[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:grlA

[Show Plain Result]

#ERROR : Can't open dsspfile "2wemC.bssp"
#ERROR : Can't open dsspfile "2wemA.bssp"
#ERROR : Can't open dsspfile "1wikA.bssp"
#ERROR : Can't open dsspfile "1ykaA.bssp"
#ERROR : Can't open dsspfile "2wciB.bssp"
#ERROR : Can't open dsspfile "2wciA.bssp"
#ERROR : Can't open dsspfile "1z7pA.bssp"
#ERROR : Can't open dsspfile "2e7pC.bssp"
#ERROR : Can't open dsspfile "2e7pB.bssp"
#ERROR : Can't open dsspfile "2e7pD.bssp"
#ERROR : Can't open dsspfile "2e7pA.bssp"
#ERROR : Can't open dsspfile "3h8qB.bssp"
#ERROR : Can't open dsspfile "3h8qA.bssp"
#ERROR : Can't open dsspfile "3h4kA.bssp"
#ERROR : Can't open dsspfile "2v6oA.bssp"
#ERROR : Can't open dsspfile "1kteA.bssp"
#ERROR : Can't open dsspfile "3fz9A.bssp"
#ERROR : Can't open dsspfile "2ht9B.bssp"
#ERROR : Can't open dsspfile "2ht9A.bssp"
#ERROR : Can't open dsspfile "2flsA.bssp"
#ERROR : Can't open dsspfile "2cq9A.bssp"
#ERROR : Can't open dsspfile "3d5jB.bssp"
#ERROR : Can't open dsspfile "3d5jA.bssp"
#ERROR : Can't open dsspfile "3d4mA.bssp"
#ERROR : Can't open dsspfile "3ctgA.bssp"
#ERROR : Can't open dsspfile "2klxA.bssp"
#ERROR : Can't open dsspfile "1jhbA.bssp"
#ERROR : Can't open dsspfile "2khpA.bssp"
#ERROR : Can't open dsspfile "1nm3B.bssp"
#ERROR : Can't open dsspfile "1nm3A.bssp"
#ERROR : Can't open dsspfile "2hzfB.bssp"
#ERROR : Can't open dsspfile "2hzeA.bssp"
#ERROR : Can't open dsspfile "2hzeB.bssp"
#ERROR : Can't open dsspfile "3c1sA.bssp"
#ERROR : Can't open dsspfile "3c1rA.bssp"
#ERROR : Can't open dsspfile "2jadA.bssp"
#ERROR : Can't open dsspfile "2jacA.bssp"
#ERROR : Can't open dsspfile "3dp7B.bssp"
#ERROR : Can't open dsspfile "3dp7A.bssp"
#ERROR : Can't open dsspfile "1b4qA.bssp"

## Summary of PDB Search
:110
    4e-25  56%  2wemC  [x.x.x] GLUTAREDOXIN-RELATED PROTEIN 5
    4e-25  56%  2wemA  [x.x.x] GLUTAREDOXIN-RELATED PROTEIN 5
    4e-22  47%  1wikA  [c.47.1] THIOREDOXIN-LIKE PROTEIN 2
    5e-22  37%  1ykaA  [x.x.x] MONOTHIOL GLUTAREDOXIN YDHD
    5e-22  37%  2wciB  [x.x.x] GLUTAREDOXIN-4
    5e-22  37%  2wciA  [x.x.x] GLUTAREDOXIN-4
    3e-08  30%  1z7pA  [x.x.x] GLUTAREDOXIN
    3e-08  30%  2e7pC  [x.x.x] GLUTAREDOXIN
    3e-08  30%  2e7pB  [x.x.x] GLUTAREDOXIN
    4e-08  32%  2e7pD  [x.x.x] GLUTAREDOXIN
    4e-08  32%  2e7pA  [x.x.x] GLUTAREDOXIN
    2e-07  34%  3h8qB  [x.x.x] THIOREDOXIN REDUCTASE 3
    2e-07  34%  3h8qA  [x.x.x] THIOREDOXIN REDUCTASE 3
    1e-06  23%  3h4kA  [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
    2e-06  24%  2v6oA  [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
    2e-06  24%  1kteA  [x.x.x] THIOLTRANSFERASE
    2e-06  27%  3fz9A  [x.x.x] GLUTAREDOXIN
    5e-06  27%  2ht9B  [x.x.x] GLUTAREDOXIN-2
    5e-06  27%  2ht9A  [x.x.x] GLUTAREDOXIN-2
    5e-06  27%  2flsA  [x.x.x] GLUTAREDOXIN-2
    5e-06  27%  2cq9A  [x.x.x] GLRX2 PROTEIN
    7e-06  33%  3d5jB  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    7e-06  33%  3d5jA  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    1e-05  30%  3d4mA  [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
    1e-05  30%  3ctgA  [x.x.x] GLUTAREDOXIN-2
    2e-05  33%  2klxA  [x.x.x] GLUTAREDOXIN
    3e-05  23%  1jhbA  [x.x.x] GLUTAREDOXIN
    1e-04  26%  2khpA  [x.x.x] GLUTAREDOXIN
    2e-04  26%  1nm3B  [c.47.1 - c.47.1] PROTEIN HI0572
    4e-04  28%  1nm3A  [c.47.1 - c.47.1] PROTEIN HI0572
    4e-04  21%  2hzfB  [x.x.x] GLUTAREDOXIN-1
    4e-04  21%  2hzeA  [x.x.x] GLUTAREDOXIN-1
    5e-04  21%  2hzeB  [x.x.x] GLUTAREDOXIN-1
    5e-04  31%  3c1sA  [x.x.x] GLUTAREDOXIN-1
    5e-04  31%  3c1rA  [x.x.x] GLUTAREDOXIN-1
    7e-04  36%  2jadA  [x.x.x] YELLOW FLUORESCENT PROTEIN GLUTAREDOXIN FUSION
    7e-04  36%  2jacA  [x.x.x] GLUTAREDOXIN-1
    7e-04  50%  3dp7B  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    7e-04  50%  3dp7A  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    7e-04  21%  1b4qA  [c.47.1] PROTEIN (HUMAN THIOLTRANSFERASE)
:110

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
2wemC           -----------------------GTPEQPQCGFSNAVVQILRLHGVDYAAYNVLDDPELRQGIKDYSNWP
2wemA           -----------------------GTPEQPQCGFSNAVVQILRLHGVDYAAYNVLDDPELRQGIKDYSNWP
1wikA           -----------------VMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWP
1ykaA           ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
2wciB           ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
2wciA           ---TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWP
1z7pA           ------------------------------CGYCNRVKQLLTQVGASYKVVELDEGSQLQSALAHWTGRG
2e7pC           ------------------------------CGYCNRVKQLLTQVGASYKVVELDEGSQLQSALAHWTGRG
2e7pB           ------------------------------CGYCNRVKQLLTQVGASYKVVELDEGSQLQSALAHWTGRG
2e7pD           ------------------------------CGYCNRVKQLLTQVGASYKVVELDEGSQLQSALAHWTGRG
2e7pA           ------------------------------CGYCNRVKQLLTQVGASYKVVELDEGSQLQSALAHWTGRG
3h8qB           ----------GLIERSRVVIFSKS-----YCPHSTRVKELFSSLGVE---CNVLELDQVDDGLSEITNQK
3h8qA           ----------GLIERSRVVIFSKS-----YCPHSTRVKELFSSLGVE---CNVLELDQVDDGLSEITNQK
3h4kA           ----TSQWLRKTVDSAAVILFSKTT-----CPYCKKVKDVLAEAKIKHATIELDQGSAIQKCLASFSKIE
2v6oA           ------------VDSAAVILFSKTT-----CPYCKKVKDVLAEAKIKHATIELDQGSAIQKCLASFSKIE
1kteA           --------VNSKIQPGKVVVFIK--PTCPFCRKTQELLSQLPFKEGLLEFVDITDTNEIQDYLQQLTGAR
3fz9A           ------------------------------CSYSSEVKSLFKRLNVDPLVVELDEGPQIQKVLERLTGQH
2ht9B           ------NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVDLLEGNQFQDALYKMTGER
2ht9A           ------NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVDLLEGNQFQDALYKMTGER
2flsA           ------NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVDLLEGNQFQDALYKMTGER
2cq9A           ------NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVDLLEGNQFQDALYKMTGER
3d5jB           ------------------------------CPYSKALSTLFQELNVPKSKALVLELDEMSNGLEEISGQK
3d5jA           ------------------------------CPYSKALSTLFQELNVPKSKALVLELDEMSNGLEEISGQK
3d4mA           -------------------VFVAAKTYCPYC--KATLSTLFQELNVPKSKALVLELDEMSNGLEEISGQK
3ctgA           -------------------VFVAAKTYCPYC--KATLSTLFQELNVPKSKALVLELDEMSNGLEEISGQK
2klxA           ----------------------------PNCPYCKRARDLLDKKGVKYTDIDA--STSLREMVQRANGRN
1jhbA           ------------IQPGKVVVFIK--PTCPYCRRAQEILSQLPIKQGLLEFVDITHTNEIQDYLQQLTGAR
2khpA           ----------------------------PGCPYCXXXXXXXXXXGAEFNEIDASATPELRAEMQERSGRN
1nm3B           --DTLKYLAPQHQVQESISIFTK-----PGCPFCAKAKQLLHDKGLSFEEI-ILGHDATIVSVRAVSGRT
1nm3A           --DTLKYLAPQHQVQESISIFTK-----PGCPFCAKAKQLLHDKGLSFEEI-ILGHDATIVSVRAVSGRT
2hzfB           -----EEFVQQRLANNKVTIFVKYT--CPFCRNALDILNKFSFKRGAYEIVDIKEENELRDYFEQITGGK
2hzeA           -----EEFVQQRLANNKVTIFVKYT--CPFCRNALDILNKFSFKRGAYEIVDIKEENELRDYFEQITGGK
2hzeB           -----EEFVQQRLANNKVTIFVKYTPF---CRNALDILNKFSFKRGAYEIVDIKEENELRDYFEQITGGK
3c1sA           ------------IAENEI--FVASKTYCPYC--HAALNTLFEKLKVPRSKVLVLQLNDMKEGLYEINGQR
3c1rA           ------------IAENEI--FVASKTYCPYC--HAALNTLFEKLKVPRSKVLVLQLNDMKEGLYEINGQR
2jadA           ------------------------------CPYSHAALNTLEKLKVPRSKVLVLQLNDMKEGLYEINGQR
2jacA           ------------------------------CPYSHAALNTLEKLKVPRSKVLVLQLNDMKEGLYEINGQR
3dp7B           ----------------------------------MARVNMEFNHDVNYQGLFHLEEALLNEGLKVFGEWP
3dp7A           ----------------------------------MARVNMEFNHDVNYQGLFHLEEALLNEGLKVFGEWP
1b4qA           -----QEFVNSKIQPGKVVVFIK-----PTCPYSRRAQEILSQLPIKQGLLEFVDTNEIQDYLQQLTGAR


                         .         .         *         .         .         .         .:140
query           TIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKx
2wemC           TIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIH---
2wemA           TIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIH---
1wikA           TYPQLYVRGDLVGGLDIVKELKDNGELLPILK--------
1ykaA           TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
2wciB           TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
2wciA           TFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK-
1z7pA           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAK-
2e7pC           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAK-
2e7pB           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAK-
2e7pD           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQD-------
2e7pA           TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQD-------
3h8qB           TVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQE-------
3h8qA           TVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQE-------
3h4kA           TVPQMFVRGKFIGDSQTVLKYYSNDELAGIVNESKYDY--
2v6oA           TVPQMFVRGKFIGDSQTVLKYYSNDELAGIVNESKYDY--
1kteA           TVPRVFIGKECIGGCTDLESMHKRGELLTRLQQVG-----
3fz9A           TVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSE-------
2ht9B           TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
2ht9A           TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
2flsA           TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
2cq9A           TVPRIFVNGTFIGGATDTHRLHKEGKL-------------
3d5jB           TVPNVYINGKHIGGNSDLETLKKNGKLAEILK--------
3d5jA           TVPNVYINGKHIGGNSDLETLKKNGKLAEILK--------
3d4mA           TVPNVYINGKHIGGNSDLETLKKNGKLAEILK--------
3ctgA           TVPNVYINGKHIGGNSDLETLKKNGKLAEILK--------
2klxA           TFPQIFIGDYHVGGCDDLYALENKGKLDSLLQD-------
1jhbA           TVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIG-----
2khpA           TFPQIFIGSVHVGGCDDLYALEDEGKLDSLLK--------
1nm3B           TVPQVFIGGKHIGGSDDLEKYF------------------
1nm3A           TVPQVFIGGKHIGGSD------------------------
2hzfB           TVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGV----
2hzeA           TVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGV----
2hzeB           TVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGV----
3c1sA           TVPNIYINGKHIGGND------------------------
3c1rA           TVPNIYINGKHIGGND------------------------
2jadA           TVPNIYINGKHIGGND------------------------
2jacA           TVPNIYINGKHIGGND------------------------
3dp7B           TI--------------------------------------
3dp7A           TI--------------------------------------
1b4qA           TVPRVFIGKDSIGGSSDLVSLQQSGELLTRLKQIG-----