[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:ribD

[Show Plain Result]

#ERROR : Can't open dsspfile "2b3zD.bssp"
#ERROR : Can't open dsspfile "2b3zA.bssp"
#ERROR : Can't open dsspfile "2hxvA.bssp"
#ERROR : Can't open dsspfile "2o7pA.bssp"
#ERROR : Can't open dsspfile "2g6vA.bssp"
#ERROR : Can't open dsspfile "2obcA.bssp"
#ERROR : Can't open dsspfile "2g6vB.bssp"
#ERROR : Can't open dsspfile "2obcB.bssp"
#ERROR : Can't open dsspfile "2o7pB.bssp"
#ERROR : Can't open dsspfile "2b3jD.bssp"
#ERROR : Can't open dsspfile "2b3jC.bssp"
#ERROR : Can't open dsspfile "2b3jA.bssp"
#ERROR : Can't open dsspfile "1vq2A.bssp"
#ERROR : Can't open dsspfile "3dh1D.bssp"
#ERROR : Can't open dsspfile "3dh1B.bssp"
#ERROR : Can't open dsspfile "3dh1A.bssp"
#ERROR : Can't open dsspfile "2w4lC.bssp"
#ERROR : Can't open dsspfile "1wwrD.bssp"
#ERROR : Can't open dsspfile "1wwrC.bssp"
#ERROR : Can't open dsspfile "1wwrB.bssp"
#ERROR : Can't open dsspfile "1wwrA.bssp"
#ERROR : Can't open dsspfile "1z3aA.bssp"
#ERROR : Can't open dsspfile "2w4lD.bssp"
#ERROR : Can't open dsspfile "2w4lE.bssp"
#ERROR : Can't open dsspfile "2w4lB.bssp"
#ERROR : Can't open dsspfile "2nx8A.bssp"
#ERROR : Can't open dsspfile "2w4lF.bssp"
#ERROR : Can't open dsspfile "2w4lA.bssp"
#ERROR : Can't open dsspfile "1tiyB.bssp"
#ERROR : Can't open dsspfile "1tiyA.bssp"
#ERROR : Can't open dsspfile "1wkqB.bssp"
#ERROR : Can't open dsspfile "1wkqA.bssp"

## Summary of PDB Search
:351
    1e-38  32%  2b3zD  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-38  32%  2b3zA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-19  30%  2hxvA  [x.x.x] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE
    2e-18  35%  2o7pA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    4e-18  35%  2g6vA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    3e-17  34%  2obcA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    4e-17  34%  2g6vB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    6e-16  34%  2obcB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    7e-15  35%  2o7pB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    3e-06  34%  2b3jD  [x.x.x] TRNA ADENOSINE DEAMINASE
    3e-06  34%  2b3jC  [x.x.x] TRNA ADENOSINE DEAMINASE
    3e-06  34%  2b3jA  [x.x.x] TRNA ADENOSINE DEAMINASE
    8e-06  48%  1vq2A  [c.97.1] DEOXYCYTIDYLATE DEAMINASE
    1e-05  37%  3dh1D  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    1e-05  37%  3dh1B  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    1e-05  37%  3dh1A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    2e-05  46%  2w4lC  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    3e-05  39%  1wwrD  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    3e-05  39%  1wwrC  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    3e-05  39%  1wwrB  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    3e-05  39%  1wwrA  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    7e-05  27%  1z3aA  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE
    2e-04  46%  2w4lD  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    3e-04  44%  2w4lE  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    3e-04  45%  2w4lB  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    3e-04  36%  2nx8A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE
    6e-04  46%  2w4lF  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    6e-04  46%  2w4lA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    6e-04  35%  1tiyB  [c.97.1] GUANINE DEAMINASE
    6e-04  35%  1tiyA  [c.97.1] GUANINE DEAMINASE
    7e-04  34%  1wkqB  [c.97.1] GUANINE DEAMINASE
    7e-04  34%  1wkqA  [c.97.1] GUANINE DEAMINASE
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCS
2b3zD           MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGADIYVTLEPCS
2b3zA           MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGADIYVTLEPCS
2hxvA           ---AIELAKKGLGRXXXXXXXXXXXXKDGRIIAEGFHPYFGGPHAEIESARKKGEDLRGATLIVTLEPCD
2o7pA           ---ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAYVTLEPC-
2g6vA           ---ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAYVTLEPC-
2obcA           ---ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAYVTLEPC-
2g6vB           ---ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAYVTLEPCS
2obcB           ---ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAYVTLEPCS
2o7pB           ---ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAYVTLEPCD
2b3jD           --------------------------------------------------------LEGCTLYVTLEPC-
2b3jC           --------------------------------------------------------LEGCTLYVTLEPC-
2b3jA           --------------------------------------------------------LEGCTLYVTLEPC-
1vq2A           --------------------VGAVIEKNGRIIS---TGYNGSPHAELNAILFAAENIEGATMYVTLSPC-
3dh1D           MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNATRHAEMVAIKSPSEVFEHTVLYVTVEPCI
3dh1B           MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNATRHAEMVAIKSPSEVFEHTVLYVTVEPCI
3dh1A           MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNATRHAEMVAIKSPSEVFEHTVLYVTVEPCI
2w4lC           -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMNK---VKGCSMYVALFPCN
1wwrD           --LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEETAHAEMLAIKEACRRLEGCELYVTLEPC-
1wwrC           --LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEETAHAEMLAIKEACRRLEGCELYVTLEPC-
1wwrB           --LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEETAHAEMLAIKEACRRLEGCELYVTLEPC-
1wwrA           --LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEETAHAEMLAIKEACRRLEGCELYVTLEPC-
1z3aA           MRHALTLAKRAWDEREV--PVGAVLVHNNRVIGEGWNRPIGTAHAEIMALRQGNYRLIDATLYVTLEPC-
2w4lD           -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMNK---VKGCSMYVALFPCN
2w4lE           -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMNKNTDVKGCSMYVALFPCN
2w4lB           -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMN--KDVKGCSMYVALFPCN
2nx8A           --------------------IGCVIVKDGEIIGRGEESNQAIMHAEMMAINNAHERLLDTTLFVTIEPC-
2w4lF           -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMN---DVKGCSMYVALFPCN
2w4lA           -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMN---DVKGCSMYVALFPCN
1tiyB           ---------------GIGGPFGAVIVKDGAIIAEGQTSNDPTAHAEVTAIRKACKQLDDCILYTSCEPC-
1tiyA           ---------------GIGGPFGAVIVKDGAIIAEGQTSNDPTAHAEVTAIRKACKQLDDCILYTSCEPC-
1wkqB           ---------------GIGGPFGAVIVKDGAIIAEGQTSNDPTAHAEVTAIRKACKQLDDCILYTSCEPC-
1wkqA           ---------------GIGGPFGAVIVKDGAIIAEGQTSNDPTAHAEVTAIRKACKQLDDCILYTSCEPC-


                         .         .         *         .         .         .         .:140
query           HYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLKKQINKFYAPYFFNRKKNL
2b3zD           HYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGILADQAERLNEKFLHFMRTGL
2b3zA           HYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGILADQAERLNEKFLHFMRTGL
2hxvA           HHGKTPPCTDLIIESGIKTVVIGTRD-PNPVSGNGVEKFRNHXXXXXXXXXXXXXXXXCEFFITYVTKKR
2o7pA           -----PPCCDALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEEQLNK----GFLKRRTGF
2g6vA           ------PCCDALIAAGVARVV-ASQDPNPQVAGRGLYRLQQAGIDVSHGLSEEQLNK----GFLKRRTGF
2obcA           ------PCCDALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEEQLNK----GFLKRRTGF
2g6vB           ----------DALIAAGVARVVASQDPNPQVAGRGLYRLQQAGIDVSHGLSEEQLNK----GFLKRRTGF
2obcB           ---------DALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEEQLNK----GFLKRRTGF
2o7pB           ----------ALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEEQLNK----GFLKRRTGF
2b3jD           -----VMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFIVDKGVLKEACSTLLTTFFKNLRAN-
2b3jC           -----VMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFIVDKGVLKEACSTLLTTFFKNLRAN-
2b3jA           -----VMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFIVDKGVLKEACSTLLTTFFKNLRAN-
1vq2A           -----PDCAKAIAQSGIKKLVY-CETYDKNKPGWD-DILRNAGIEV-FNVPKKNLNK-------------
3dh1D           ------MCAAALRLMKIPLVVYGCQNERFGGCGSVLNI--------------------------------
3dh1B           ------MCAAALRLMKIPLVVYGCQNERFGGCGSVLNI--------------------------------
3dh1A           ------MCAAALRLMKIPLVVYGCQNERFGGCGSVLNI--------------------------------
2w4lC           ECAK------------------------------------------------------------------
1wwrD           ----------------------------------------------------------------------
1wwrC           ----------------------------------------------------------------------
1wwrB           ----------------------------------------------------------------------
1wwrA           ----------------------------------------------------------------------
1z3aA           -----VMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLMNHRVEITEGILADECAALLSDFFRMRRQEI
2w4lD           ECAK------------------------------------------------------------------
2w4lE           ECAK------------------------------------------------------------------
2w4lB           ECAK------------------------------------------------------------------
2nx8A           -----VMCSGAIGLARIPHVIYGASN--------------------------------------------
2w4lF           ECAK------------------------------------------------------------------
2w4lA           ECAK------------------------------------------------------------------
1tiyB           ------PCLGAIYWARPKAVFYAAEHTDAAEAG-------------------------------------
1tiyA           ------PCLGAIYWARPKAVFYAAEHTDAAEAG-------------------------------------
1wkqB           -----PMCLGAIYWARPKAVFYAAEHTDAAEAG-------------------------------------
1wkqA           -----PMCLGAIYWARPKAVFYAAEHTDAAEAG-------------------------------------


                         +         .         .         .         .         *         .:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
2b3zD           PYVTLKAAASLDGKIATSDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTK-QPVR
2b3zA           PYVTLKAAASLDGKIATSDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTK-QPVR
2hxvA           PFVALKYASTLDGKIHRGDSKWITD--KLRFKVHERNIYSAVLVGAGTVLKDNPQLTCRLK--EGRNPVR
2o7pA           PYIQLKLGASDGRTAASGESQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDE-----
2g6vA           PYIQLKLGASLDG--RTAESQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDE-----
2obcA           PYIQLKLGASLDG--RTAESQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDE-----
2g6vB           PYIQLKLGASDGRTAASGESQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDE-----
2obcB           PYIQLKLGASDGRTAASGESQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDE-----
2o7pB           PYIQLKLGASLDGRTW------ITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDE-----
2b3jD           ----------------------------------------------------------------------
2b3jC           ----------------------------------------------------------------------
2b3jA           ----------------------------------------------------------------------
1vq2A           ----------------------------------------------------------------------
3dh1D           ----------------------------------------------------------------------
3dh1B           ----------------------------------------------------------------------
3dh1A           ----------------------------------------------------------------------
2w4lC           ----------------------------------------------------------------------
1wwrD           ----------------------------------------------------------------------
1wwrC           ----------------------------------------------------------------------
1wwrB           ----------------------------------------------------------------------
1wwrA           ----------------------------------------------------------------------
1z3aA           ----------------------------------------------------------------------
2w4lD           ----------------------------------------------------------------------
2w4lE           ----------------------------------------------------------------------
2w4lB           ----------------------------------------------------------------------
2nx8A           ----------------------------------------------------------------------
2w4lF           ----------------------------------------------------------------------
2w4lA           ----------------------------------------------------------------------
1tiyB           ----------------------------------------------------------------------
1tiyA           ----------------------------------------------------------------------
1wkqB           ----------------------------------------------------------------------
1wkqA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
2b3zD           VILDTVLSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGI
2b3zA           VILDTVLSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGI
2hxvA           VILDRKGVL--SGKVFRVFEENRVIVFTESEEAEYPPHVEKA----------LSDCSVESILRNLYERDI
2o7pA           ----------------------------------------------------------------------
2g6vA           ----------------------------------------------------------------------
2obcA           ----------------------------------------------------------------------
2g6vB           ----------------------------------------------------------------------
2obcB           ----------------------------------------------------------------------
2o7pB           ----------------------------------------------------------------------
2b3jD           ----------------------------------------------------------------------
2b3jC           ----------------------------------------------------------------------
2b3jA           ----------------------------------------------------------------------
1vq2A           ----------------------------------------------------------------------
3dh1D           ----------------------------------------------------------------------
3dh1B           ----------------------------------------------------------------------
3dh1A           ----------------------------------------------------------------------
2w4lC           ----------------------------------------------------------------------
1wwrD           ----------------------------------------------------------------------
1wwrC           ----------------------------------------------------------------------
1wwrB           ----------------------------------------------------------------------
1wwrA           ----------------------------------------------------------------------
1z3aA           ----------------------------------------------------------------------
2w4lD           ----------------------------------------------------------------------
2w4lE           ----------------------------------------------------------------------
2w4lB           ----------------------------------------------------------------------
2nx8A           ----------------------------------------------------------------------
2w4lF           ----------------------------------------------------------------------
2w4lA           ----------------------------------------------------------------------
1tiyB           ----------------------------------------------------------------------
1tiyA           ----------------------------------------------------------------------
1wkqB           ----------------------------------------------------------------------
1wkqA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLYKCSKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2b3zD           MSVYVEGGSAVHGSFVKEGCFQEIIFYFAPK---------------------------------------
2b3zA           MSVYVEGGSAVHGSFVKEGCFQEIIFYFAPK---------------------------------------
2hxvA           DSVLVEGGS---------KVFSEF----------------------------------------------
2o7pA           ----------------------------------------------------------------------
2g6vA           ----------------------------------------------------------------------
2obcA           ----------------------------------------------------------------------
2g6vB           ----------------------------------------------------------------------
2obcB           ----------------------------------------------------------------------
2o7pB           ----------------------------------------------------------------------
2b3jD           ----------------------------------------------------------------------
2b3jC           ----------------------------------------------------------------------
2b3jA           ----------------------------------------------------------------------
1vq2A           ----------------------------------------------------------------------
3dh1D           ----------------------------------------------------------------------
3dh1B           ----------------------------------------------------------------------
3dh1A           ----------------------------------------------------------------------
2w4lC           ----------------------------------------------------------------------
1wwrD           ----------------------------------------------------------------------
1wwrC           ----------------------------------------------------------------------
1wwrB           ----------------------------------------------------------------------
1wwrA           ----------------------------------------------------------------------
1z3aA           ----------------------------------------------------------------------
2w4lD           ----------------------------------------------------------------------
2w4lE           ----------------------------------------------------------------------
2w4lB           ----------------------------------------------------------------------
2nx8A           ----------------------------------------------------------------------
2w4lF           ----------------------------------------------------------------------
2w4lA           ----------------------------------------------------------------------
1tiyB           ----------------------------------------------------------------------
1tiyA           ----------------------------------------------------------------------
1wkqB           ----------------------------------------------------------------------
1wkqA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
2b3zD           -
2b3zA           -
2hxvA           -
2o7pA           -
2g6vA           -
2obcA           -
2g6vB           -
2obcB           -
2o7pB           -
2b3jD           -
2b3jC           -
2b3jA           -
1vq2A           -
3dh1D           -
3dh1B           -
3dh1A           -
2w4lC           -
1wwrD           -
1wwrC           -
1wwrB           -
1wwrA           -
1z3aA           -
2w4lD           -
2w4lE           -
2w4lB           -
2nx8A           -
2w4lF           -
2w4lA           -
1tiyB           -
1tiyA           -
1wkqB           -
1wkqA           -