[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:argH

[Show Plain Result]

#ERROR : Can't open dsspfile "2e9fD.bssp"
#ERROR : Can't open dsspfile "2e9fC.bssp"
#ERROR : Can't open dsspfile "2e9fB.bssp"
#ERROR : Can't open dsspfile "2e9fA.bssp"
#ERROR : Can't open dsspfile "1k7wD.bssp"
#ERROR : Can't open dsspfile "1k7wC.bssp"
#ERROR : Can't open dsspfile "1k7wB.bssp"
#ERROR : Can't open dsspfile "1k7wA.bssp"
#ERROR : Can't open dsspfile "1hy1D.bssp"
#ERROR : Can't open dsspfile "1hy1C.bssp"
#ERROR : Can't open dsspfile "1hy1B.bssp"
#ERROR : Can't open dsspfile "1hy1A.bssp"
#ERROR : Can't open dsspfile "1tjuD.bssp"
#ERROR : Can't open dsspfile "1tjuB.bssp"
#ERROR : Can't open dsspfile "1tjuA.bssp"
#ERROR : Can't open dsspfile "1tjwC.bssp"
#ERROR : Can't open dsspfile "1tjwB.bssp"
#ERROR : Can't open dsspfile "1tjvC.bssp"
#ERROR : Can't open dsspfile "1tjvA.bssp"
#ERROR : Can't open dsspfile "1u16A.bssp"
#ERROR : Can't open dsspfile "1u15C.bssp"
#ERROR : Can't open dsspfile "1u15B.bssp"
#ERROR : Can't open dsspfile "1u15A.bssp"
#ERROR : Can't open dsspfile "1auwA.bssp"
#ERROR : Can't open dsspfile "1xwoD.bssp"
#ERROR : Can't open dsspfile "1xwoC.bssp"
#ERROR : Can't open dsspfile "1xwoB.bssp"
#ERROR : Can't open dsspfile "1xwoA.bssp"
#ERROR : Can't open dsspfile "1hy0B.bssp"
#ERROR : Can't open dsspfile "1hy0A.bssp"
#ERROR : Can't open dsspfile "1k62B.bssp"
#ERROR : Can't open dsspfile "1tj7A.bssp"
#ERROR : Can't open dsspfile "1k62A.bssp"
#ERROR : Can't open dsspfile "1tj7B.bssp"
#ERROR : Can't open dsspfile "1aosA.bssp"
#ERROR : Can't open dsspfile "1dcnD.bssp"
#ERROR : Can't open dsspfile "1dcnC.bssp"
#ERROR : Can't open dsspfile "1dcnA.bssp"
#ERROR : Can't open dsspfile "1i0aD.bssp"
#ERROR : Can't open dsspfile "1i0aC.bssp"
#ERROR : Can't open dsspfile "1i0aB.bssp"
#ERROR : Can't open dsspfile "1i0aA.bssp"
#ERROR : Can't open dsspfile "1dcnB.bssp"
#ERROR : Can't open dsspfile "1j3uA.bssp"
#ERROR : Can't open dsspfile "2pfmA.bssp"
#ERROR : Can't open dsspfile "3gtdA.bssp"
#ERROR : Can't open dsspfile "1c3uA.bssp"
#ERROR : Can't open dsspfile "1c3cA.bssp"
#ERROR : Can't open dsspfile "1yfmA.bssp"
#ERROR : Can't open dsspfile "3c8tA.bssp"
#ERROR : Can't open dsspfile "1vdkA.bssp"

## Summary of PDB Search
:462
    2e-81  37%  2e9fD  [x.x.x] ARGININOSUCCINATE LYASE
    2e-81  37%  2e9fC  [x.x.x] ARGININOSUCCINATE LYASE
    2e-81  37%  2e9fB  [x.x.x] ARGININOSUCCINATE LYASE
    2e-81  37%  2e9fA  [x.x.x] ARGININOSUCCINATE LYASE
    4e-80  37%  1k7wD  [a.127.1] DELTA 2 CRYSTALLIN
    4e-80  37%  1k7wC  [a.127.1] DELTA 2 CRYSTALLIN
    4e-80  37%  1k7wB  [a.127.1] DELTA 2 CRYSTALLIN
    4e-80  37%  1k7wA  [a.127.1] DELTA 2 CRYSTALLIN
    8e-80  37%  1hy1D  [a.127.1] DELTA CRYSTALLIN II
    8e-80  37%  1hy1C  [a.127.1] DELTA CRYSTALLIN II
    8e-80  37%  1hy1B  [a.127.1] DELTA CRYSTALLIN II
    8e-80  37%  1hy1A  [a.127.1] DELTA CRYSTALLIN II
    2e-79  36%  1tjuD  [a.127.1] DELTA CRYSTALLIN II
    2e-79  36%  1tjuB  [a.127.1] DELTA CRYSTALLIN II
    2e-79  36%  1tjuA  [a.127.1] DELTA CRYSTALLIN II
    4e-79  36%  1tjwC  [a.127.1] DELTA CRYSTALLIN II
    4e-79  36%  1tjwB  [a.127.1] DELTA CRYSTALLIN II
    4e-79  36%  1tjvC  [a.127.1] DELTA CRYSTALLIN II
    4e-79  36%  1tjvA  [a.127.1] DELTA CRYSTALLIN II
    5e-79  37%  1u16A  [a.127.1] DELTA CRYSTALLIN I
    5e-79  37%  1u15C  [a.127.1] DELTA CRYSTALLIN I
    5e-79  37%  1u15B  [a.127.1] DELTA CRYSTALLIN I
    5e-79  37%  1u15A  [a.127.1] DELTA CRYSTALLIN I
    9e-79  36%  1auwA  [a.127.1] DELTA 2 CRYSTALLIN
    1e-77  36%  1xwoD  [x.x.x] DELTA CRYSTALLIN
    1e-77  36%  1xwoC  [x.x.x] DELTA CRYSTALLIN
    1e-77  36%  1xwoB  [x.x.x] DELTA CRYSTALLIN
    1e-77  36%  1xwoA  [x.x.x] DELTA CRYSTALLIN
    2e-77  36%  1hy0B  [a.127.1] DELTA CRYSTALLIN I
    2e-77  36%  1hy0A  [a.127.1] DELTA CRYSTALLIN I
    5e-77  34%  1k62B  [a.127.1] ARGININOSUCCINATE LYASE
    6e-76  38%  1tj7A  [a.127.1] ARGININOSUCCINATE LYASE
    5e-75  34%  1k62A  [a.127.1] ARGININOSUCCINATE LYASE
    9e-74  38%  1tj7B  [a.127.1] ARGININOSUCCINATE LYASE
    2e-72  35%  1aosA  [a.127.1] ARGININOSUCCINATE LYASE
    5e-71  35%  1dcnD  [a.127.1] DELTA 2 CRYSTALLIN
    1e-69  35%  1dcnC  [a.127.1] DELTA 2 CRYSTALLIN
    4e-69  35%  1dcnA  [a.127.1] DELTA 2 CRYSTALLIN
    1e-67  33%  1i0aD  [a.127.1] DELTA CRYSTALLIN I
    1e-67  33%  1i0aC  [a.127.1] DELTA CRYSTALLIN I
    1e-67  33%  1i0aB  [a.127.1] DELTA CRYSTALLIN I
    1e-67  33%  1i0aA  [a.127.1] DELTA CRYSTALLIN I
    2e-65  35%  1dcnB  [a.127.1] DELTA 2 CRYSTALLIN
    2e-14  31%  1j3uA  [a.127.1] ASPARTASE
    7e-13  26%  2pfmA  [x.x.x] ADENYLOSUCCINATE LYASE
    5e-09  24%  3gtdA  [x.x.x] FUMARATE HYDRATASE CLASS II
    1e-08  23%  1c3uA  [a.127.1] ADENYLOSUCCINATE LYASE
    1e-08  22%  1c3cA  [a.127.1] PROTEIN (ADENYLOSUCCINATE LYASE)
    4e-08  27%  1yfmA  [x.x.x] FUMARASE
    6e-06  22%  3c8tA  [x.x.x] FUMARATE LYASE
    7e-04  23%  1vdkA  [a.127.1] FUMARATE HYDRATASE CLASS II
:462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQXXXXXXXXXXXXXGLN
2e9fD           ----------------------------SLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
2e9fC           ----------------------------SLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
2e9fB           ----------------------------SLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
2e9fA           ----------------------------SLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
1k7wD           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1k7wC           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1k7wB           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1k7wA           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1hy1D           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1hy1C           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1hy1B           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1hy1A           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjuD           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjuB           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjuA           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjwC           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjwB           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjvC           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1tjvA           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1u16A           ---------------------IMEKLNSSIAYDQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1u15C           ---------------------IMEKLNSSIAYDQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1u15B           ---------------------IMEKLNSSIAYDQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1u15A           ---------------------IMEKLNSSIAYDQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1auwA           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1xwoD           ---------------------IMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1xwoC           ---------------------IMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1xwoB           ---------------------IMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1xwoA           ---------------------IMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1hy0B           ---------------------IMQMLSTSISTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1hy0A           ---------------------IMQMLSTSISTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
1k62B           ---------LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
1tj7A           ---------LWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
1k62A           ---------------------IMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
1tj7B           -------------RFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
1aosA           ---------------------IMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
1dcnD           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1dcnC           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1dcnA           --------------------------------DQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1i0aD           ---------------------IMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLE
1i0aC           ---------------------IMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLE
1i0aB           ---------------------IMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLE
1i0aA           ---------------------IMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLE
1dcnB           ---------------------IMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
1j3uA           ----------------------------------------------------------------------
2pfmA           ----------------------------------------------------------------------
3gtdA           ----------------------------------------------------------------------
1c3uA           ----------------------------------------------------------------------
1c3cA           ----------------------------------------------------------------------
1yfmA           ----------------------------------------------------------------------
3c8tA           ----------------------------------------------------------------------
1vdkA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
2e9fD           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDXXXXXXXX
2e9fC           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDXXXXXXXX
2e9fB           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDXXXXXXXX
2e9fA           RIEEEIEAGTFPWREELEDVHMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDXXXXXXXX
1k7wD           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1k7wC           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1k7wB           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1k7wA           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1hy1D           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1hy1C           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1hy1B           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1hy1A           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjuD           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjuB           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjuA           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjwC           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjwB           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjvC           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1tjvA           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1u16A           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQ
1u15C           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQ
1u15B           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQ
1u15A           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQ
1auwA           KISEEWSKGVFVVKQSDEDINTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1xwoD           KISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQ
1xwoC           KISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQ
1xwoB           KISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQ
1xwoA           KISEEWSKGVFVVTQSDEDIHTANERRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQ
1hy0B           KISEELSKGVIVVTQSDEDIQTANERRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQ
1hy0A           KISEELSKGVIVVTQSDEDIQTANERRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQ
1k62B           KVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWE
1tj7A           XXXXDVRARPQQIESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLWCKDTVSELLTANRQ
1k62A           KVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWE
1tj7B           XXXXDVRARPQQIESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLWCKDTVSELLTANRQ
1aosA           KVK---------LNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWE
1dcnD           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1dcnC           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1dcnA           KISEEWSKGVFVVKQSDEDIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1i0aD           KISEESSKGVLVMTQSDEDIQTAIERRLKELIGDIAGKLQTGRSRNEQVVTDXXXXXXXXXXXXXTHLLQ
1i0aC           KISEESSKGVLVMTQSDEDIQTAIERRLKELIGDIAGKLQTGRSRNEQVVTDXXXXXXXXXXXXXTHLLQ
1i0aB           KISEESSKGVLVMTQSDEDIQTAIERRLKELIGDIAGKLQTGRSRNEQVVTDXXXXXXXXXXXXXTHLLQ
1i0aA           KISEESSKGVLVMTQSDEDIQTAIERRLKELIGDIAGKLQTGRSRNEQVVTDXXXXXXXXXXXXXTHLLQ
1dcnB           KISEE-------------DIHTANERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQ
1j3uA           -------------------INMNIANRALELMGEEKGHVNMSQSTNDAFPTATHIAVLSLLNQLIETTKY
2pfmA           -------------------------------LGEERKWVHYGLTSTDVVDTALSYILKQANEIILKDLEN
3gtdA           -------------------------------------HVNKGQSSNDSFPTAMHIATVLATKQLIPALNN
1c3uA           KIDVELFKKIEE--KTNHDVVAFVEG-IGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKE
1c3cA           KIDVELFKKIEE--KTNHDVVAFVEG-IGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKE
1yfmA           -----------------------ISNRAIEIVHPN-NHCNQSQSSNDTFPTVMHIAASQIQNELIPELTN
3c8tA           --------------------------------GEAGKYLHWGATTQDIMDTATVLQIRDGLALISRRIES
1vdkA           -----------------------IANRASEILGKPLGHVNRGQSSNDTFPTAMYVAVALALHQLYPAVEG


                         +         .         .         .         .         *         .:210
query           IIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTS
2e9fD           XXXXXXXXXXKHLDPVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
2e9fC           XXXXXXXXXXKHLDPVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
2e9fB           XXXXXXXXXXKHLDPVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
2e9fA           XXXXXXXXXXKHLDPVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTG
1k7wD           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1k7wC           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1k7wB           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1k7wA           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1hy1D           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1hy1C           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1hy1B           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1hy1A           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjuD           LIKTLVERAAIEIDVILPGYSHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjuB           LIKTLVERAAIEIDVILPGYSHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjuA           LIKTLVERAAIEIDVILPGYSHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjwC           LIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjwB           LIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjvC           LIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1tjvA           LIKTLVERAAIEIDVILPGYDHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1u16A           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1u15C           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1u15B           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1u15A           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1auwA           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1xwoD           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNP
1xwoC           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNP
1xwoB           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNP
1xwoA           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNP
1hy0B           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1hy0A           LIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1k62B           LIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNP
1tj7A           LQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTA
1k62A           LIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNP
1tj7B           LQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTA
1aosA           LIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNP
1dcnD           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1dcnC           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1dcnA           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1i0aD           LIKTLVERAAIEIDIIMPGYTHLQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGVLAGNP
1i0aC           LIKTLVERAAIEIDIIMPGYTHLQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGVLAGNP
1i0aB           LIKTLVERAAIEIDIIMPGYTHLQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGVLAGNP
1i0aA           LIKTLVERAAIEIDIIMPGYTHLQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGVLAGNP
1dcnB           LIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNP
1j3uA           MQQEFMKKADEFAGVIKMGRTHLQDAVPILLGQEFEAYARVIARDIERIANTRNNLYDINMGATAV-GTG
2pfmA           FVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEMKRNVERFKQAANTVRVGKLSGA--VGTY
3gtdA           LLTYLQXXXXXXXXXXXXGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKLAQGGTAVGTGINSK
1c3uA           FCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKISGAV--GNY
1c3cA           FCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKISGAV--GNY
1yfmA           L-KNALEAKSKEFDHIVKGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAV-GTG
3c8tA           VRKALAALARNHRDTPMAGRTHLQHALPVTFGYKAAVWLSAFDRHAAR----LEEISPRVLVVSGASGTL
1vdkA           LIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKKEMEKGLYNL-AIGGTAVGTGLNAHPR


                         .         .         .         +         .         .         .:280
query           FNIDRNFTSKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVV
2e9fD           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
2e9fC           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
2e9fB           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
2e9fA           FPIDRHFTARELGFKAPMRNSLDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFVEVPDAFA
1k7wD           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1k7wC           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1k7wB           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1k7wA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1hy1D           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1hy1C           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1hy1B           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1hy1A           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjuD           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjuB           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjuA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjwC           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjwB           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjvC           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1tjvA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1u16A           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1u15C           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1u15B           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1u15A           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1auwA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTDSDAFS
1xwoD           LDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1xwoC           LDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1xwoB           LDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1xwoA           LDIDREMLRSELDFASISLNSMDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1hy0B           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1hy0A           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1k62B           LGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYS
1tj7A           YEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLSAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVT
1k62A           LGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYS
1tj7B           YEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLSAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVT
1aosA           LGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLSDAYS
1dcnD           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1dcnC           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDA--
1dcnA           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLSDAFS
1i0aD           LEIDRELLRSELDMTSITLNSIDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDAYS
1i0aC           LEIDRELLRSELDMTSITLNSIDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDAYS
1i0aB           LEIDRELLRSELDMTSITLNSIDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDAYS
1i0aA           LEIDRELLRSELDMTSITLNSIDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDAYS
1dcnB           LDIDREMLRSELEFASISLNSMDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLS----
1j3uA           LNADPEYISKFSGHPRSAQHLVDATQNTDCYTEVSSALKVCMINMSKIANDLRLMASGGLSEIVLPARQ-
2pfmA           ANIDEKYVCENLGLEAAPIST--QTLQRDRHAHYMSTLALIATSIEKMAVEIRLQKSETREVEEAFAKGQ
3gtdA           IGFDIKFAQKVAEFTKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGGLGELHLPENE-
1c3uA           ANVPPEVEEKALSYLGLKPEPVSTVVPRDRHAFYLSTLAIVAAGIERIAVE--IRHLQRTEVLEVEEPF-
1c3cA           ANVPPEVEEKALSYLGLKPEPVSTVVPRDRHAFYLSTLAIVAAGIERIAVE--IRHLQRTEVLEVEEPF-
1yfmA           LNTKPGFISKETGLKFQTPNRFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGGYHELMLPEN-E
3c8tA           ASLGTRGLDVQRELARELNLGVPSISARDAVAETVQFLALVSGSLGKLAMDISI----------------
1vdkA           FGLVAKYLAEETGLPRVAENRFAALAAHDELVNVMGAIRTLAGALMKIGND-VRWLASGIGEITIPANE-


                         .         *         .         .         .         .         +:350
query           TGSSIMPQKKNPDLLEYLRGKTGTVYGNLFSMLTILKGLPISYFKDLQDDKEILFKSNEILNNSIAILNE
2e9fD           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSXXXXXX
2e9fC           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSXXXXXX
2e9fB           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSXXXXXX
2e9fA           TGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSXXXXXX
1k7wD           TGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1k7wC           TGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1k7wB           TGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1k7wA           TGASLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1hy1D           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1hy1C           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1hy1B           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1hy1A           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjuD           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjuB           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjuA           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjwC           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjwB           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjvC           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1tjvA           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1u16A           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATG
1u15C           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATG
1u15B           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATG
1u15A           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATG
1auwA           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1xwoD           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1xwoC           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1xwoB           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1xwoA           TGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1hy0B           TGSSLMPQKKNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATG
1hy0A           TGSSLMPQKKNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATG
1k62B           TGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATG
1tj7A           SGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAAL
1k62A           TGSSLMPRKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATG
1tj7B           SGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAAL
1aosA           TGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATG
1dcnD           T---------NPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1dcnC           -----------PDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1dcnA           T---------NPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1i0aD           TGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEXXXXXXXXXXXXXXXXXG
1i0aC           TGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEXXXXXXXXXXXXXXXXXG
1i0aB           TGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEXXXXXXXXXXXXXXXXXG
1i0aA           TGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEXXXXXXXXXXXXXXXXXG
1dcnB           -----------PDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATG
1j3uA           PGSSIMPGKVNPVMPEVMNQVAFQVFGN---DLTITSASEAGQF-ELNVMEPVLFQSISIMTNVFKSFTE
2pfmA           KGSSAMPHKRNPIGSENMTGLARVIRG---YMMTAYENVPLWHERDISHERVILPDATIALNYMLNRFGN
3gtdA           PGSSIMPGKVNPTQVEALTMVCTQVMGNHVT-VTIAGSLELNVFKPVIIYN--ILQSIELLSDSVSFVTH
1c3uA           --RSAMPHKKNPITCERLTGLSRMMRAYVDPS---LENIALWHERDISHERYVFPDATQTLYYMIVTATN
1c3cA           -RKSAMPHKKNPITCERLTGLSRMMRAYVDPS---LENIALWHERDISHERYVFPDATQTLYYMIVTATN
1yfmA           PGSSIMPGKVNPTQNEALTQVCVQVMGN------------------------------------------
3c8tA           ----------------------------------------------------------------------
1vdkA           PGSSIMPGKVNPTQVEALTMVVVRVYGN------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLKNLKPNKQQMLDLANSGYITATDLADYLVKNHSMPFRKAYQTTASIVNYAXXXXXXXXXXXXXXXXXI
2e9fD           XXXXXKWRRERMWRAAEGGYTLATELADYLAEK-GLPFREAHHXXXXXXXXXXXXXXALKDLTLEELQAH
2e9fC           XXXXXKWRRERMWRAAEGGYTLATELADYLAEK-GLPFREAHHXXXXXXXXXXXXXXALKDLTLEELQAH
2e9fB           XXXXXKWRRERMWRAAEGGYTLATELADYLAEK-GLPFREAHHXXXXXXXXXXXXXXALKDLTLEELQAH
2e9fA           XXXXXKWRRERMWRAAEGGYTLATELADYLAEK-GLPFREAHHXXXXXXXXXXXXXXALKDLTLEELQAH
1k7wD           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1k7wC           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1k7wB           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1k7wA           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1hy1D           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1hy1C           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1hy1B           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1hy1A           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjuD           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjuB           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjuA           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjwC           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjwB           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjvC           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1tjvA           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1u16A           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GMPFRQAHTASGKAVHLAETKGIAINNLTLEDLKSI
1u15C           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GMPFRQAHTASGKAVHLAETKGIAINNLTLEDLKSI
1u15B           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GMPFRQAHTASGKAVHLAETKGIAINNLTLEDLKSI
1u15A           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GMPFRQAHTASGKAVHLAETKGIAINNLTLEDLKSI
1auwA           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSI
1xwoD           VISTLQISKENM-EKALTPEMLSTDLALYLVRK-GMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSI
1xwoC           VISTLQISKENM-EKALTPEMLSTDLALYLVRK-GMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSI
1xwoB           VISTLQISKENM-EKALTPEMLSTDLALYLVRK-GMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSI
1xwoA           VISTLQISKENM-EKALTPEMLSTDLALYLVRK-GMPFRQAHTASGKAVHLAETKGITINNLTLEDLKSI
1hy0B           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GMPFRQAHTASGKAVHLAETKGIAINNLTLEDLKSI
1hy0A           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GMPFRQAHTASGKAVHLAETKGIAINNLTLEDLKSI
1k62B           VISTLQIHQENM-GQALSPDMLATDLAYYLVRK-GMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTI
1tj7A           VLDGIQVKRPRCQEAAQQGYANATELADYLVAK-GVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKF
1k62A           VISTLQIHQENM-GQALSPDMLATDLAYYLVRK-GMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTI
1tj7B           VLDGIQVKRPRCQEAAQQGYANATELADYLVAK-GVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKF
1aosA           VISTLQIHQENM-GQALSPDMLATDLAYYLVRK-GMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTI
1dcnD           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
1dcnC           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
1dcnA           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
1i0aD           VISTLQINKENM-EKALTPELLSTDLALYLVRK-GMPIRQAQTASGKAVHLAETKGITINNLTLEDLKSI
1i0aC           VISTLQINKENM-EKALTPELLSTDLALYLVRK-GMPIRQAQTASGKAVHLAETKGITINNLTLEDLKSI
1i0aB           VISTLQINKENM-EKALTPELLSTDLALYLVRK-GMPIRQAQTASGKAVHLAETKGITINNLTLEDLKSI
1i0aA           VISTLQINKENM-EKALTPELLSTDLALYLVRK-GMPIRQAQTASGKAVHLAETKGITINNLTLEDLKSI
1dcnB           VISTLQISKENM-EKALTPEMLATDLALYLVRK-GVPFRQAHTASGKAVHLAETKGITINNLSLEDLKSI
1j3uA           CLKGIKANEERMKEYVEKGYETAAKLA-----------REAYLTGESI----------------------
2pfmA           IVKNLTVYPENM----------------------------------------------------------
3gtdA           CVKGLEPNIARINTLRDKSLMLVTVLNPHI----------------------------------------
1c3uA           VVRNMKVNEERM----------------------------------------------------------
1c3cA           VVRNMKVNEERM----------------------------------------------------------
1yfmA           ----------------------------------------------------------------------
3c8tA           ----------------------------------------------------------------------
1vdkA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EPRLTIEVLKIFNVKNSVNSKKSYGGTSFDNIKKMIMKYKKx
2e9fD           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
2e9fC           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
2e9fB           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
2e9fA           HPLFAEDALPLLRLETAIHRRRSYGGTAPEAVRERLEEAKK-
1k7wD           SPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1k7wC           SPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1k7wB           SPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1k7wA           SPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1hy1D           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1hy1C           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1hy1B           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1hy1A           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjuD           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjuB           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjuA           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjwC           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjwB           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjvC           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1tjvA           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1u16A           SPLFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1u15C           SPLFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1u15B           SPLFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1u15A           SPLFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1auwA           SPQFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1xwoD           SPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQI------
1xwoC           SPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQI------
1xwoB           SPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQI------
1xwoA           SPLFSSDVSQVFNFVNSVEQYTAMGGTAKSSVTTQI------
1hy0B           SPLFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1hy0A           SPLFSSDVSQVFNFVNSVEQYTALGGTAKSSVTTQIEQLRE-
1k62B           SPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVR--
1tj7A           SQVIDEDVYPILSLQSCLDKRAAKGGVS--------------
1k62A           SPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVR--
1tj7B           SQVIDEDVYPILSLQSCLDKRAAKGGVS--------------
1aosA           SPLFSGDVICVWDYRHSVEQYGALGGTARSSVDWQIRQVR--
1dcnD           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1dcnC           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1dcnA           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1i0aD           SPLFASDVSQVFSVVNSVEQYTAVGGTAKSSVTAQIEQLRE-
1i0aC           SPLFASDVSQVFSVVNSVEQYTAVGGTAKSSVTAQIEQLRE-
1i0aB           SPLFASDVSQVFSVVNSVEQYTAVGGTAKSSVTAQIEQLRE-
1i0aA           SPLFASDVSQVFSVVNSVEQYTAVGGTAKSSVTAQIEQLRE-
1dcnB           SPQFSSDVSQVFNFVNSVEQYTALAGTAKSSVTTQIEQLRE-
1j3uA           ------------------------------------------
2pfmA           ------------------------------------------
3gtdA           ------------------------------------------
1c3uA           ------------------------------------------
1c3cA           ------------------------------------------
1yfmA           ------------------------------------------
3c8tA           ------------------------------------------
1vdkA           ------------------------------------------