[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:hpaG

[Show Plain Result]

#ERROR : Can't open dsspfile "1gttA.bssp"
#ERROR : Can't open dsspfile "1wzoB.bssp"
#ERROR : Can't open dsspfile "1wzoA.bssp"
#ERROR : Can't open dsspfile "1wzoC.bssp"
#ERROR : Can't open dsspfile "1sawB.bssp"
#ERROR : Can't open dsspfile "1sawA.bssp"
#ERROR : Can't open dsspfile "2dfuA.bssp"
#ERROR : Can't open dsspfile "2dfuB.bssp"
#ERROR : Can't open dsspfile "2dfuD.bssp"
#ERROR : Can't open dsspfile "1nr9D.bssp"
#ERROR : Can't open dsspfile "1nr9C.bssp"
#ERROR : Can't open dsspfile "1nr9B.bssp"
#ERROR : Can't open dsspfile "1nr9A.bssp"
#ERROR : Can't open dsspfile "1nkqE.bssp"
#ERROR : Can't open dsspfile "1nkqA.bssp"
#ERROR : Can't open dsspfile "1nkqB.bssp"
#ERROR : Can't open dsspfile "1nkqC.bssp"
#ERROR : Can't open dsspfile "1nkqF.bssp"
#ERROR : Can't open dsspfile "2q18X.bssp"
#ERROR : Can't open dsspfile "2q19X.bssp"
#ERROR : Can't open dsspfile "2q1dX.bssp"
#ERROR : Can't open dsspfile "2q1aX.bssp"

## Summary of PDB Search
:281
    2e-26  35%  1gttA  [d.177.1 - d.177.1] 4-HYDROXYPHENYLACETATE DEGRADATION
    7e-26  34%  1wzoB  [x.x.x] HPCE
    7e-26  34%  1wzoA  [x.x.x] HPCE
    2e-25  34%  1wzoC  [x.x.x] HPCE
    3e-21  33%  1sawB  [d.177.1] HYPOTHETICAL PROTEIN FLJ36880
    3e-21  33%  1sawA  [d.177.1] HYPOTHETICAL PROTEIN FLJ36880
    3e-19  33%  2dfuA  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    5e-19  33%  2dfuB  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    6e-18  34%  2dfuD  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    3e-12  30%  1nr9D  [d.177.1] PROTEIN YCGM
    3e-12  30%  1nr9C  [d.177.1] PROTEIN YCGM
    3e-12  30%  1nr9B  [d.177.1] PROTEIN YCGM
    3e-12  30%  1nr9A  [d.177.1] PROTEIN YCGM
    2e-09  35%  1nkqE  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    2e-09  35%  1nkqA  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    3e-09  35%  1nkqB  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    4e-09  35%  1nkqC  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    7e-08  35%  1nkqF  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    7e-05  29%  2q18X  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
    1e-04  29%  2q19X  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
    5e-04  29%  2q1dX  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
    8e-04  29%  2q1aX  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXXXRIGSCISKP
1gttA           ----------------------------------------------------------------------
1wzoB           ---------------------------------------------------------------------P
1wzoA           ---------------------------------------------------------------------P
1wzoC           ---------------------------------------------------------------------P
1sawB           ----------------------------------------------------------------------
1sawA           ----------------------------------------------------------------------
2dfuA           ---------------------------------------------------------------------P
2dfuB           ----------------------------------------------------------------------
2dfuD           ----------------------------------------------------------------------
1nr9D           ----------------------------------------------------------------------
1nr9C           ----------------------------------------------------------------------
1nr9B           ----------------------------------------------------------------------
1nr9A           ----------------------------------------------------------------------
1nkqE           ----------------------------------------------------------------------
1nkqA           ----------------------------------------------------------------------
1nkqB           ----------------------------------------------------------------------
1nkqC           ----------------------------------------------------------------------
1nkqF           ----------------------------------------------------------------------
2q18X           MKLFRVVKRGYYISYALDNSTIIRLDEDPIKALMRYSENKEVLDRVTDYQSLLKSFQINDIRITKPIDPP
2q19X           MKLFRVVKRGYYISYALDNSTIIRLDEDPIKALMRYSENKEVLDRVTDYQSLLKSFQINDIRITKPIDPP
2q1dX           MKLFRVVKRGYYISYALDNSTIIRLDEDPIKALMRYSENKEVLDRVTDYQSLLKSFQINDIRITKPIDPP
2q1aX           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
1gttA           GTLFALGLNYADH--------PEEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVVIGKQARNVSE
1wzoB           GKILGVALNY--------ASRPEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRA
1wzoA           GKILGVALNYA------GLSRPEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRA
1wzoC           GKILGVALNYAR---------PEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRA
1sawB           -NIVCVGRNYASE-----------PVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPE
1sawA           -NIVCVGRNYASE-----------PVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPE
2dfuA           TKIVCVGRNY---------RLPKEPGLFLKGPNALARPGEPVPYPFFTEELHYEGELAVVVGDRMRHVPP
2dfuB           -----------------GRNYPKEPGLFLKGPNALARPGEPVPYPFFTEELHYEGELAVVVGDRMRHVPP
2dfuD           ------------------------------------GTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPP
1nr9D           ---------------------PEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQATE
1nr9C           ---------------------PEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQATE
1nr9B           ---------------------PEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQATE
1nr9A           ---------------------PEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQATE
1nkqE           -----IGRNYAAHIKELN----NQPFFFLKPTSSIVTPNPGPIFIPRGVKVHHEIELALIVSKHLSNVTK
1nkqA           -----IGRNYAAHIKELN----NQPFFFLKPTSSIVTPNPGPIFIPRGVKVHHEIELALIVSKHLSNVTK
1nkqB           -----IGRNYAAHIKEL------QPFFFLKPTSSIVTPNPGPIFIPRGVKVHHEIELALIVSKHLSNVTK
1nkqC           -----IGRNYAAHIKEL------QPFFFLKPTSSIVTPNPGPIFIPRGVKVHHEIELALIVSKHLSNVTK
1nkqF           -----IGRNYAAH----------QPFFFLKPTSSIVTPNPGPIFIPRGVKVHHEIELALIVSKHLSNVTK
2q18X           -EVWGSGISYENVAKILGKTIYEKEIFFKATPNRCVGHGEAIAVRSDSEWTLPEPELAVVLDSNGK----
2q19X           -EVWGSGISYEMVAKILGKTIYEKEIFFKATPNRCVGHGEAIAVRSDSEWTLPEPELAVVLDSNGK----
2q1dX           -EVWGSGISYTIYEKVYDAVRPE--IFFKATPNRCVGHGEAIAVRSDSEWTLPEPELAVVLDSNGK----
2q1aX           -------------------------IFFKATPNRCVGHGEAIAVRSDSEWTLPEPELAVVLDSNGK----


                         +         .         .         .         .         *         .:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQXXXXXXXXXXXXGHRHQT
1gttA           ADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLSTIVPKEAIPDPHNLTLRTFVNGELRQQ
1wzoB           KDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFLPLGPFLVV-EEVEDPQDLWLRAYVNGELRQE
1wzoA           KDALDYVLGYTIANDLVARDYVRPP----IRAKGRDTFLPLGPFLVV-EEVEDPQDLWLRAYVNGELRQE
1wzoC           KDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFLPLGPFLVV-EEVEDPQDLWLRAYVNGELRQE
1sawB           AAAMDYVGGYALCLDMTARDVQKKKGLPWTLAKSFTASCPVSAF-VPKEKIPDPHKLKLWLKVNGELRQE
1sawA           AAAMDYVGGYALCLDMTARDVQKKKGLPWTLAKSFTASCPVSAF-VPKEKIPDPHKLKLWLKVNGELRQE
2dfuA           EKALDHVLGYTVAVDITARDVQK-KDLQWVRAKSADKFLPLGPWLETDLNPQ---DTWVRTYVNGTLRQE
2dfuB           EKALDHVLGYTVAVDITARDVQK-KDLQWVRAKSADKFLPLGPWLETDLNPQ---DTWVRTYVNGTLRQE
2dfuD           EKALDHVLGYTVAVDITARDVQK-KDLQWVRAKSADKFLPLGPWLETDLNPQ---DTWVRTYVNGTLRQE
1nr9D           EHVRKAIAGYGVALDLTLRDVQKKKAGQWEKAKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQ
1nr9C           EHVRKAIAGYGVALDLTLRDVQKKKAGQWEKAKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQ
1nr9B           EHVRKAIAGYGVALDLTLRDVQKKKAGQWEKAKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQ
1nr9A           EHVRKAIAGYGVALDLTLRDVQKKKAGQWEKAKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQ
1nkqE           KEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTF-PISA-IVSREKFNLQDIFRVKCSVNGQLRQD
1nkqA           KEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTF-PISA-IVSREKFNLQDIFRVKCSVNGQLRQD
1nkqB           KEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTF-PISA-IVSREKFNLQDIFRVKCSVNGQLRQD
1nkqC           KEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTF-PISA-IVSREKFNLQDIFRVKCSVNGQLRQD
1nkqF           KEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTF-PISA-IVSREKFNLQDIFRVKCSVNGQLRQD
2q18X           ------ILGYTIMDDVSARDLEAENPLYLPQSKIYAGCCAFGPVIVTSDEIK------------------
2q19X           ------ILGYTIMDDVSARDLEAENPLYLPQSKIYAGCCAFGPVIVTSDEIK------------------
2q1dX           ------ILGYTIMDDVSARDLEAENPLYLPQSKIYAGCCAFGPVIVTSDEIK------------------
2q1aX           ------ILGYTIMDDVSARDLEAENPLYLPQSKIYAGCCAFGPVIVTSDEIK------------------


                         .         .         .         +         .         .         .:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVxxx
1gttA           GTTADLIFSVPFLIAYLSEFMTLNPGDM------------------------------------------
1wzoB           GHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQ-------VRPGDVMRLEIEGLGALENPI---
1wzoA           GHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQ-------VRPGDVMRLEIEGLGALENPI---
1wzoC           GHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQ-------VRPGDVMRLEIEGLGALENPI---
1sawB           GETSSMIFSIPYIISYVSKIITLEEGDIILTGTPK----GVGP---VKENDEIEAGIHGLVSMTFKV---
1sawA           GETSSMIFSIPYIISYVSKIITLEEGDIILTGTPK----GVGP---VKENDEIEAGIHGLVSMTFKV---
2dfuA           GHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGA-------LRPGDRLEVAVEGVGT--------
2dfuB           GHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGA-------LRPGDRLEVAVEGVGT--------
2dfuD           GHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGA-------LRPGDRLEVAVEGVGT--------
1nr9D           GTTAD-IHKIVPLIAY-SKFFTLKAGDVVLTGTPD----GVGP---LQSGDELTVTFD------------
1nr9C           GTTAD-IHKIVPLIAY-SKFFTLKAGDVVLTGTPD----GVGP---LQSGDELTVTFD------------
1nr9B           GTTAD-IHKIVPLIAY-SKFFTLKAGDVVLTGTPD----GVGP---LQSGDELTVTFD------------
1nr9A           GTTAD-IHKIVPLIAY-SKFFTLKAGDVVLTGTPD----GVGP---LQSGDELTVTFD------------
1nkqE           GGTN-LLHPLHKILQHI-STISLEPGDI------------------------------------------
1nkqA           GGTN-LLHPLHKILQHI-STISLEPGDI------------------------------------------
1nkqB           GGTN-LLHPLHKILQHI-STISLEPGDI------------------------------------------
1nkqC           GGTN-LLHPLHKILQHI-STISLEPGDI------------------------------------------
1nkqF           GGTN-LLHPLHKILQHI-STISLEPGDI------------------------------------------
2q18X           ----------------------------------------------------------------------
2q19X           ----------------------------------------------------------------------
2q1dX           ----------------------------------------------------------------------
2q1aX           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           x
1gttA           -
1wzoB           -
1wzoA           -
1wzoC           -
1sawB           -
1sawA           -
2dfuA           -
2dfuB           -
2dfuD           -
1nr9D           -
1nr9C           -
1nr9B           -
1nr9A           -
1nkqE           -
1nkqA           -
1nkqB           -
1nkqC           -
1nkqF           -
2q18X           -
2q19X           -
2q1dX           -
2q1aX           -