ii0A           ----------------------------------------------------------------------
1ihuA           ----------------------------------------------------------------------
1f48A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KVYLTVIPRNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQEQxxxxxx
1wcv1           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQ------
2bejA           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQ------
2bekB           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQ------
2bekA           KVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQ------
1g3qA           VPLLAVIPEDPAIREGTLEGIPAVKYKPESKGAKAFVKLAEE------------
2ozeA           NVFQNIIKRSNKVSTWSKNGI---------------------------------
1ionA           PL-LAVIPEDPVIREGTLEGIPAVKYKPESKGAQAFIKLAEE------------
3ez2B           ------------------------------------------------------
3ez2A           ------------------------------------------------------
3ezfA           ------------------------------------------------------
3ez7A           ------------------------------------------------------
1cp2A           ELLIHFVPRSPMVTKAEINKQTVIEYDPTCEQAEEY------------------
3ez9B           ------------------------------------------------------
1xdbA           ------------------------------------------------------
1rw4A           ------------------------------------------------------
1nipA           ------------------------------------------------------
1m34E           ------------------------------------------------------
1g5pA           ------------------------------------------------------
1g21F           ------------------------------------------------------
1g21E           ------------------------------------------------------
1g20H           ------------------------------------------------------
1g20G           ------------------------------------------------------
1g20F           ------------------------------------------------------
1g20E           ------------------------------------------------------
1g1mA           ------------------------------------------------------
1fp6C           ------------------------------------------------------
1fp6A           ------------------------------------------------------
1de0A           ------------------------------------------------------
3bfvA           ------------------------------------------------------
2afkH           ------------------------------------------------------
2afkG           ------------------------------------------------------
2afkF           ------------------------------------------------------
2afkE           ------------------------------------------------------
2afiP           ------------------------------------------------------
2afiO           ------------------------------------------------------
2afiN           ------------------------------------------------------
2afiM           ------------------------------------------------------
2afiH           ------------------------------------------------------
2afiF           ------------------------------------------------------
2afiE           ------------------------------------------------------
3cioD           ------------------------------------------------------
3cioA           ------------------------------------------------------
3ez9A           ------------------------------------------------------
1xd8A           ------------------------------------------------------
2vedB           ------------------------------------------------------
2vedA           ------------------------------------------------------
1hyqA           AKVIGLIPEDPEVRRAAAYGKPVVLRSPNSPAARA-------------------
3cwqB           ------------------------------------------------------
3cwqA           ------------------------------------------------------
1ii9B           ------------------------------------------------------
1ii9A           ------------------------------------------------------
1ii0B           ------------------------------------------------------
1ii0A           ------------------------------------------------------
1ihuA           ------------------------------------------------------
1f48A           ------------------------------------------------------