[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:dxs

[Show Plain Result]

#ERROR : Can't open dsspfile "2o1xB.bssp"
#ERROR : Can't open dsspfile "2o1xA.bssp"
#ERROR : Can't open dsspfile "2o1sC.bssp"
#ERROR : Can't open dsspfile "2o1xC.bssp"
#ERROR : Can't open dsspfile "2o1xD.bssp"
#ERROR : Can't open dsspfile "2o1sA.bssp"
#ERROR : Can't open dsspfile "2o1sD.bssp"
#ERROR : Can't open dsspfile "2o1sB.bssp"
#ERROR : Can't open dsspfile "2ozlB.bssp"
#ERROR : Can't open dsspfile "3exeB.bssp"
#ERROR : Can't open dsspfile "1ik6A.bssp"
#ERROR : Can't open dsspfile "1olxB.bssp"
#ERROR : Can't open dsspfile "1wciB.bssp"
#ERROR : Can't open dsspfile "1u5bB.bssp"
#ERROR : Can't open dsspfile "1olsB.bssp"
#ERROR : Can't open dsspfile "1dtwB.bssp"
#ERROR : Can't open dsspfile "2bfcB.bssp"
#ERROR : Can't open dsspfile "2bp7B.bssp"
#ERROR : Can't open dsspfile "1w88F.bssp"
#ERROR : Can't open dsspfile "1umdB.bssp"
#ERROR : Can't open dsspfile "1w88H.bssp"
#ERROR : Can't open dsspfile "1w85B.bssp"
#ERROR : Can't open dsspfile "1gpuA.bssp"
#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "1ni4B.bssp"
#ERROR : Can't open dsspfile "1itzA.bssp"
#ERROR : Can't open dsspfile "1qs0B.bssp"
#ERROR : Can't open dsspfile "3hylA.bssp"
#ERROR : Can't open dsspfile "2r8oB.bssp"
#ERROR : Can't open dsspfile "2r8oA.bssp"
#ERROR : Can't open dsspfile "2r5nB.bssp"
#ERROR : Can't open dsspfile "2r5nA.bssp"
#ERROR : Can't open dsspfile "1qgdA.bssp"
#ERROR : Can't open dsspfile "1w85G.bssp"
#ERROR : Can't open dsspfile "1w85C.bssp"
#ERROR : Can't open dsspfile "1w85A.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "1w88C.bssp"
#ERROR : Can't open dsspfile "1w88A.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "2o1sD.bssp"
#ERROR : Can't open dsspfile "2o1sB.bssp"

## Summary of PDB Search
:637
    e-120  44%  2o1xB  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    e-119  44%  2o1xA  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    e-114  52%  2o1sC  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    e-104  44%  2o1xC  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    e-102  44%  2o1xD  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    5e-83  53%  2o1sA  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    2e-79  55%  2o1sD  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    6e-79  54%  2o1sB  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE
    6e-15  28%  2ozlB  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT BETA
    6e-15  28%  3exeB  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT BETA,
    1e-11  27%  1ik6A  [c.36.1 - c.48.1] PYRUVATE DEHYDROGENASE
    6e-09  27%  1olxB  [c.36.1 - c.48.1] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    1e-08  27%  1wciB  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    1e-08  27%  1u5bB  [c.36.1 - c.48.1] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    1e-08  27%  1olsB  [c.36.1 - c.48.1] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    1e-08  27%  1dtwB  [c.36.1 - c.48.1] BRANCHED-CHAIN ALPHA-KETO ACID
    1e-08  27%  2bfcB  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    2e-08  27%  2bp7B  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    3e-08  23%  1w88F  [c.36.1 - c.48.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, BETA
    4e-08  24%  1umdB  [c.36.1 - c.48.1] 2-OXO ACID DEHYDROGENASE BETA SUBUNIT
    7e-08  27%  1w88H  [c.36.1 - c.48.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, BETA
    7e-08  27%  1w85B  [c.36.1 - c.48.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, BETA
    2e-07  27%  1gpuA  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    2e-07  27%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    1e-06  27%  1ni4B  [c.36.1 - c.48.1] PYRUVATE DEHYDROGENASE E1 COMPONENT: BETA
    1e-06  26%  1itzA  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    2e-06  26%  1qs0B  [c.36.1 - c.48.1] 2-OXOISOVALERATE DEHYDROGENASE BETA-SUBUNIT
    5e-06  27%  3hylA  [x.x.x] TRANSKETOLASE
    4e-05  20%  2r8oB  [x.x.x] TRANSKETOLASE 1
    4e-05  20%  2r8oA  [x.x.x] TRANSKETOLASE 1
    4e-05  20%  2r5nB  [x.x.x] TRANSKETOLASE 1
    4e-05  20%  2r5nA  [x.x.x] TRANSKETOLASE 1
    4e-05  20%  1qgdA  [c.36.1 - c.36.1 - c.48.1] PROTEIN (TRANSKETOLASE)
    1e-04  38%  1w85G  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    1e-04  38%  1w85C  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    1e-04  38%  1w85A  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    1e-04  38%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-04  38%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-04  38%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-04  38%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-04  37%  1w88C  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    2e-04  37%  1w88A  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    5e-04  37%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-04  37%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-22  49%  2o1sD  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE(query 10->179)
    3e-23  47%  2o1sB  [x.x.x] 1-DEOXY-D-XYLULOSE-5-PHOSPHATE SYNTHASE(query 4->177)
:637

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
2o1xB           ------LDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRI
2o1xA           ------LDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRI
2o1sC           ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
2o1xC           ------LDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRI
2o1xD           ------------PKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRI
2o1sA           ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------
2ozlB           ----------------------------------------------------------------------
3exeB           ----------------------------------------------------------------------
1ik6A           ----------------------------------------------------------------------
1olxB           ----------------------------------------------------------------------
1wciB           ----------------------------------------------------------------------
1u5bB           ----------------------------------------------------------------------
1olsB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
1w88F           ----------------------------------------------------------------------
1umdB           ----------------------------------------------------------------------
1w88H           ----------------------------------------------------------------------
1w85B           ----------------------------------------------------------------------
1gpuA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
1ni4B           ----------------------------------------------------------------------
1itzA           -----------------------LEKSVNTIRFLAIDAVEKANGHPGLPMGCAPMGHVLYYWFN--RDRF
1qs0B           ----------------------------------------------------------------------
3hylA           ----------------------------------------------------------------------
2r8oB           ----------------------------------------------------------------------
2r8oA           ----------------------------------------------------------------------
2r5nB           ----------------------------------------------------------------------
2r5nA           ----------------------------------------------------------------------
1qgdA           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ---------VDSTQELRLLPKESLPKLCDELRRYLLD-----------GLGTVELTVALHYVYNTPFDQL
2o1sB           ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLL------------GLGTVELTVALHYVYNTPFDQL


                         .         .         *         .         .         .         .:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
2o1xB           LFDVGHQAYAHKILTGRRDQMADIKKEGGISGFTKVSESEHDAITVGHASTSLTNALGMALARDAQGKDF
2o1xA           LFDVGHQAYAHKILTGRRDQMADIKKEGGISGFTKVSESEHDAITVGHASTSLTNALGMALARDAQGKDF
2o1sC           IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
2o1xC           LFDVGHQAYAHKILTGRRDQMADIKKEGGISGFTKVSESEHDAITVGHASTSLTNALGMALARDAQGKDF
2o1xD           LFDVGHQAYAHKILTGRRDQMADIKKEGGISGFTKVSESEHDAITVGHASTSLTNALGMALARDAQGKDF
2o1sA           IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------
2ozlB           ----------------------------------------------------------------------
3exeB           ----------------------------------------------------------------------
1ik6A           ----------------------------------------------------------------------
1olxB           ----------------------------------------------------------------------
1wciB           ----------------------------------------------------------------------
1u5bB           ----------------------------------------------------------------------
1olsB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
1w88F           ----------------------------------------------------------------------
1umdB           ----------------------------------------------------------------------
1w88H           ----------------------------------------------------------------------
1w85B           ----------------------------------------------------------------------
1gpuA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
1ni4B           ----------------------------------------------------------------------
1itzA           VLSAGHGCYALLHLAGKEEDLKQFRQGSRTPGHPENFETPGVEVTTGPLGQGIANAVGLALAEKLAARFN
1qs0B           ----------------------------------------------------------------------
3hylA           ----------------------------------------------------------------------
2r8oB           ----------------------------------------------------------------------
2r8oA           ----------------------------------------------------------------------
2r5nB           ----------------------------------------------------------------------
2r5nA           ----------------------------------------------------------------------
1qgdA           ----------------------------------------------------------------------
1w85G           ---------------------------------------------------------------KMRGKKA
1w85C           ---------------------------------------------------------------KMRGKKA
1w85A           ---------------------------------------------------------------KMRGKKA
3dv0G           ---------------------------------------------------------------KMRGKKA
3dv0E           ---------------------------------------------------------------KMRGKKA
3dv0C           ---------------------------------------------------------------KMRGKKA
3dv0A           ---------------------------------------------------------------KMRGKKA
1w88C           ---------------------------------------------------------------KMRGKKA
1w88A           ---------------------------------------------------------------KMRGKKA
3dvaE           ---------------------------------------------------------------KMRGKKA
3dvaA           ---------------------------------------------------------------KMRGKKA
2o1sD           IWDVGHQAYPHKILTG----------------------SEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
2o1sB           IWDVGHQAYPHKILT---------------HPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR


                         +         .         .         .         .         *         .:210
query           NIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKL
2o1xB           HVAAVIGDGSLTGGMALAALNTIGDMGRKMLIVLNDNEMSISENVGAMNK--------------------
2o1xA           HVAAVIGDGSLTGGMALAALNTIGDMGRKMLIVLNDNEMSISENVGAMNKFMS-----------------
2o1sC           RTVCVIGDGAITAG-AFEA-NHAGDIRPD-LVILNDNEGTLFEELG------------------------
2o1xC           HVAAVIGDGSLTGGMALAALNTIGDMGRKMLIVLNDNEMSISENVNP-----------------------
2o1xD           HVAAVIGDGSLTGGMALAALNTIGDMGRKMLIVLNDNEM-----------------------SISEN---
2o1sA           RTVCVIGDGAITAG-AFEA-NHAGDIRPD-LVILNDNE--------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------
2ozlB           ----------------------------------------------------------------------
3exeB           ----------------------------------------------------------------------
1ik6A           ----------------------------------------------------------------------
1olxB           ----------------------------------------------------------------------
1wciB           ----------------------------------------------------------------------
1u5bB           ----------------------------------------------------------------------
1olsB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
1w88F           ----------------------------------------------------------------------
1umdB           ----------------------------------------------------------------------
1w88H           ----------------------------------------------------------------------
1w85B           ----------------------------------------------------------------------
1gpuA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
1ni4B           ----------------------------------------------------------------------
1itzA           KTYVILGDGCQMEGIANEACSLAGHGLGKLIAFYDDNHISVSTRFEALGWHTIWVKNGNTYDDIRAAIKE
1qs0B           ----------------------------------------------------------------------
3hylA           ----------------------------------------------------------------------
2r8oB           ----------------------------------------------------------------------
2r8oA           ----------------------------------------------------------------------
2r5nB           ----------------------------------------------------------------------
2r5nA           ----------------------------------------------------------------------
1qgdA           ----------------------------------------------------------------------
1w85G           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
1w85C           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
1w85A           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
3dv0G           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
3dv0E           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
3dv0C           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
3dv0A           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
1w88C           VAITYTGDGGTSQGNFYQGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
1w88A           VAITYTGDGGTSQGNFYQGINFAGAFKAPAIFVVQNNRFAISTPV-------------------------
3dvaE           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPV-------------------------
3dvaA           VAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPV-------------------------
2o1sD           RTVCVIGDGAITAG-AFEA-NHAGDIRPD-LVILNDNTL-------------------------------
2o1sB           RTVCVIGDGAITAG-AFEA-NHAGDIRPD-LVILNDN---------------------------------


                         .         .         .         +         .         .         .:280
query           IVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIK
2o1xB           ------------------FMRASVNP---FAAMGVRYVGPVDGHNVQELVWLLERLVDL--DGPTILHIV
2o1xA           -VNPFA-------------------------AMGVRYVGPVDGHNVQELVWLLERLVDL--DGPTILHIV
2o1sC           -----------------------------FNYIG-----PVDGHDVLGLITTLKN-RDLK--GPQFLHI-
2o1xC           -----------------------------FAAMGVRYVGPVDGHNVQELVWLLERLVDL--DGPTILHIV
2o1xD           VVNPFA-------------------------AMGVRYVGPVDGHNVQELVWLLERLVDL--DGPTILHIV
2o1sA           --------------------------GTLFEELGFNYIGPVDGHDVLGLITTLKN-RDLK--GPQFLHI-
2o1sD           ---------------------------TLFEELGFNYIGPVDGHDVLGLITTLKN-RDLK--GPQFLHI-
2o1sB           -----------------------ILNDNLFEELGFNYIGPVDGHDVLGLITTLKN-RDLK--GPQFLHI-
2ozlB           ----------------------------------------------------------------------
3exeB           ----------------------------------------------------------------------
1ik6A           ----------------------------------------------------------------------
1olxB           ----------------------------------------------------------------------
1wciB           ----------------------------------------------------------------------
1u5bB           ----------------------------------------------------------------------
1olsB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
1w88F           ----------------------------------------------------------------------
1umdB           ----------------------------------------------------------------------
1w88H           ----------------------------------------------------------------------
1w85B           ----------------------------------------------------------------------
1gpuA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
1ni4B           ----------------------------------------------------------------------
1itzA           AKAVTDKPTLIKVNKANSYVHGSALGAKEVEATRQNLGWPYD----TFFVPEDVKSHWSRHTPEGAALEA
1qs0B           ----------------------------------------------------------------------
3hylA           ----------------------------------------------------------------------
2r8oB           ----------------------------------------------------------------------
2r8oA           ----------------------------------------------------------------------
2r5nB           ----------------------------------------------------------------------
2r5nA           ----------------------------------------------------------------------
1qgdA           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TQKGKGYSYAEKASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG
2o1xB           TTKGKGLSYAEADPIYWHGPAKFDPATGEYVPSSAY--SWSAAFGEAVTEWAKTDPRTFVVTPAMREGSG
2o1xA           TTKGKGLSYAEADPIYWHGPAKFDPATGEYVPSSAY--SWSAAFGEAVTEWAKTDPRTFVVTPAMREGSG
2o1sC           TKKGRGYEPA--------------------------LPSYSKIFGDWLCETAAKDNK-LAITPARE-GSG
2o1xC           TTKG-AYSWSA-------------------------------AFGEAVTEWAKTDPRTFVVTPAMREGSG
2o1xD           TTKG-AYSWSA-------------------------------AFGEAVTEWAKTDPRTFVVTPAMREGSG
2o1sA           TKKGRGYEPA--------------------------LPSYSKIFGDWLCETAAKDNKLA-ITPAREG-SG
2o1sD           ----------------------------------TKLPSYSKIFGDWLCETAAKDNKLA-ITPAREG-SG
2o1sB           ----------------------------------TKLPSYSKIFGDWLCETAAKDNKLA-ITPAREG-SG
2ozlB           ----------------------------------------------------ERDEKVLGEEVAQYDGAS
3exeB           ----------------------------------------------------ERDEKVLGEEVAQYDGAS
1ik6A           ----------------------------------------------------------------------
1olxB           ----------------------------------------------------------------------
1wciB           ----------------------------------------------------------------------
1u5bB           ----------------------------------------------------------------------
1olsB           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------
2bfcB           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
1w88F           ----------------------------------------------------------------------
1umdB           ---------------------------------------------------------VLGEDVGKRGGVF
1w88H           ----------------------------------------------------------------------
1w85B           ----------------------------------------------------------------------
1gpuA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
1ni4B           ----------------------------------------------------ERDEKVLGEEVAQYDGAS
1itzA           DWNAKFAEYEKKYADD--AATLKSIITGELPTGWVDLPKYTPESPGDATRNLSQQNALANVVPGLIGGSA
1qs0B           ----------------------------------------------------------------------
3hylA           ----------------------------------------------------------------------
2r8oB           --------------------------------------------------------------------SG
2r8oA           --------------------------------------------------------------------SG
2r5nB           --------------------------------------------------------------------SG
2r5nA           --------------------------------------------------------------------SG
1qgdA           --------------------------------------------------------------------SG
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA
2o1xB           LVEFSRVHPHRYLDVGIAEEVAVTTAAGMALQGMRPVVAIYSTFLQRAYDQVLHDVAIEHLNVTFCIDRA
2o1xA           LVEFSRVHPHRYLDVGIAEEVAVTTAAGMALQGMRPVVAIYSTFLQRAYDQVLHDVAIEHLNVTFCIDRA
2o1sC           VE-FSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRA
2o1xC           LVEFSRVHPHRYLDVGIAEEVAVTTAAGMALQGMRPVVAIYSTFLQRAYDQVLHDVAIEHLNVTFCIDRA
2o1xD           LVEFSRVHPHRYLDVGIAEEVAVTTAAGMALQGMRPVVAIYSTFLQRAYDQVLHDVAIEHLNVTFCIDRA
2o1sA           VE-FSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRA
2o1sD           VE-FSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRA
2o1sB           VE-FSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRA
2ozlB           RGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTNFSMQAIDQVINSAALQPVPIVFRGPNG
3exeB           RGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTNFSMQAIDQVINSAALQPVPIVFRGPNG
1ik6A           --------PERVIDTPLNEGGILGFAMGMAMAGLKPVAEIQFVL---GADELLNHIAKLRYKAPLVV---
1olxB           ----------------------------------------FADYIFPAFDQIVNEAACGSLTIR---SPW
1wciB           ----------------------------------------FADYIFPAFDQIVNEAACGSLTIR---SPW
1u5bB           ----------------------------------------FADYIFPAFDQIVNEAACGSLTIR---SPW
1olsB           ----------------------------------------FADYIFPAFDQIVNEAACGSLTIR---SPW
1dtwB           ----------------------------------------FADYIFPAFDQIVNEAACGSLTIR---SPW
2bfcB           ----------------------------------------FADYIFPAFDQIVNEAACGSLTIR---SPW
2bp7B           ----------RVFDAPISESGIVGTAVGMGAYGLRPVVEIFADYFYPASDQIVSEMAIAPLTLRMPCG-G
1w88F           ----------RVFDTPLAESXXXXXXXXXXXQGFRPVPEIY---------EVMDSICGQMARIRY---RT
1umdB           LGLLQKYGPDRVMDTPLSEXXXXXXXXXXXXHGLRPVAEIFADYIFPGFDQLVSQVAVVRMPSXXXXXXX
1w88H           ----------------------------------------------------------------------
1w85B           ----------------------------------------------------------------------
1gpuA           ------NYSGRYIRYGIREHAMGAIMNGISAFGYKPYGGTFLNFVSYAAG-AVRLSALSGHPVIWVATHD
1ay0A           ------NYSGRYIRYGIREHAMGAIMNGISAFGYKPYGGTFLNFVSYAAG-AVRLSALSGHPVIWVATHD
1ni4B           RGLWKKYGDKRIIDTPISEXXXXXXXXXXXX--LRPICEFTFNFSQ-AIDQVINSAALQPVPIVFRGPNG
1itzA           LKMFG-DFQKRNVRFGVREHGMGAICNGIASPGFVPYCATFFVFT----DYMRGAMRISALSEAGVIDSI
1qs0B           ----------RVFDAPISESGIVGTAVGGAY-GLRPVVEIFADYFYPASDQIVSEARLRYAPLTLRPCGG
3hylA           --------------------NGIALHGGLKTYGGTFFV--FSDYLRPAIR-----LAALQLPVTYVFTHD
2r8oB           SKAINEDAAGNYIHYGVREFGMTAIANGISLHGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMYTHDSI
2r8oA           SKAINEDAAGNYIHYGVREFGMTAIANGISLHGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMYTHDSI
2r5nB           SKAINEDAAGNYIHYGVREFGMTAIANGISLHGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMYTHDSI
2r5nA           SKAINEDAAGNYIHYGVREFGMTAIANGISLHGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMYTHDSI
1qgdA           SKAINEDAAGNYIHYGVREFGMTAIANGISLHGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMYTHDSI
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDE
2o1xB           GIVGADGATHNGVFDLSFLRSIPGVRIGLPKDAAELRGMLKYAQT-HDGPFAIRYPRGNTAQVPAGTWPD
2o1xA           GIVGADGATHNGVFDLSFLRSIPGVRIGLPKDAAELRGMLKYAQT-HDGPFAIRYPRGNTAQVPAGTWPD
2o1sC           GIVGADGQTHQGAFDLSYLRCIPE--VITPSDENE-CRQLYTGYHYNDGPSAVRYPRGNAVGVELTPL-E
2o1xC           GIVGADGATHNGVFDLSFLRSIPGVRIGLPKDAAELRGMLKYAQT-HDGPFAIRYPRGNTAQVPAGTWPD
2o1xD           GIVGADGATHNGVFDLSFLRSIPGVRIGLPKDAAELRGMLKYAQT-HDGPFAIRYPRGNTAQVPAGTWPD
2o1sA           GIVGADGQTHQGAFDLSYLRCIPE--VITPSDENE-CRQLYTGYHYNDGPSAVRYPRGNAVGVELTPL-E
2o1sD           GIVGADGQTHQGAFDLSYLRCIPE--VITPSDENE-CRQLYTGYHYNDGPSAVRYPRGNAVGVELTPL-E
2o1sB           GIVGADGQTHQGAFDLSYLRCIPE--VITPSDENE-CRQLYTGYHYNDGPSAVRYPRGNAVGVELTPL-E
2ozlB           ASAGV-AAQHSQCFAAWY-GHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPSKDF
3exeB           ASAGV-AAQHSQCFAAWY-GHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPSKDF
1ik6A           -------RTPVGSPEAIFVHT-PGLVVVMPSTPYNAKGLLKAAIR-GDDPVVFLEPKYRAPREEVPEGDY
1olxB           GCVG-HGALYASQSPEAFFAHCPGIKVVIPRSPFQ-AKGLLLSCIEDKNPCIFFEPKYRAAAEEVPIEPY
1wciB           GCVGHGALYHSQSPE-AFFAHCPGIKVVIPRSPFQ-AKGLLLSCIEDKNPCIFFEPKYRAAAEEVPIEPY
1u5bB           GCVGHGALYHSQSPE-AFFAHCPGIKVVIPRSPFQ-AKGLLLSCIEDKNPCIFFEPKYRAAAEEVPIEPY
1olsB           GCVGHGALYHSQSPE-AFFAHCPGIKVVIPRSPFQ-AKGLLLSCIEDKNPCIFFEPKYRAAAEEVPIEPY
1dtwB           GCVGHGALYHSQSPE-AFFAHCPGIKVVIPRSPFQ-AKGLLLSCIEDKNPCIFFEPKYRAAAEEVPIEPY
2bfcB           GCVGHGALYHSQSPE-AFFAHCPGIKVVIPRSPFQ-AKGLLLSCIEDKNPCIFFEPKYRAAAEEVPIEPY
2bp7B           GIYG--GQTHSQSPEAMFTQVCGLRTVM-PSNPYDAKGLLIASIECDD-PVIFLEPKRLYNGPAVPDGYY
1w88F           GITIRSPFGHSDSLE-GLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEHLKYRSFRQEVPEGEY
1umdB           XXXSQSPEAH-----FVHTAGLKVVAVSTPYDAKGLLK----AAIRDEDPVVFLEPKRRSVKEEVPEEDY
1w88H           ---------------------------------------------------------------EVPEGEY
1w85B           ---------------------------------------------------------------EVPEGEY
1gpuA           SIVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIES
1ay0A           SIVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIES
1ni4B           ASAGV-AAQHSQCFAAWY-GHCPGLKVVSPWNSEDAKGLIKSAIRDNN-PVVVLENELYGVPFEFPSKDF
1itzA           GL-GEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKLPHLPGTSI-E
1qs0B           GIYG--GQTHSQSPEVCGLRTVPSNPLLIASIECDDPVIFLEPKRLYNGPFDGHHDRSKHPHSAVPDGYY
3hylA           SIVGEDGPTHEPIEQLAALRA-PNVSVIRPADGNESVAAWRLALESTNKPTALVLTRQDLPTLEGAKDDT
2r8oB           GL-GEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQN-LAQQERTEEQ
2r8oA           GL-GEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQN-LAQQERTEEQ
2r5nB           GL-GEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQN-LAQQERTEEQ
2r5nA           GL-GEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQN-LAQQERTEEQ
1qgdA           GL-GEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQN-LAQQERTEEQ
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMIT
2o1xB           -LKWGEWERLKGGDDVVILAGGKALDYALKAAEDLPGVG----VVNARFVKPLDEEMLREVGGRARALIT
2o1xA           -LKWGEWERLKGGDDVVILAGGKALDYALKAAEDLPGVG----VVNARFVKPLDEEMLREVGGRARALIT
2o1sC           KLPIGKGIVKRRGEKLAILNFGTLPEAAKVA------ESLNATLVD-RFVKPLDEALILEAA-SHEALVT
2o1xC           -LKWGEWERLKGGDDVVILAGGKALDYALKAAEDLPGVG----VVNARFVKPLDEEMLREVGGRARALIT
2o1xD           -LKWGEWERLKGGDDVVILAGGKALDYALKAAEDLPGVG----VVNARFVKPLDEEMLREVGGRARALIT
2o1sA           KLPIGKGIVKRRGEKLAILNFGTLPEAAKVA------ESLNATLVD-RFVKPLDEALILEAA-SHEALVT
2o1sD           KLPIGKGIVKRRGEKLAILNFGTLPEAAKVA------ESLNATLVD-RFVKPLDEALILEAA-SHEALVT
2o1sB           KLPIGKGIVKRRGEKLAILNFGTLPEAAKVA------ESLNATLVD-RFVKPLDEALILEAA-SHEALVT
2ozlB           LIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVT
3exeB           LIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVT
1ik6A           VVEIGKARVAREGDDVTLVTYGAVVHKA-LEAAERVKASVE--VVDLQTLNPLDFDTVLKSVSKTGRLII
1olxB           NIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVKTGRLLIS
1wciB           NIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVKTGRLLIS
1u5bB           NIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVKTGRLLIS
1olsB           NIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVKTGRLLIS
1dtwB           NIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVKTGRLLIS
2bfcB           NIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKGVSCEVIDLRTIIPWDVDTICKSVKTGRLLIS
2bp7B           TVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAEE---SGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVV
1w88F           TIPIGKADIKREGKDITIIAYGAMVHESXXXXXXXXXXGISAEVVDLRTVQPLDIETIIGSVEKTGRAIV
1umdB           TLPIGKAALRREGKDLTLICYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVL
1w88H           TIPIGKADIKREGKDITIIAYGAMVHESXXXXXXXXXXGISAEVVDLRTVQPLDIETIIGSVEKTGRAIV
1w85B           TIPIGKADIKREGKDITIIAYGAMVHESXXXXXXXXXXGISAEVVDLRTVQPLDIETIIGSVEKTGRAIV
1gpuA           ASK--GGYVLQDNPDIILVATGSEVSLSVEAAKTLAAKNIKARVV-------------------------
1ay0A           ASK--GGYVLQDNPDIILVATGSEVSLSVEAAKTLAAKNIKARVV-------------------------
1ni4B           LIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVIN-RTIRP-DETIEASVKTNH--LVT
1itzA           GVEKG-GYTISDNSDLIVMGTGSELEIAAKAADELRKEGKTVRVVSFVSWELFDEESVLPAA--VTARIS
1qs0B           TVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAEE---SGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVV
3hylA           YEKVAKGAYVKETADVILLATGSEVSLAVEAQKALAVDGVDASVV-------------------------
2r8oB           LANIARGGYVLKDPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQ--------------
2r8oA           LANIARGGYVLKDPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQ--------------
2r5nB           LANIARGGYVLKDPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQ--------------
2r5nA           LANIARGGYVLKDPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQ--------------
1qgdA           LANIARGGYVLKDPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQ--------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDIxxxxx
2o1xB           VEDNTVGGFGGAVLEALNSMNLHP---TVRVLGIPDEFQEHATAESVHARAGIDAPAIRTVLAEL-----
2o1xA           VEDNTVGGFGGAVLEALNSMNLHP---TVRVLGIPDEFQEHATAESVHARAGIDAPAIRTVLAEL-----
2o1sC           VEENAIGGAGSGVNEVLAHR----KPVPVLNIGLPDFFIPQGTQEERAEL-GLDAAGEAK----------
2o1xC           VEDNTVGGFGGAVLEALNSMNLHP---TVRVLGIPDEFQEHATAESVHARAGIDAPAIRTVLAEL-----
2o1xD           VEDNTVGGFGGAVLEALNSMNLHP---TVRVLGIPDEFQEHATAESVHARAGIDAPAIRTVLAEL-----
2o1sA           VEENAIGGAGSGVNEVLAHR----KPVPVLNIGLPDFFIPQGTQEERAEL-GLDAAGEAK----------
2o1sD           VEENAIGGAGSGVNEVLAHR----KPVPVLNIGLPDFFIPQGTQEERAEL-GLDAAGEAK----------
2o1sB           VEENAIGGAGSGVNEVLAHR----KPVPVLNIGLPDFFIPQGTQEERAEL-GLDAAGEAK----------
2ozlB           VEGG------------------------------------------------------------------
3exeB           VEGG------------------------------------------------------------------
1ik6A           AHDSKTGGLGAEVRALVAEKAL------------------------------------------------
1olxB           HEAPLTGGFASEISSTVQEE--------------------------------------------------
1wciB           HEAPLTGGFASEISSTVQEE--------------------------------------------------
1u5bB           HEAPLTGGFASEISSTVQEE--------------------------------------------------
1olsB           HEAPLTGGFASEISSTVQEE--------------------------------------------------
1dtwB           HEAPLTGGFASEISSTVQEE--------------------------------------------------
2bfcB           HEAPLTGGFASEISSTVQEE--------------------------------------------------
2bp7B           VHEATTCGFGAELVSLVQE---------------------------------------------------
1w88F           VQEAQQAGIAANVVAEINERAILSLEAPVLRVAAPD----------------------------------
1umdB           VSD-------------------------------------------------------------------
1w88H           VQEAQQAGIAANVVAEINERAILSLEAPVLRVAAPD----------------------------------
1w85B           VQEAQQAGIAANVVAEINERAILSLEAPVLRVAAPD----------------------------------
1gpuA           ----------------------------------------------------------------------
1ay0A           ----------------------------------------------------------------------
1ni4B           VEGG------------------------------------------------------------------
1itzA           IEAGSTLGWQKYV---------------------------------------------------------
1qs0B           VHEATTCGFGAELVSLVQE---------------------------------------------------
3hylA           ----------------------------------------------------------------------
2r8oB           ----------------------------------------------------------------------
2r8oA           ----------------------------------------------------------------------
2r5nB           ----------------------------------------------------------------------
2r5nA           ----------------------------------------------------------------------
1qgdA           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
1w85A           ----------------------------------------------------------------------
3dv0G           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
1w88C           ----------------------------------------------------------------------
1w88A           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
2o1sD           ----------------------------------------------------------------------
2o1sB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxx
2o1xB           -------
2o1xA           -------
2o1sC           -------
2o1xC           -------
2o1xD           -------
2o1sA           -------
2o1sD           -------
2o1sB           -------
2ozlB           -------
3exeB           -------
1ik6A           -------
1olxB           -------
1wciB           -------
1u5bB           -------
1olsB           -------
1dtwB           -------
2bfcB           -------
2bp7B           -------
1w88F           -------
1umdB           -------
1w88H           -------
1w85B           -------
1gpuA           -------
1ay0A           -------
1ni4B           -------
1itzA           -------
1qs0B           -------
3hylA           -------
2r8oB           -------
2r8oA           -------
2r5nB           -------
2r5nA           -------
1qgdA           -------
1w85G           -------
1w85C           -------
1w85A           -------
3dv0G           -------
3dv0E           -------
3dv0C           -------
3dv0A           -------
1w88C           -------
1w88A           -------
3dvaE           -------
3dvaA           -------
2o1sD           -------
2o1sB           -------