[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:parB

[Show Plain Result]

#ERROR : Can't open dsspfile "1vz0H.bssp"
#ERROR : Can't open dsspfile "1vz0F.bssp"
#ERROR : Can't open dsspfile "1vz0E.bssp"
#ERROR : Can't open dsspfile "1vz0C.bssp"
#ERROR : Can't open dsspfile "1vz0B.bssp"
#ERROR : Can't open dsspfile "1vz0A.bssp"
#ERROR : Can't open dsspfile "1vk1A.bssp"

## Summary of PDB Search
:282
    6e-36  42%  1vz0H  [d.268.1 - a.4.14] CHROMOSOME PARTITIONING PROTEIN PARB
    6e-36  42%  1vz0F  [d.268.1 - a.4.14] CHROMOSOME PARTITIONING PROTEIN PARB
    6e-36  42%  1vz0E  [d.268.1 - a.4.14] CHROMOSOME PARTITIONING PROTEIN PARB
    6e-36  42%  1vz0C  [d.268.1 - a.4.14] CHROMOSOME PARTITIONING PROTEIN PARB
    6e-36  42%  1vz0B  [d.268.1 - a.4.14] CHROMOSOME PARTITIONING PROTEIN PARB
    6e-36  42%  1vz0A  [d.268.1 - a.4.14] CHROMOSOME PARTITIONING PROTEIN PARB
    8e-04  28%  1vk1A  [d.268.1] CONSERVED HYPOTHETICAL PROTEIN
:282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
1vz0H           --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1vz0F           --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1vz0E           --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1vz0C           --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1vz0B           --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1vz0A           --------------------------VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVR
1vk1A           ------------------------IPVKKVEYVFIELDKM-PHEQLVQRELEDFIESVTGSGIFWKPMLL


                         .         .         *         .         .         .         .:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEE
1vz0H           PQGDG---YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALL-E
1vz0F           PQGDG---YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALL-E
1vz0E           PQGDG---YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALL-E
1vz0C           PQGDG---YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALL-E
1vz0B           PQGDG---YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALL-E
1vz0A           PQGDG---YELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQREDLSPVEEARGYQALL-E
1vk1A           AKIPGTDEYLIVDGHHRWAGLQKLGAKRAPSVILDYFD--------------------------------


                         +         .         .         .         .         *         .:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVR
1vz0H           MGLTQEEVARRVGKARSTVANXXXXXXXXXXXXXXXXXGEITAGHARALLMLEPEDWGLKEILEKGLSVR
1vz0F           MGLTQEEVARRVGKARSTVANXXXXXXXXXXXXXXXXXGEITAGHARALLMLEPEDWGLKEILEKGLSVR
1vz0E           MGLTQEEVARRVGKARSTVANXXXXXXXXXXXXXXXXXGEITAGHARALLMLEPEDWGLKEILEKGLSVR
1vz0C           MGLTQEEVARRVGKARSTVANXXXXXXXXXXXXXXXXXGEITAGHARALLMLEPEDWGLKEILEKGLSVR
1vz0B           MGLTQEEVARRVGKARSTVANXXXXXXXXXXXXXXXXXGEITAGHARALLMLEPEDWGLKEILEKGLSVR
1vz0A           MGLTQEEVARRVGKARSTVANXXXXXXXXXXXXXXXXXGEITAGHARALLMLEPEDWGLKEILEKGLSVR
1vk1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QSExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vz0H           QAE-------------------------------------------------------------------
1vz0F           QAE-------------------------------------------------------------------
1vz0E           QAE-------------------------------------------------------------------
1vz0C           QAE-------------------------------------------------------------------
1vz0B           QAE-------------------------------------------------------------------
1vz0A           QAE-------------------------------------------------------------------
1vk1A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xx
1vz0H           --
1vz0F           --
1vz0E           --
1vz0C           --
1vz0B           --
1vz0A           --
1vk1A           --