[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:mucA

[Show Plain Result]

#ERROR : Can't open dsspfile "1jhhA.bssp"
#ERROR : Can't open dsspfile "1jhcA.bssp"
#ERROR : Can't open dsspfile "1jheA.bssp"
#ERROR : Can't open dsspfile "1jhfA.bssp"
#ERROR : Can't open dsspfile "1jhfB.bssp"
#ERROR : Can't open dsspfile "1jhhB.bssp"
#ERROR : Can't open dsspfile "1i4vA.bssp"
#ERROR : Can't open dsspfile "1ay9A.bssp"
#ERROR : Can't open dsspfile "1umuB.bssp"
#ERROR : Can't open dsspfile "1umuA.bssp"

## Summary of PDB Search
:131
    4e-11  37%  1jhhA  [a.4.5 - b.87.1] LEXA REPRESSOR
    4e-11  37%  1jhcA  [b.87.1] LEXA REPRESSOR
    9e-11  37%  1jheA  [b.87.1] LEXA REPRESSOR
    1e-10  37%  1jhfA  [a.4.5 - b.87.1] LEXA REPRESSOR
    6e-10  42%  1jhfB  [b.87.1] LEXA REPRESSOR
    1e-09  40%  1jhhB  [b.87.1] LEXA REPRESSOR
    4e-09  28%  1i4vA  [b.87.1] UMUD' PROTEIN
    7e-06  25%  1ay9A  [b.87.1] UMUD PROTEIN
    9e-05  25%  1umuB  [b.87.1] UMUD'
    9e-05  25%  1umuA  [b.87.1] UMUD'
:131

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKP
1jhhA           ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMAMKDIGIMDGDLLAVHKTQDV
1jhcA           ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMAMKDIGIMDGDLLAVHKTQDV
1jheA           ----------RVAAGEPLPAQWHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
1jhfA           ----------RVAADEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
1jhfB           ---------------------------------------ADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
1jhhB           ---------------------------------------ADFLLRVSGMAMKDIGIMDGDLLAVHKTQDV
1i4vA           ---------------FPSPAADYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXXVDSAITA
1ay9A           ---------------------DYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXXVDSAITA
1umuB           ---------------------DYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXV-DSAITA
1umuA           ---------------------DYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXV-DSAITA


                         .         .         *         .         .         .         .:140
query           KNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIxxxx
1jhhA           RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
1jhcA           RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
1jheA           RNGQVVVARIDDAVTVARL--KKQGNKVELLPENSEFKPIVVD------------------
1jhfA           RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
1jhfB           RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
1jhhB           RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
1i4vA           SHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNS--AYSPITISSEDTLDVFGVVIHVV----
1ay9A           SHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNS--AYSPITISSEDTLDVFGVVIHVV----
1umuB           SHGDIVIAAVDGEFTVKKLQLRPTVQLIPNSAYS---PITISSEDTLDVFGVVIHVV----
1umuA           SHGDIVIAAVDGEFTVKKLQLRPTVQLIPNSAYS---PITISSEDTLDVFGVVIHVV----