[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:AAZ21934.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gz0H.bssp"
#ERROR : Can't open dsspfile "1gz0F.bssp"
#ERROR : Can't open dsspfile "1gz0B.bssp"
#ERROR : Can't open dsspfile "1gz0A.bssp"
#ERROR : Can't open dsspfile "1gz0E.bssp"
#ERROR : Can't open dsspfile "1v2xA.bssp"
#ERROR : Can't open dsspfile "2i6dA.bssp"
#ERROR : Can't open dsspfile "2ha8A.bssp"
#ERROR : Can't open dsspfile "2ha8B.bssp"
#ERROR : Can't open dsspfile "3gyqA.bssp"
#ERROR : Can't open dsspfile "1x7pB.bssp"
#ERROR : Can't open dsspfile "1x7pA.bssp"
#ERROR : Can't open dsspfile "1x7oB.bssp"
#ERROR : Can't open dsspfile "1x7oA.bssp"
#ERROR : Can't open dsspfile "1mxiA.bssp"

## Summary of PDB Search
:247
    3e-17  31%  1gz0H  [d.79.3 - c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE
    3e-17  31%  1gz0F  [d.79.3 - c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE
    3e-17  31%  1gz0B  [d.79.3 - c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE
    3e-17  31%  1gz0A  [d.79.3 - c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE
    9e-14  32%  1gz0E  [c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YJFH
    4e-09  26%  1v2xA  [c.116.1] TRNA (GM18) METHYLTRANSFERASE
    1e-06  32%  2i6dA  [x.x.x] RNA METHYLTRANSFERASE, TRMH FAMILY
    6e-06  24%  2ha8A  [x.x.x] TAR (HIV-1) RNA LOOP BINDING PROTEIN
    9e-06  24%  2ha8B  [x.x.x] TAR (HIV-1) RNA LOOP BINDING PROTEIN
    2e-05  27%  3gyqA  [x.x.x] RRNA (ADENOSINE-2'-O-)-METHYLTRANSFERASE
    4e-05  25%  1x7pB  [x.x.x] RRNA METHYLTRANSFERASE
    4e-05  25%  1x7pA  [x.x.x] RRNA METHYLTRANSFERASE
    1e-04  25%  1x7oB  [x.x.x] RRNA METHYLTRANSFERASE
    1e-04  25%  1x7oA  [x.x.x] RRNA METHYLTRANSFERASE
    7e-04  21%  1mxiA  [c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE HI0766
:247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQI
1gz0H           -------IYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
1gz0F           -------IYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
1gz0B           -------IYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
1gz0A           -------IYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESVVIQLANRQYLDE--KSDGA
1gz0E           ----------------------------------------------------------------------
1v2xA           ----------------------------------------------------------------------
2i6dA           ----------------------------------------------------------------------
2ha8A           ----------------------------------------------------------------------
2ha8B           ----------------------------------------------------------------------
3gyqA           ----------------------------------------------------------------------
1x7pB           ----------------------------------------------------------------------
1x7pA           ----------------------------------------------------------------------
1x7oB           ----------------------------------------------------------------------
1x7oA           ----------------------------------------------------------------------
1mxiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLM
1gz0H           VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
1gz0F           VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
1gz0B           VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
1gz0A           VHQGIIARVKQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
1gz0E           ---------------DLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATA
1v2xA           -----------------------------VLLENVHKPHNLSAILRTCDAV---GVLEAHAVNPTGGVPT
2i6dA           -------------------------------LDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKV
2ha8A           ----------------------GKSISRLIVVASLIDPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQ
2ha8B           ----------------------------------IDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQ
3gyqA           -----------------------------VVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIARRL
1x7pB           -----------------------------VLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKS
1x7pA           -----------------------------VLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKS
1x7oB           -----------------------------VLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKS
1x7oA           -----------------------------VLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKS
1mxiA           -------------------------------------PQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRL


                         +         .         .         .         .         *         .:210
query           YKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGK
1gz0H           KKVACGAAESVPLIRVTNLART--RLQEENIWIVG--TAGEADHTLYQSKTGRLALVGAEGEG-RRLTRE
1gz0F           KKVACGAAESVPLIRVTNLART--RLQEENIWIVG--TAGEADHTLYQSKTGRLALVGAEGEG-RRLTRE
1gz0B           KKVACGAAESVPLIRVTNLART--RLQEENIWIVG--TAGEADHTLYQSKTGRLALVGAEGEG-RRLTRE
1gz0A           KKVACGAAESVPLIRVTNLART--RLQEENIWIVG--TAGEADHTLYQSKTGRLALVGAEGEG-RRLTRE
1gz0E           KKVACGAAESVPLIRVTNLART--RLQEENIWIVG--TAGEADHTLYQSKTGRLALVGAEGEG-RRLTRE
1v2xA           FNETSGGSHKWVYLRVHDLHEAFRFLKERGFTVYATALREDRDFREVDYTKPTAVLFGAEKWGVSEEALA
2i6dA           VQ-ASGALARVQPTPLKNTVDTLAYFRRQGIPVYGAFLDGQSNFTE-----PAILVLGSEGRGISEVAAE
2ha8A           HLSVSA-EQWLPLVEVKQLIDYLQQKKTEGYTIIGVEQTAKSDLTQYCFPEKSLLLLGNEREGIPANLIQ
2ha8B           HLSVSA-EQWLPLVEVKQLIDYLQQKKTEGYTIIGVEQTAKSDLTQYCFPEKSLLLLGNEREGIPANLIQ
3gyqA           QRASRGYVFSLPVV-LSGREEAIAFIRDSGMQLMTLKADGDISVKEL---GDNALLFGSEKGGPSDLFEE
1x7pB           VRSSTGSLFSLPAVRVPSPGEVMDWVEARRIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRT
1x7pA           VRSSTGSLFSLPAVRVPSPGEVMDWVEARRIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRT
1x7oB           VRSSTGSLFSLPAVRVPSPGEVARRAAGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRT
1x7oA           VRSSTGSLFSLPAVRVPSPGEVARRAAGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRT
1mxiA           RRSGLDYHEFAEIKRHKTFEAFLESEKPKR--LFALTTKGCPAHSQVKFKLGDYLMFGPEGIPMSILNEM


                         .         .         .         +         .         .         .:280
query           YTDFFVKIDINKDVESLNISNSAAIVFHxxxxxxxxx
1gz0H           HCDELISIPAG-SVSSLNVSVATGI------------
1gz0F           HCDELISIPAG-SVSSLNVSVATGI------------
1gz0B           HCDELISIPAG-SVSSLNVSVATGI------------
1gz0A           HCDELISIPAG-SVSSLNVSVATGI------------
1gz0E           HCDELISIPAG-SVSSLNVSVATGI------------
1v2xA           LADGAIKIPMLGMVQSLNVSVAAAVI-----------
2i6dA           ITDRLTIPASGLSVESLNVAIATAIL-----------
2ha8A           QLDVCVEIPQQGIIRSLNVHVSGALL-----------
2ha8B           QLDVCVEIPQQGIIRSLNVHVSGALL-----------
3gyqA           ASSASVSIPMMSQTESLNVSVSLGIALH---------
1x7pB           LCDYTVSI-----------------------------
1x7pA           LCDYTVSI-----------------------------
1x7oB           LCDYTVSI-----------------------------
1x7oA           LCDYTVSI-----------------------------
1mxiA           PMEQKIRIPMTANSRSMNLSNSVAVTVY---------