[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:recR

[Show Plain Result]

#ERROR : Can't open dsspfile "1vddC.bssp"
#ERROR : Can't open dsspfile "1vddB.bssp"
#ERROR : Can't open dsspfile "1vddA.bssp"

## Summary of PDB Search
:203
    2e-23  35%  1vddC  [e.49.1] RECOMBINATION PROTEIN RECR
    2e-23  35%  1vddB  [e.49.1] RECOMBINATION PROTEIN RECR
    2e-23  35%  1vddA  [e.49.1] RECOMBINATION PROTEIN RECR
:203

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGC
1vddC           -----------------PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKC
1vddB           -----------------PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKC
1vddA           -----------------PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKC


                         .         .         *         .         .         .         .:140
query           NNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVI
1vddC           DVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMGVGPDKLHIKPLLPRVGQGM--EVI
1vddB           DVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMGVGPDKLHIKPLLPRVGQGM--EVI
1vddA           DVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMGVGPDKLHIKPLLPRVGQGM--EVI


                         +         .         .         .         .         *         .:210
query           LATSATVEGQTTAYYIEDXXXXXXXXXXXXAQGLPVGGEIESLDDGTLYSAFKNRxxxxxxxx
1vddC           LATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR--------
1vddB           LATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR--------
1vddA           LATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR--------