[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:AAZ21413.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lfpA.bssp"
#ERROR : Can't open dsspfile "1konA.bssp"
#ERROR : Can't open dsspfile "1mw7A.bssp"

## Summary of PDB Search
:241
    1e-43  45%  1lfpA  [e.39.1] HYPOTHETICAL PROTEIN AQ_1575
    9e-36  37%  1konA  [e.39.1] PROTEIN YEBC
    1e-20  45%  1mw7A  [e.39.1] HYPOTHETICAL PROTEIN HP0162
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
1lfpA           ----SHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKAN-PWENIERAI
1konA           --GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLD-----ANPRLRAAVDKALSNNMTRDTLNRAI
1mw7A           ----------------------KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAI


                         .         .         *         .         .         .         .:140
query           AKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGXXX
1lfpA           KKGAGELEEQFEEVIYEGYAPGGVAVVL-ATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYLFERKGYIE
1konA           ARGA-----NMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKG--V
1mw7A           KRAS-SKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTGASIVPNGSLEFMFNR-----


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEK
1lfpA           VPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPISTVQIND
1konA           ISFEKGDEDTIMEAALEAGAEDVVTYDDAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDA
1mw7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DKVXXXXXXXXXXXXXXXVQSVYSNxxxxxx
1lfpA           EE-----------------------------
1konA           ETAPKLMRLIDMLEDCDDVQEVYHN------
1mw7A           -------------------------------