[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:nrdB

[Show Plain Result]

#ERROR : Can't open dsspfile "2aniA.bssp"
#ERROR : Can't open dsspfile "1syyA.bssp"
#ERROR : Can't open dsspfile "1uzrC.bssp"
#ERROR : Can't open dsspfile "1uzrB.bssp"
#ERROR : Can't open dsspfile "1uzrA.bssp"
#ERROR : Can't open dsspfile "2o1zB.bssp"
#ERROR : Can't open dsspfile "2rccC.bssp"
#ERROR : Can't open dsspfile "2rccA.bssp"
#ERROR : Can't open dsspfile "2rccB.bssp"
#ERROR : Can't open dsspfile "1oquC.bssp"
#ERROR : Can't open dsspfile "1kgnA.bssp"
#ERROR : Can't open dsspfile "2iyhA.bssp"
#ERROR : Can't open dsspfile "1h0nA.bssp"
#ERROR : Can't open dsspfile "3dhzA.bssp"
#ERROR : Can't open dsspfile "3hf1B.bssp"
#ERROR : Can't open dsspfile "1jk0A.bssp"
#ERROR : Can't open dsspfile "1w68A.bssp"
#ERROR : Can't open dsspfile "2uw2A.bssp"
#ERROR : Can't open dsspfile "1piyA.bssp"
#ERROR : Can't open dsspfile "1mxrA.bssp"
#ERROR : Can't open dsspfile "1jprB.bssp"
#ERROR : Can't open dsspfile "1jprA.bssp"
#ERROR : Can't open dsspfile "1mrrA.bssp"
#ERROR : Can't open dsspfile "1pm2A.bssp"
#ERROR : Can't open dsspfile "1pizA.bssp"
#ERROR : Can't open dsspfile "1pfrA.bssp"
#ERROR : Can't open dsspfile "2p1iG.bssp"
#ERROR : Can't open dsspfile "2av8A.bssp"
#ERROR : Can't open dsspfile "1yfdB.bssp"
#ERROR : Can't open dsspfile "1yfdA.bssp"
#ERROR : Can't open dsspfile "1rsrB.bssp"
#ERROR : Can't open dsspfile "1rsrA.bssp"
#ERROR : Can't open dsspfile "2r2fB.bssp"
#ERROR : Can't open dsspfile "2r2fA.bssp"
#ERROR : Can't open dsspfile "1r2fB.bssp"
#ERROR : Can't open dsspfile "1r2fA.bssp"
#ERROR : Can't open dsspfile "2bq1I.bssp"
#ERROR : Can't open dsspfile "1smqC.bssp"
#ERROR : Can't open dsspfile "1smqA.bssp"
#ERROR : Can't open dsspfile "1rsvA.bssp"
#ERROR : Can't open dsspfile "2p1iA.bssp"
#ERROR : Can't open dsspfile "1biqB.bssp"
#ERROR : Can't open dsspfile "2o1zA.bssp"
#ERROR : Can't open dsspfile "1pj0A.bssp"
#ERROR : Can't open dsspfile "2p1iB.bssp"
#ERROR : Can't open dsspfile "1rnrA.bssp"
#ERROR : Can't open dsspfile "2p1iC.bssp"
#ERROR : Can't open dsspfile "3hf1A.bssp"
#ERROR : Can't open dsspfile "1biqA.bssp"
#ERROR : Can't open dsspfile "2vuxA.bssp"
#ERROR : Can't open dsspfile "2vuxB.bssp"
#ERROR : Can't open dsspfile "1smsA.bssp"

## Summary of PDB Search
:337
    6e-33  30%  2aniA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA
    2e-32  30%  1syyA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN
    1e-15  27%  1uzrC  [a.25.1] RIBONUCLEOTIDE REDUCTASE R2-2 SMALL SUBUNIT
    1e-15  27%  1uzrB  [a.25.1] RIBONUCLEOTIDE REDUCTASE R2-2 SMALL SUBUNIT
    1e-15  27%  1uzrA  [a.25.1] RIBONUCLEOTIDE REDUCTASE R2-2 SMALL SUBUNIT
    4e-15  27%  2o1zB  [x.x.x] RIBONUCLEOTIDE REDUCTASE SUBUNIT R2
    7e-15  26%  2rccC  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT
    7e-15  26%  2rccA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT
    3e-14  26%  2rccB  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT
    3e-14  22%  1oquC  [a.25.1] RIBONUCLEOTIDE REDUCTASE SUBUNIT R2F
    3e-14  22%  1kgnA  [a.25.1] RIBONUCLEOTIDE REDUCTASE PROTEIN R2F
    3e-14  28%  2iyhA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE M2 SUBUNIT
    3e-14  28%  1h0nA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE
    3e-14  22%  3dhzA  [x.x.x] RIBONUCLEOTIDE REDUCTASE SUBUNIT R2F
    3e-14  24%  3hf1B  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2
    4e-14  23%  1jk0A  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN
    8e-14  28%  1w68A  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE M2 CHAIN
    8e-14  27%  2uw2A  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE M2 SUBUNIT
    8e-14  25%  1piyA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    1e-13  25%  1mxrA  [a.25.1] RIBONUCLEOTIDE REDUCTASE R2
    1e-13  25%  1jprB  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    1e-13  25%  1jprA  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    2e-13  25%  1mrrA  [a.25.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    2e-13  25%  1pm2A  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    2e-13  25%  1pizA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    2e-13  25%  1pfrA  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    2e-13  25%  2p1iG  [x.x.x] RIBONUCLEOTIDE REDUCTASE, SMALL CHAIN
    3e-13  25%  2av8A  [a.25.1] RIBONUCLEOTIDE REDUCTASE R2
    4e-13  25%  1yfdB  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    4e-13  25%  1yfdA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    4e-13  25%  1rsrB  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    4e-13  25%  1rsrA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    5e-13  24%  2r2fB  [a.25.1] PROTEIN (RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE
    5e-13  24%  2r2fA  [a.25.1] PROTEIN (RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE
    5e-13  24%  1r2fB  [a.25.1] PROTEIN (RIBONUCLEOTIDE REDUCTASE R2)
    5e-13  24%  1r2fA  [a.25.1] PROTEIN (RIBONUCLEOTIDE REDUCTASE R2)
    5e-13  24%  2bq1I  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 BETA
    6e-13  24%  1smqC  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN
    6e-13  24%  1smqA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN
    1e-12  24%  1rsvA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    1e-12  25%  2p1iA  [x.x.x] RIBONUCLEOTIDE REDUCTASE, SMALL CHAIN
    1e-12  24%  1biqB  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    2e-12  26%  2o1zA  [x.x.x] RIBONUCLEOTIDE REDUCTASE SUBUNIT R2
    3e-12  24%  1pj0A  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA
    3e-12  25%  2p1iB  [x.x.x] RIBONUCLEOTIDE REDUCTASE, SMALL CHAIN
    4e-12  25%  1rnrA  [a.25.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN
    5e-12  25%  2p1iC  [x.x.x] RIBONUCLEOTIDE REDUCTASE, SMALL CHAIN
    3e-11  25%  3hf1A  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2
    4e-11  24%  1biqA  [a.25.1] PROTEIN R2 OF RIBONUCLEOTIDE REDUCTASE
    6e-11  24%  2vuxA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2
    1e-10  26%  2vuxB  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2
    7e-09  23%  1smsA  [a.25.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTKIIQPPKEEIVKPQKMGLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
2aniA           -----------------------------PIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKSDLSEDE
1syyA           -----------------------------PIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKSDLSEDE
1uzrC           -----------------------------------------------WLPEKVPVSNDIPSWG-TLTAGE
1uzrB           -----------------------------------------------WLPEKVPVSNDIPSWG-TLTAGE
1uzrA           -----------------------------------------------WLPEKVPVSNDIPSWG-TLTAGE
2o1zB           -----------------------------PILYPDVWDFYKKAEASFWTAEEIDLSSDLKDFEND---NE
2rccC           -------------------------------RFSWAYPLYKNLANF-WTPFEIN-SHDAKQFP-TLTETE
2rccA           -------------------------------RFSWAYPLYKNLANF-WTPFEIN-SHDAKQFP-TLTETE
2rccB           --------------------------------FSWAYPLYKNLANF-WTPFEIN-SHDAKQFP-TLTETE
1oquC           -----------------------------------------------WLPEKIPVSNDIQSWNK-MTPQE
1kgnA           -----------------------------------------------WLPEKIPVSNDIQSWNK-MTPQE
2iyhA           --------------------LLRENPIF-PIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE-SLKPEE
1h0nA           --------------------LLRENPVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDE
3dhzA           -----------------------------------------------WLPEKIPVSNDIQSWNK-MTPQE
3hf1B           -----------------------------PIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
1jk0A           -----------------------ERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENE
1w68A           --------------------LLRENPVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA-LKPDE
2uw2A           --------------------LLRENPIF-PIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE-SLKPEE
1piyA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1mxrA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1jprB           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1jprA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1mrrA           ----------DQLKEPMFFGQPVQVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1pm2A           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1pizA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1pfrA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
2p1iG           --------------------------------YPEVWNFYKKAEASFWTAEEIDLSSDLKDFEK-LNVNE
2av8A           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1yfdB           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1yfdA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1rsrB           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
1rsrA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
2r2fB           -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLSAAE
2r2fA           -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLSAAE
1r2fB           -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLSAAE
1r2fA           -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLSAAE
2bq1I           -------------------------------------EVWNRLTSNFWLPEKVPLSNDIPAWQ-TLSAAE
1smqC           -----------------------ERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENE
1smqA           -----------------------ERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENE
1rsvA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
2p1iA           --------------------------------YPEVWNFYKKAEASFWTAEEIDLSSDLKDFEK-LNVNE
1biqB           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
2o1zA           -----------------------------PILYPDVWDFYKKAEASFWTAEEIDLSSDLKDFEK-LNDNE
1pj0A           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFFRPEEVDVSRDRIDYQA-LPEHE
2p1iB           --------------------------------YPEVWNFYKKAEASFWTAEEIDLSSDLKDFEK---LNE
1rnrA           ----------DQLKEPMFFGQPVQVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
2p1iC           --------------------------------YPEVWNFYKKAEASFWTAEEIDLSSDLKDFEK-LNVNE
3hf1A           -----------------------------PIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
1biqA           --TTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA-LPEHE
2vuxA           -----------------------------PIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
2vuxB           --------------------LLRKRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNK-LKADE
1smsA           --------------------LLMENSVMFPIKYHEIWAAYKKVEASFWTAEEIELAKDTEDFQK-LTDDQ


                         .         .         *         .         .         .         .:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
2aniA           RRVILLNLGFFSTAESLVNNIVLAIFKHVTNP-EARQYLLRQAFEEAVHTHTYLYICESLGLDEKEIDDF
1syyA           RRVILLNLGFFSTAESLVNNIVLAIFKHVTNP-EARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIDDF
1uzrC           KQLTMRVFTGLTMLDT-IQGTVVSLIPDALTPHEEAVL-TNIAFMESVHAKSYSQIFSTLCSTAEIDDAF
1uzrB           KQLTMRVFTGLTMLDT-IQGTVVSLIPDALTPHEEAVL-TNIAFMESVHAKSYSQIFSTLCSTAEIDDAF
1uzrA           KQLTMRVFTGLTMLDT-IQGTVVSLIPDALTPHEEAVL-TNIAFMESVHAKSYSQIFSTLCSTAEIDDAF
2o1zB           KHFIKHVLAFFAASDINLASKFLRQV----KITEAKKFYAFQIAVENIHSETYSLLIDNYIKDEKEFHAI
2rccC           QEAFKKIIGLLAFLD-SVQTDYSR--AAEYLTDSSLAALSVLSFQEVVHNQSYSYVLSSL-VPKATQDEI
2rccA           QEAFKKIIGLLAFLD-SVQTDYSR--AAEYLTDSSLAALSVLSFQEVVHNQSYSYVLSSL-VPKATQDEI
2rccB           QEAFKKIIGLLAFLD-SVQTDYSR--AAEYLTDSSLAALSVLSFQEVVHNQSYSYVLSSL-VPKATQDEI
1oquC           QLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAF
1kgnA           QLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAF
2iyhA           RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFL
1h0nA           RHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTIKDPKEREYLF
3dhzA           QLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAF
3hf1B           KYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKREFLF
1jk0A           RFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYDPKESEFNAI
1w68A           RHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTIKDPKEREYLF
2uw2A           RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFL
1piyA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1mxrA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1jprB           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1jprA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1mrrA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1pm2A           KHIFISNLKYQTLLEIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1pizA           KHIFISNLKYQTLLEIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
1pfrA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
2p1iG           KHFIKHVLAFFA-ASENLASKFLREVEII----EAKKFYSFQIAVENIHSETYSLLIDNYIKDEKLFHAI
2av8A           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSFTHIIRNIVNDPSEMTSY
1yfdB           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSHTHIIRNIVNDPSEMTSY
1yfdA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSHTHIIRNIVNDPSEMTSY
1rsrB           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSFTHIIRNIVNDPSEMTSY
1rsrA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSFTHIIRNIVNDPSEMTSY
2r2fB           QQLTIRVFTGLTLLDT-IQNIAPSLMADAITPHEE-AVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
2r2fA           QQLTIRVFTGLTLLDT-IQNIAPSLMADAITPHEE-AVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
1r2fB           QQLTIRVFTGLTLLDT-IQNIAPSLMADAITPHEE-AVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
1r2fA           QQLTIRVFTGLTLLDT-IQNIAPSLMADAITPHEE-AVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
2bq1I           QQLTIRVFTGLTLLDT-IQNIAPSLMADAITPHEE-AVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAY
1smqC           RFFISRVLAFFAASENLVEN-----FSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYDPKESEFNAI
1smqA           RFFISRVLAFFAASENLVEN-----FSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYDPKESEFNAI
1rsvA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSFTHIIRNIVNDPSEMTSY
2p1iA           KHFIKHVLAFFAASE-NLASKFLREVEII----EAKKFYSFQIAVENIHSETYSLLIDNYIKDEKEFHAI
1biqB           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSFTHIIRNIVNDPSEMTSY
2o1zA           KHFIKHVXXXXXXXXXXK---FLRQV----KITEAKKFYAFQIAVENIHSETYSLLIDNYIKDEKEFHAI
1pj0A           KHIFISNLKYQTLLEIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
2p1iB           KHFIKHVLAFFA-ASENLASKFLREVEII----EAKKFYSFQIAVENIHSETYSLLIDNYIKDEKERLNL
1rnrA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSYTHIIRNIVNDPSEMTSY
2p1iC           KHFIKHVLAFFAASE-NLASKFLREVEII----EAKKFYSFQIAVENIHSETYSLLIDNYIKDEKEFHAI
3hf1A           KYFISHILAFFAASDENL----VERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKRFNAI
1biqA           KHIFISNLKYQTLLDIQGRSPNVALLPLISIP-ELETWVETWAFSETIHSRSFTHIIRNIVNDPSEMTSY
2vuxA           KYFISHILAFFAASNL------VERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKRFNAI
2vuxB           KYFISHILAFFANENL------VERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTIRDPKKR----
1smsA           KTYIGNLLALSISSDNLVNKYLIENFSAQLQNPEGKSFYGFQIMMENIYSEVYSMMVDAFFKDPKNIPLF


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
2aniA           QMEITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDE
1syyA           QMEITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDE
1uzrC           RWSEENRNLQRKAEIVLQSYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDE
1uzrB           RWSEENRNLQRKAEIVLQSYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDE
1uzrA           RWSEENRNLQRKAEIVLQSYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDE
2o1zB           ENIPAVKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
2rccC           FEYWKHDDVLKERNEFIIDGYEKFVLESIVYDVILEGLNFYSGFAFFYNLARNQKVST--STINYINRDE
2rccA           FEYWKHDDVLKERNEFIIDGYEKFVLESIVYDVILEGLNFYSGFAFFYNLARNQKVST--STINYINRDE
2rccB           FEYWKHDDVLKERNEFIIDGYEKFVLESIVYDVILEGLNFYSGFAFFYNLARNQKVST--STINYINRDE
1oquC           RWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDE
1kgnA           RWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDE
2iyhA           MPC--------------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
1h0nA           NAIETMPC---------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
3dhzA           RWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDE
3hf1B           NAIMPYVKKKADWALRWIADRKSTXXXXXXXXXXXXXXXXSGSFAAIFWLKKRGLMPGLTFSNELISRDE
1jk0A           HTIPEIGEKAEWALRWIQDADALFGERLVAFASI-EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDE
1w68A           NAIETMPC---------VKKKADWALRWIGDKEATYGERVVAFAAVEXXXXXXXKKRGLMPGLTFSSRDE
2uw2A           MPC--------------VKKKADWALRWIGDKEATYGERVVAFAAVEXXLKKRGPMPGLTFSNELISRDE
1piyA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1mxrA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1jprB           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1jprA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1mrrA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1pm2A           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1pizA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1pfrA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVAFACSFAFAERELMEGNAKIIRLIARDE
2p1iG           IPAIKNKALWAAKWINDTNSFAE----RIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
2av8A           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1yfdB           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1yfdA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
1rsrB           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRAYVSFACSFAFAERELMEGNAKIIRLIARDE
1rsrA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRAYVSFACSFAFAERELMEGNAKIIRLIARDE
2r2fB           AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
2r2fA           AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
1r2fB           AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
1r2fA           AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
2bq1I           AWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDE
1smqC           HTIPEIGEKAEWALRWIQDADALFGERLVAFASI-EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDE
1smqA           HTIPEIGEKAEWALRWIQDADALFGERLVAFASI-EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDE
1rsvA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDA
2p1iA           ENIPAIKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
1biqB           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDA
2o1zA           ENIPAVKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
1pj0A           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIRFYVSFACSFAFAERELMEGNAKIIRLIARDE
2p1iB           FHAPAIKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
1rnrA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIR-YVSFACSFAFAERELMEGNAKIIRLIARDE
2p1iC           ENIPAIKNKALWAAKWINDTNSFAERIVA--NACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDE
3hf1A           ETMPYVKKKADWALRW-IADRKSTXXXXXXXXXXXXXXXXSGSFAAIFWLKKRGLMPGLTFSNELISRDE
1biqA           WHLLGEGTHTVNGKTVTVSLKKKLYLCLMSVNAL-EAIR-YVSFACSFAFAERELMEGNAKIIRLIARDA
2vuxA           ETMPYVKKKADWALRW-IADRKSTXXXXXXXXXXXXXXXXSGSFAAIFWLKKRGLMPGLTFSNELISRDE
2vuxB           ---------PYVKKKADWTXXXXXXXXXXXXXXXXSG-----SFAAIFWLKKRGLMPGLTFSNELISRDE
1smsA           KEIANLPEVKHKAAFIERWISNDDSLYAERLVAFAEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDR


                         .         .         .         +         .         .         .:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
2aniA           TIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRG-ILGLRASMFIDYVQHIA
1syyA           TIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRG-ILGLRASMFIDYVQHIA
1uzrC           AVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVEYTDLYDEVG-----LTEDVKKFLRYNA
1uzrB           AVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVEYTDLYDEVG-----LTEDVKKFLRYNA
1uzrA           AVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVEYTDLYDEVG-----LTEDVKKFLRYNA
2o1zB           GLHTDFNCLIYSLLENKLPE----EVVQNIVKEA---VEVERSFI---CESLPCIGMNSRLMSQYIEFVA
2rccC           QLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLKAADLEKDWFRYIIGDKIP--GINPED-ETYISFIA
2rccA           QLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLKAADLEKDWFRYIIGDKIP--GINPED-ETYISFIA
2rccB           QLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLKAADLEKDWFRYIIGDKIP--GINPED-ETYISFIA
1oquC           SVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTDIYDDLG-----WTEDVKRFLRYNA
1kgnA           SVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTDIYDDLG-----WTEDVKRFLRYNA
2iyhA           GLHCDFACLMFKHLVHKPSEERVREI---IINAVRI----EQEFLTEALPV-KLIGMNCTLMKQYIEFVA
1h0nA           GLHCDFACLMFKHLVHKPAEQRVREI-------ITNAVRIEQEFLTEALPV-KLIGMNCTLMKQYIEFVA
3dhzA           SVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTDIYDDLG-----WTEDVKRFLRYNA
3hf1B           GLHCDFACLMFQYLVNKPSEERVREIIVDAVKI-------EQEFLTEALPVG-LIGMNCILMKQYIEFVA
1jk0A           GLHTDFACLLFAH-LKNKPD------PAIVEKIVTEAVEIEQRYFLDALPVA-LLGMNADLMNQYVEFVA
1w68A           GLHCDFACLMFKHLVHKPAEQRVREI-------ITNAVRIEQEFLTEALPV-KLIGMNCTLMKQYIEFVA
2uw2A           GLHCDFACLMFKHLVHKPSEERVREI---IINAVRI----EQEFLTEALPV-KLIGMNCTLMKQYIEFVA
1piyA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1mxrA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1jprB           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1jprA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1mrrA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1pm2A           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1pizA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1pfrA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2p1iG           GLHTDFNCLIYSLLENKLPENVVQNIVKEAVEVERSFI-CESLPCDLI-------GMNSRLMSQYIEFVA
2av8A           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1yfdB           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1yfdA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1rsrB           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
1rsrA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2r2fB           AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYETG-----WVNDVKAFLCYNA
2r2fA           AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYETG-----WVNDVKAFLCYNA
1r2fB           AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYETG-----WVNDVKAFLCYNA
1r2fA           AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYETG-----WVNDVKAFLCYNA
2bq1I           AVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYETG-----WVNDVKAFLCYNA
1smqC           GLHTDFACLLFAH-LKNKPD------PAIVEKIVTEAVEIEQRYFLDALPVA-LLGMNADLMNQYVEFVA
1smqA           GLHTDFACLLFAH-LKNKPD------PAIVEKIVTEAVEIEQRYFLDALPVA-LLGMNADLMNQYVEFVA
1rsvA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2p1iA           GLHTDFNCLIYSLLENKLPENVVQNIVKEAVEVERSFI-CESLPCDLI-------GMNSRLMSQYIEFVA
1biqB           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2o1zA           GLHTDFNCLIYSLLENKLPE----EVVQNIVKEA---VEVERSFICESLPC-DLIGMNSRLMSQYIEFVA
1pj0A           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2p1iB           GLHTDFNCLIYSLLENKLPENVVQNIVKEAVEVERSFI-CESLPCDLI-------GMNSRLMSQYIEFVA
1rnrA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2p1iC           GLHTDFNCLIYS--LNKLPENVVQNIVKEAVEVERSFI-CESLPCDLI-------GMNSRLMSQYIEFVA
3hf1A           GLHCDFACLMFQYLVNKPSEERVREIIVDAVKI-------EQEFLTEALPVG-LIGMNCILMKQYIEFVA
1biqA           ALHLTGMLNLLRSGA-DDPEMAAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLNKDILCQYVEYIT
2vuxA           GLHCDFACLMFQYLVNKPSEERVREIIVDAVKI-------EQEFLTEALPVG-LIGMNCILMKQYIEFVA
2vuxB           GLHCDFACLMFQYLVNKPSEERVREIIVDAVKI-------EQEFLTEALPVG-LIGMNCILMKQYIEFVA
1smsA           GAYTDFSCLLFAHLTKPNPKI--------IEKIITEAVEIEKEYYSNSLPVEKF-GMDLKSIHTYIEFVA


                         .         *         .         .         .         .         +:350
query           NRRLSQLGLEPIYDVDKNPLTWLDSMLNAVEHMNFFEGRSTEYSKxxxxxxxxxxxx
2aniA           DRRLERIGLKPIYHT-KNPFPWM----------------------------------
1syyA           DRRLERIGLKPIYHT-KNPFPWM----------------------------------
1uzrC           NKALMNLGYEALFETDVNP--------------------------------------
1uzrB           NKALMNLGYEALFETDVNP--------------------------------------
1uzrA           NKALMNLGYEALFETDVNP--------------------------------------
2o1zB           DRLLECLGSPKIFHA-KNPFNWM----------------------------------
2rccC           NKRAVQLGEKPYPEIKHNP--------------------------------------
2rccA           NKRAVQLGEKPYPEIKHNP--------------------------------------
2rccB           NKRAVQLGEKPYPEIKHNP--------------------------------------
1oquC           NKALNNLGYEGLFPTDETKVS------------------------------------
1kgnA           NKALNNLGYEGLFPTDETKVS------------------------------------
2iyhA           DRLMLELGFSKVFRVE-NPFDFM----------------------------------
1h0nA           DRLMLELGFNKIFRVE-NPFDFME---------------------------------
3dhzA           NKALNNLGYEGLFPTDETKVS------------------------------------
3hf1B           DRLLVELGFSKVFQAE-NPFDFMENI-------------------------------
1jk0A           DRLLVAFGNKKYYKVE-NPFDFMEN--------------------------------
1w68A           DRLMLELGFNKIFRVE-NP--------------------------------------
2uw2A           DRLMLELGFSKVFRVE-NPFDFM----------------------------------
1piyA           NIRMQAVGLDLPFNTRSNPIPWINTWL------------------------------
1mxrA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1jprB           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1jprA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1mrrA           NIRMQAVGLDLPFNTRSNPIPWINTWL------------------------------
1pm2A           NIRMQAVGLDLPFNTRSNPIPWINTWL------------------------------
1pizA           NIRMQAVGLDLPFNTRSNPIPWINTWL------------------------------
1pfrA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
2p1iG           DRLLECLGCSKVFH-SKNPFNW-----------------------------------
2av8A           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1yfdB           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1yfdA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1rsrB           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
1rsrA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
2r2fB           NKALMNLGYEALFPADVNP--------------------------------------
2r2fA           NKALMNLGYEALFPADVNP--------------------------------------
1r2fB           NKALMNLGYEALFPADVNP--------------------------------------
1r2fA           NKALMNLGYEALFPADVNP--------------------------------------
2bq1I           NKALMNLGYEALFPADVNP--------------------------------------
1smqC           DRLLVAFGNKKYYKVE-NPFDFMEN--------------------------------
1smqA           DRLLVAFGNKKYYKVE-NPFDFMEN--------------------------------
1rsvA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
2p1iA           DRLLECLGCSKVFH-SKNPFNW-----------------------------------
1biqB           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
2o1zA           DRLLECLGSPKIFHA-KNPFNWMD---------------------------------
1pj0A           NIRMQAVGLDLPFNTRSNPIPWINTWL------------------------------
2p1iB           DRLLECLGCSKVFH-SKNPFNW-----------------------------------
1rnrA           NIRMQAVGLDLPFNTRSNPIPWINTWL------------------------------
2p1iC           DRLLECLGCSKVFH-SKNPFNW-----------------------------------
3hf1A           DRLLVELGFSKVFQAE-NP--------------------------------------
1biqA           NIRMQAVGLDLPFQTRSNPIPWINTWL------------------------------
2vuxA           DRLLVELGFSKVFQAE-NPFDFM----------------------------------
2vuxB           DRLLVELGFSKVFQAE-NPFDFMEN--------------------------------
1smsA           DGLLQGFGNEKYYNA-----------VNPFEFMEFFEKKVSDYQK------------