[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:wcaG

[Show Plain Result]

#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "1gy8A.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "1gy8C.bssp"
#ERROR : Can't open dsspfile "1gy8B.bssp"
#ERROR : Can't open dsspfile "1gy8D.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "1r6dA.bssp"
#ERROR : Can't open dsspfile "1r66A.bssp"
#ERROR : Can't open dsspfile "2q1tA.bssp"
#ERROR : Can't open dsspfile "2pzjA.bssp"
#ERROR : Can't open dsspfile "2q1uB.bssp"
#ERROR : Can't open dsspfile "2q1uA.bssp"
#ERROR : Can't open dsspfile "2q1sA.bssp"

## Summary of PDB Search
:312
    2e-68  44%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    2e-68  44%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    2e-68  44%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    4e-68  43%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    4e-68  43%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    2e-67  43%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    3e-14  25%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-14  25%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-14  25%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-14  25%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    9e-14  24%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    9e-14  24%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-13  24%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-13  24%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    8e-07  27%  1gy8A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    8e-07  28%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-06  27%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-06  27%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    5e-06  27%  1gy8C  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    9e-06  27%  1gy8B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    1e-05  28%  1gy8D  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    3e-05  19%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    1e-04  26%  1r6dA  [c.2.1] TDP-GLUCOSE-4,6-DEHYDRATASE
    2e-04  26%  1r66A  [c.2.1] TDP-GLUCOSE-4,6-DEHYDRATASE
    4e-04  25%  2q1tA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    4e-04  25%  2pzjA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    7e-04  22%  2q1uB  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    7e-04  22%  2q1uA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    9e-04  25%  2q1sA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
:312

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQXXXXXXXXXXXXXXXXXAAAKVGG
1e6uA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1bsvA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1bwsA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1e7sA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1e7qA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
1e7rA           ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
2c5eB           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c5eA           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c59B           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c59A           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c54B           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c54A           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c5aB           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
2c5aA           --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
1gy8A           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
2cnbB           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
1gy8C           ----------------------------------------------------------------------
1gy8B           ----------------------------------------------------------------------
1gy8D           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
1r6dA           ----------------------------------------------------------------------
1r66A           ----------------------------------------------------------------------
2q1tA           ----------------------------------------------------------------------
2pzjA           ----------------------------------------------------------------------
2q1uB           ----------------------------------------------------------------------
2q1uA           ----------------------------------------------------------------------
2q1sA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
1e6uA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1bsvA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1bwsA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1e7sA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1e7qA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMAESELLQGTLEPTNEPYAI
1e7rA           IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPEAI
2c5eB           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
2c5eA           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
2c59B           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
2c59A           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
2c54B           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
2c54A           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
2c5aB           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAFGL
2c5aA           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAFGL
1gy8A           ----LKYYDNNVVGILRLQAMLLH---KCD--KIIFSSSAAIFPTMNAEPID----INAK-KSPESPYGE
2cnbA           ----LKYYDNNVVGILRLQAMLLH---KCD--KIIFSSSAAIFPTNA-EPID----INAK-KSPESPYGE
2cnbB           ----LKYYDNNVVGILRLQAMLLH---KCD--KIIFSSSAAIFGNPTAEPID----INAK-KSPESPYGE
2cnbC           ----LKYYDNNVVGILRLQAMLLH---KCD--KIIFSSSAAIFGNPTAEPID----INAK-KSPESPYGE
1gy8C           ----LKYYDNNVVGILRLQAMLLH---KCD--KIIFSSSAAIFPTMNAEPID----INAK-KSPESPYGE
1gy8B           ----LKYYDNNVVGILRLQAMLLH---KC---DKIIFSSSAAIFGNPTMTNAEPIDINAK-KSPESPYGE
1gy8D           ----LKYYDNNVVGILRLQAMLLH---KCD--KIIFSSSAAIFPTNA-EPID----INAK-KSPESPYGE
3eheA           --------------NVLATYRLLEAMRKAGVSRIVFTSTSTVYGEAKVIPTPEDYPT-----HPISLYGA
1r6dA           ----------FTETNVQGTQTLLQCAVDAGVGRVVHVSTNQVYGSIDSGSWTESSPL-----EPNSPYAA
1r66A           ----------FTETNVQGTQTLLQCAVDAGVGRVVHVSTDEVYGSIDSGSWTESSPL-----EPNSPYAA
2q1tA           ---------------------------------------------------EETDIVS--LHNNDSPYSM
2pzjA           ---------------------------------------------------EETDIVS--LHNNDSPYSM
2q1uB           ---------------------------------------------------EETDIVS--LHNNDSPYSM
2q1uA           ---------------------------------------------------EETDIVS--LHNNDSPYSM
2q1sA           ---------------------------------------------------EETDIVS--LHNNDSPYSM


                         +         .         .         .         .         *         .:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPAXXXXXXXXXXXXXNTVILWGNGKAK
1e6uA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQKAPDVVVWGSGTPM
1bsvA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPM
1bwsA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPM
1e7sA           ARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
1e7qA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
1e7rA           AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
2c5eB           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREAAPAAFCRKAQTSTDRFE---MWGDGLQT
2c5eA           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREAAPAAFCRKAQTSTDRFE---MWGDGLQT
2c59B           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
2c59A           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
2c54B           ERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
2c54A           ERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
2c5aB           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
2c5aA           EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
1gy8A           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIAPDDKRMPIFGDGTCV
2cnbA           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIAPDDKRMPIFGDGTCV
2cnbB           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIADKRGTDYPTPDGTCV
2cnbC           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIAPDTDKRMIFGDGTCV
1gy8C           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIAPDASTMPIFGDGTCV
1gy8B           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIADKRGTDYPTPDGTCV
1gy8D           SKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDQGSTHLIPIILGRVMSDIADKRGTDYPTPDGTCV
3eheA           SKLACEALIESYCHTFDMQAWIYRFANVIG------RRSTHGV---IYDFIMKLKRNPEELEILGNGEQN
1r6dA           SKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFV---------TNLLDGGTLPLYGDGANV
1r66A           SKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFV---------TNLLDGGTLPLYGDGANV
2q1tA           SKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALLPLENGGVAT
2pzjA           SKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALLPLENGGVAT
2q1uB           SKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALLPLENGGVAT
2q1uA           SKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALLPLENGGVAT
2q1sA           SKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALLPLENGGVAT


                         .         .         .         +         .         .         .:280
query           REVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNXXXXXXXXXXXPNGSPRKVM
1e6uA           REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1bsvA           REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1bwsA           REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRDLAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1e7sA           REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1e7qA           REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
1e7rA           REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
2c5eB           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c5eA           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c59B           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c59A           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c54B           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c54A           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c5aB           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
2c5aA           RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
1gy8A           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
2cnbA           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
2cnbB           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
2cnbC           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
1gy8C           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
1gy8B           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
1gy8D           RDYVHVCDLASAHILALNDKSKYFSVNLGTSRGYSVREVIE-VARKTTGHPIPVRECGRR--EGDPAYLV
3eheA           KSYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEEL-----------GLSPRFRFTMLL
1r6dA           REWVHTDD--------------------------------------------------------------
1r66A           REWVHTDD--------------------------------------------------------------
2q1tA           RDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNGSPEKA-
2pzjA           RDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNGSPEKA-
2q1uB           RDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSGKRFGS
2q1uA           RDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSGKRFGS
2q1sA           RDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNGSPEKA-


                         .         *         .         .         .         .         +:350
query           DISLAKKYGWKSKMSLITSIRNTYKSFVRExx
1e6uA           DVTRLHQLGWYHEISLEAGLASTYQWFL----
1bsvA           DVTRLHQLGWYHEISLEAGLASTYQWFL----
1bwsA           DVTRLHQLGWYHEISLEAGLASTYQWFL----
1e7sA           DVTRLHQLGWYHEISLEAGLASTYQWFL----
1e7qA           DVTRLHQLGWYHEISLEAGLASTYQWFL----
1e7rA           DVTRLHQLGWYHEISLEAGLASTYQWFL----
2c5eB           DNNLIKKLGWAPNMRLKEGLRITY--------
2c5eA           DNNLIKKLGWAPNMRLKEGLRITY--------
2c59B           DNNLIKKLGWAPNMRLKEGLRITY--------
2c59A           DNNLIKKLGWAPNMRLKEGLRITY--------
2c54B           DNNLIKKLGWAPNMRLKEGLRITY--------
2c54A           DNNLIKKLGWAPNMRLKEGLRITY--------
2c5aB           DNNLIKKLGWAPNMRLKEGLRITY--------
2c5aA           DNNLIKKLGWAPNMRLKEGLRITY--------
1gy8A           AASAREVLGWKPKYDTLEAIMETSWKFQR---
2cnbA           AASAREVLGWKPKYDTLEAIMETSWKFQR---
2cnbB           AASAREVLGWKPKYDTLEAIMETSWKFQR---
2cnbC           AASAREVLGWKPKYDTLEAIMETSWKFQR---
1gy8C           AASAREVLGWKPKYDTLEAIMETSWKFQR---
1gy8B           AASAREVLGWKPKYDTLEAIMETSWKFQR---
1gy8D           AASAREVLGWKPKYDTLEAIMETSWKFQR---
3eheA           SIEKLKRLGWKPRYNSEEAVRMAVRDLVED--
1r6dA           --------------------------------
1r66A           --------------------------------
2q1tA           ----RRELGFSADVSIDDGLRKT---------
2pzjA           ----RRELGFSADVSIDDGLRKT---------
2q1uB           PEKARRELGFSADVSIDDGLRKT---------
2q1uA           PEKARRELGFSADVSIDDGLRKT---------
2q1sA           ----RRELGFSADVSIDDGLRKT---------