[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:AAZ21453.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r5tA.bssp"
#ERROR : Can't open dsspfile "3hdnA.bssp"
#ERROR : Can't open dsspfile "3hdmA.bssp"

## Summary of PDB Search
:430
    7e-04  33%  2r5tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    7e-04  33%  3hdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    7e-04  33%  3hdmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
:430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r5tA           ----------------------------------------------------------------------
3hdnA           ----------------------------------------------------------------------
3hdmA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVYYSWKIFDKK
2r5tA           -----------------------------------------------------------VFYAVKVLQKK
3hdnA           -----------------------------------------------------------VFYAVKVLQKK
3hdmA           -----------------------------------------------------------VFYAVKVLQKK


                         +         .         .         .         .         *         .:210
query           VINFKHCFLLGVFAAVGFLSKYLFVYLLISIVLLFFYIIFVKKYQKFDFKYLISFEVFIVLLIPHLIWLT
2r5tA           AINVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLCFLEPRARFALGYLHSLNIVYRDLKPENILLD
3hdnA           AINVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLCFLEPRARFALGYLHSLNIVYRDLKPENILLD
3hdmA           AINVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLCFLEPRARFALGYLHSLNIVYRDLKPENILLD


                         .         .         .         +         .         .         .:280
query           NNDYITITYGLARTGLETSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r5tA           SQGHIVLTFGLCKENIEHNS--------------------------------------------------
3hdnA           SQGHIVLTFGLCKENIEHNS--------------------------------------------------
3hdmA           SQGHIVLTFGLCKENIEHNS--------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r5tA           ----------------------------------------------------------------------
3hdnA           ----------------------------------------------------------------------
3hdmA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r5tA           ----------------------------------------------------------------------
3hdnA           ----------------------------------------------------------------------
3hdmA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxx
2r5tA           ----------
3hdnA           ----------
3hdmA           ----------