[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:yhdH

[Show Plain Result]

#ERROR : Can't open dsspfile "1o8cC.bssp"
#ERROR : Can't open dsspfile "1o8cA.bssp"
#ERROR : Can't open dsspfile "1xa0A.bssp"
#ERROR : Can't open dsspfile "1o89A.bssp"
#ERROR : Can't open dsspfile "1xa0B.bssp"
#ERROR : Can't open dsspfile "1tt7A.bssp"
#ERROR : Can't open dsspfile "1yb5A.bssp"
#ERROR : Can't open dsspfile "2vn8B.bssp"
#ERROR : Can't open dsspfile "2vn8A.bssp"
#ERROR : Can't open dsspfile "3fbgB.bssp"
#ERROR : Can't open dsspfile "3fbgA.bssp"
#ERROR : Can't open dsspfile "1rjwA.bssp"
#ERROR : Can't open dsspfile "1v3vB.bssp"
#ERROR : Can't open dsspfile "1v3uB.bssp"
#ERROR : Can't open dsspfile "1v3tB.bssp"
#ERROR : Can't open dsspfile "1v3tA.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "1wlyA.bssp"
#ERROR : Can't open dsspfile "1lluA.bssp"
#ERROR : Can't open dsspfile "1v3uA.bssp"
#ERROR : Can't open dsspfile "2hcyA.bssp"
#ERROR : Can't open dsspfile "3gmsA.bssp"
#ERROR : Can't open dsspfile "1zsvA.bssp"
#ERROR : Can't open dsspfile "2j3hB.bssp"
#ERROR : Can't open dsspfile "2j3hA.bssp"
#ERROR : Can't open dsspfile "1qorA.bssp"
#ERROR : Can't open dsspfile "1h2bB.bssp"
#ERROR : Can't open dsspfile "1h2bA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2j8zA.bssp"
#ERROR : Can't open dsspfile "2obyA.bssp"
#ERROR : Can't open dsspfile "2zb3A.bssp"
#ERROR : Can't open dsspfile "3gqvA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2iodB.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"

## Summary of PDB Search
:333
    4e-62  38%  1o8cC  [b.35.1 - c.2.1] YHDH
    4e-62  38%  1o8cA  [b.35.1 - c.2.1] YHDH
    8e-61  47%  1xa0A  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    5e-60  39%  1o89A  [b.35.1 - c.2.1] YHDH
    3e-59  47%  1xa0B  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    8e-50  39%  1tt7A  [b.35.1 - c.2.1] YHFP
    7e-15  29%  1yb5A  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    7e-14  36%  2vn8B  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    7e-14  36%  2vn8A  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    5e-12  28%  3fbgB  [x.x.x] PUTATIVE ARGINATE LYASE
    7e-12  29%  3fbgA  [x.x.x] PUTATIVE ARGINATE LYASE
    1e-11  26%  1rjwA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-09  29%  1v3vB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    1e-09  29%  1v3uB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    1e-09  29%  1v3tB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    1e-09  29%  1v3tA  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    1e-09  29%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    7e-09  30%  1wlyA  [x.x.x] 2-HALOACRYLATE REDUCTASE
    7e-09  27%  1lluA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-08  29%  1v3uA  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    8e-08  30%  2hcyA  [x.x.x] ALCOHOL DEHYDROGENASE 1
    1e-07  28%  3gmsA  [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE
    4e-07  25%  1zsvA  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    5e-07  28%  2j3hB  [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
    5e-07  28%  2j3hA  [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
    3e-06  31%  1qorA  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    4e-06  35%  1h2bB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-06  35%  1h2bA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    8e-06  30%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    8e-06  30%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    4e-05  28%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    6e-05  26%  2j8zA  [x.x.x] QUINONE OXIDOREDUCTASE
    8e-05  26%  2obyA  [x.x.x] PUTATIVE QUINONE OXIDOREDUCTASE
    1e-04  26%  2zb3A  [x.x.x] PROSTAGLANDIN REDUCTASE 2
    1e-04  30%  3gqvA  [x.x.x] ENOYL REDUCTASE
    1e-04  30%  3b70A  [x.x.x] ENOYL REDUCTASE
    1e-04  30%  3b6zA  [x.x.x] ENOYL REDUCTASE
    5e-04  42%  2iodB  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    5e-04  46%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-04  46%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
:333

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFA
1o8cC           -----QALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFA
1o8cA           -----QALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFA
1xa0A           ----FQAFVVNKTETEFTAGVQTISDD-LPEGDVLVRVHYSSVNYKDGLASIPDGKIVKT-PFVPGIDLA
1o89A           --------------------VQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFA
1xa0B           ----FQAFVVNKTETEFTAGVQTISDD-LPEGDVLVRVHYSSVNYKDGLASIPDGKIVKT-PFVPGIDLA
1tt7A           ----FQALQAEKNADDVSVHVKTISTEDLPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLILGIDAA
1yb5A           -----------------------------KDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVA
2vn8B           ----------------------------------------------------------EEFPLTLGRDVS
2vn8A           ----------------------------------------------------------EEFPLTLGRDVS
3fbgB           --------------------------------EILVKIQSISVNPVDTK-----QRLMDVSPRVLGFDAI
3fbgA           ---------------------------------------------------------VSKAPRVLGFDAI
1rjwA           ----------------------------------------------------------------------
1v3vB           -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
1v3uB           -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
1v3tB           -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
1v3tA           -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
2dm6A           -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
1wlyA           ----------------------------------------------------------------------
1lluA           -------------------------------GQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEXX
1v3uA           -------------------ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA
2hcyA           ----------------------------------------------------------------------
3gmsA           -------------------EYKNIEP--LKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGV
1zsvA           -------------------ELKTSELPPLKNGEVLLEALFLTVDP----YMRVAAKRLKEGDTMMGQQVA
2j3hB           ----------------------------------------------------------------------
2j3hA           ----------------------------------------------------------------------
1qorA           ----------------------------------------------------------------------
1h2bB           ----------------------------------------------------------------------
1h2bA           ----------------------------------------------------------------------
2c0cB           -------LVVTRLSPNF-REAVTLSRDLPGDGDLLVRVNASDINYS----AGRYDPSVKP-PFDIGFEGI
2c0cA           -------LVVTRLSPNF-REAVTLSRDLPGDGDLLVRVNASDINYS----AGRYDPSVKP-PFDIGFEGI
2eihA           ----------------------------------------------------------------------
2j8zA           --------------------VKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEAS
2obyA           --------------------VKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEAS
2zb3A           ----------------------------------------------------------------------
3gqvA           -----------------------------------------------------------------GTDYA
3b70A           -----------------------------------------------------------------GTDYA
3b6zA           -----------------------------------------------------------------GTDYA
2iodB           ----------------------------------------------------------------------
3f9iB           ----------------------------------------------------------------------
3f9iA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF
1o8cC           GTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLC--
1o8cA           GTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLC--
1xa0A           GVVVSSQHPRFREGDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAAI-GTAGFTAAL---
1o89A           GTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLC--
1xa0B           GVVVSSQHPE---GDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAAI-GTAGFTAAL---
1tt7A           GTVVSSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEA-VYGTAGFTAAL---
1yb5A           GVIVGDNASAFKKGDRVFTSS-----TISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTALIHSA
2vn8B           GVVMECDVKYFKPGDEVAVPPWKQGTL-----SEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAIN
2vn8A           GVVMECDVKYFKPGDEVAVPPWKQGTL-----SEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAIN
3fbgB           GVVESVGNTMFNQGDIVYYSG---SPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITAYETLF
3fbgA           GVVESVGNTMFNQGDIVYYSG---SPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITAYETLF
1rjwA           -----------------------------GGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYK---
1v3vB           -RVVESKNSAFPAGSIVLASGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTAYF
1v3uB           -RVVESKNSAFPAGSIVLASGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTAYF
1v3tB           -RVVESKNSAFPAGSIVLASGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTAYF
1v3tA           -RVVESKNSAFPAGSIVLASGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTAYF
2dm6A           -RVVESKNSAFPAGSIVLASGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTAYF
1wlyA           -----------------------------GAYSQERLYPAEKLIKVPKDLDLDDVHLAGLM-LKGMTAQY
1lluA           XXXXXXXXTRVKEGDRVCLTGWETGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLK
1v3uA           -RVVESKNSAFPAGSIVLASGWTTHFIS----------DGKGLEKLLWPDKLPLSLALGTIGMPGLTAYF
2hcyA           ----------------------------------------------------------------------
3gmsA           GIV--ENVGAFVSRE---LIGKRVGE---GTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTAVTCTE
1zsvA           -KVVESKNVALPKGTIVLASGWTTHSISDG------KDLEKLLTEWPDTIPLSLA--LGTVGMPGLTAYF
2j3hB           --IIESGHPDYKKGDLL----W--GIVAWEEYSVITPMTHAHFKIQHTDVPSYYTGLLGMPGMTAYAGFY
2j3hA           --IIESGHPDYKKGDLL----W--GIVAWEEYSVITPMTHAHFKIQHTDVPSYYTGLLGMPGMTAYAGFY
1qorA           --------SKVGSGVKHIKAGDRVAQSALGAYSSVHNIIADKAAILPAAISFEQAAASFLKGLTVLRKTY
1h2bB           -----------------------------GGFAEFMRTSHRSVIKLPKDISREKLVPLADAGITAYRA--
1h2bA           -----------------------------GGFAEFMRTSHRSVIKLPKDISREKLVPLADAGITAYRA--
2c0cB           GEVVALGLSASAR----YTVGQAVAYMAPGSFAEYTVVPAS--IATPVPSVKPEYLTLLVSGTTAYI---
2c0cA           GEVVALGLSASAR----YTVGQAVAYMAPGSFAEYTVVPAS--IATPVPSVKPEYLTLLVSGTTAYI---
2eihA           -----------------------LGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAVVDKL
2j8zA           GHVAELGPG---------CQHWKIGDTAMGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLH
2obyA           GHVAELGPG--CQGH------WKIGDTAMGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLH
2zb3A           GVVEESKHQKLTKGDFVTSFYWP--------WQTKAILDGNGLEKDPQLVDGHLSYFLGAIGMPGLTSLI
3gqvA           GTVVASDVTHIQVGDRVYGAQNEMCPRTQGAFSQYTVTRGRVWAKIPKGLSFEQAAALSTAGLAMKLLGL
3b70A           GTVVASDVTHIQVGDRVYGAQNEMCPRTQGAFSQYTVTRGRVWAKIPKGLSFEQAAALSTAGLAMKLLGL
3b6zA           GTVVASDVTHIQVGDRVYGAQNEMCPRTQGAFSQYTVTRGRVWAKIPKGLSFEQAAALSTAGLAMKLLGL
2iodB           ----------------------------------------------------------------------
3f9iB           ----------------------------------------------------------------------
3f9iA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK
1o8cC           -VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVLPR-DEFA
1o8cA           -VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVLPR-DEFA
1xa0A           SIHRLEEHGLTPERGPVLVTGATGGVGSLAVS-LAKRGYTVEASTGKAAEHDYLRVLGAKEVL-------
1o89A           -VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVLPR-DEFA
1xa0B           SIHRLEEHGLTPERGPVLVTGATGGVGSLAVS-LAKRGYTVEASTGKAAEHDYLRVLGAKEV-----LAE
1tt7A           SVHRLEQNGLSPE-KXXXXXXXXXXXXXXXXXXLNKRGYDVVASTGNREAADYLKQLGASEVISREDVDG
1yb5A           CVKAGES---------VLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREIDK
2vn8B           KVGG-----LNDKNKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASE-LVRKLGADDVIDYKSGSV
2vn8A           KVGG-----LNDKNKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASE-LVRKLGADDVIDYKSGSV
3fbgB           DVFGISRNRNENEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGADIVLN------
3fbgA           DVFGISRNRNENEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGADIVLN------
1rjwA           ALK-----VTGAKPGEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNKEDAAK
1v3vB           GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
1v3uB           GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
1v3tB           GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
1v3tA           GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
2dm6A           GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
1wlyA           LLHQTHKVKPGDYV---LIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSDFAE
1lluA           QTNARPG-------QWVAISGI-GGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDP
1v3uA           GLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNS
2hcyA           ------------------------------VQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDEKDIVG
3gmsA           TLNLQRN--------DVLLVNACGSIGHLFAQLSQILNFRLIAVTRNNKHTEELLRLGAAYVISTAPLYE
1zsvA           GLLE----ICGVKGGETXXXXXXXXXXXXXXXXXXKLGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVES
2j3hB           EVCSPKE---GETV---YVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKDAFNYKEESDLTA
2j3hA           EVCSPKE---GETV---YVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKDAFNYKEESDLTA
1qorA           EIKPDEQFLFH---------AAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINEEDLVE
1h2bB           VKKAARTLYPGAYVAIVGV----GGLGHIAVQLLKVMPATVIALDVKEEKLKLAERLGADHVVDRRDPVK
1h2bA           VKKAARTLYPGAYVAIVGV----GGLGHIAVQLLKVMPATVIALDVKEEKLKLAERLGADHVVDRRDPVK
2c0cB           SLKELGGLSEGKKV---LVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINVGTVLK
2c0cA           SLKELGGLSEGKKV---LVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINVGTVLK
2eihA           GVRPGD---------DVLVMXXXXXXXXXXIQIAKLFGARVIATAGSEDKLRRAKALGADETVNHPDWPK
2j8zA           LV---GNVQAGDY---VLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNKEDFSE
2obyA           LV---GNVQAGDY---VLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNKEDFSE
2zb3A           GVQEKGHISAGSN-QTMVVXXXXXXXXXXXXQIGHLLGCSVVGICGTQEKCLFLTSLGFDAAVNTGNVAE
3gqvA           PLPSADQPPTHSKPVYVLVYGGSTATATVTMQMLRLSGY-IPIATCSPHNFDLAKSRGAEEVFD------
3b70A           PLPSADQPPTHSKPVYVLVYGGSTATATVTMQMLRLSGY-IPIATCSPHNFDLAKSRGAEEVFD------
3b6zA           PLPSADQPPTHSKPVYVLVYGGSTATATVTMQMLRLSGY-IPIATCSPHNFDLAKSRGAEEVFD------
2iodB           ---------MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHL-------------
3f9iB           --------------KTSLITGASSGIGSAIARLLHKLG---SKVIISGSNEEKLKSLG------------
3f9iA           --------------KTSLITGASSGIGSAIARLLHKLG---SKVIISGSNEEKLKSLG------------


                         .         .         .         +         .         .         .:280
query           DARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASI
1o8cC           ESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVMTPP
1o8cA           ESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVMTPP
1xa0A           -ARELDKQRWAAAVDPVGGRTLATVLSR-RYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPD
1o89A           ESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVMTPP
1xa0B           RIRPLDKQRWAAAVDPVGGRTLATVLSR-RYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPD
1tt7A           TLKALSKQQWQGAVDPVGGKQLASLLSKIQYGGSVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVYCP-
1yb5A           IKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN-----------------------
2vn8B           EEQLKSLKPFDFILDNVGG---------------------------------------------------
2vn8A           EEQLKSLKPFDFILDNVGG---------------------------------------------------
3fbgB           ----------------------------------------------------------------------
3fbgA           ----------------------------------------------------------------------
1rjwA           FMKEKXXXXXXXXXXXXSKPAFQSAYNSIRRGGACVLVGLPPE-EMPIPIFDTVLNGIKI--IGSIVGTR
1v3vB           LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY--------------------------
1v3uB           LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY--------------------------
1v3tB           LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY--------------------------
1v3tA           LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY--------------------------
2dm6A           LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY--------------------------
1wlyA           VVREITGGKGDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHAS----------------------------
1lluA           EAIQRDIGGAHGVVTAVSNSAFGQAIGMARRGGTIALVGPPGDFP--TPIFDVVLKGLHIAGSIVGTRA-
1v3uA           LEEALKKASPDGYFDNVGGEFLNTVLSQMKDFGKIAICGAIS----------------------------
2hcyA           AVLKATDGGAHGVINSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVG--------
3gmsA           TVMELTNGIGDAAIDSIGGPDGNELAFSLRPNGHFLTIGLLSGIQVN-----------------------
1zsvA           LEETLKKASPDGYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTXXXXXXXXXEIVIYQELRMEAFV
2j3hB           ALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNL------------------------
2j3hA           ALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNL------------------------
1qorA           RLKEITGGKKVRVVDSVGRDTWERSLDCLQRRGLMVSFGNSS----------------------------
1h2bB           QVMELTRGRGVNVMDFVGSQ--------------------------------------------------
1h2bA           QVMELTRGRGVNVMDFVGSQ--------------------------------------------------
2c0cB           QEYP--EGV-DVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSP------------------
2c0cA           QEYP--EGV-DVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSP------------------
2eihA           EVRRLTGGKGDKVVDHTGALYFEGVIKAT-----------------------------------------
2j8zA           ATLKFTKGAGNLILDCIGG---------------------------------------------------
2obyA           ATLKFTKGAGNLILDCIGG---------------------------------------------------
2zb3A           QLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQY--------------------------
3gqvA           ----------------------------------------------------------------------
3b70A           ----------------------------------------------------------------------
3b6zA           ----------------------------------------------------------------------
2iodB           ----------------------------------------------------------------------
3f9iB           ----------------------------------------------------------------------
3f9iA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KRREFVWNEVKSLIDFEQLEKSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK
1o8cC           ERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKVN-
1o8cA           ERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKVN-
1xa0A           LRLR-IWERLAGDLK-PDLERIAQEISLAELPQALKRILRGELRGRTVVRL--
1o89A           ERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLV----
1xa0B           LRLR-IWERLAGDLK-PDLERIAQEISLAELPQALKRILRGELRGRTVVRL--
1tt7A           DVRAAVWERSSDLKPDQLLTIVDREVSLEETPGALKDILQNRIQGRVIVKL--
1yb5A           -----------------------------------------------------
2vn8B           -----------------------------------------------------
2vn8A           -----------------------------------------------------
3fbgB           -----------------------------------------------------
3fbgA           -----------------------------------------------------
1rjwA           K-------DLQEALQF-AAEGKVKTIPLEKINEVFDRMLKGQINGRVVLTL--
1v3vB           -----------------------------------------------------
1v3uB           -----------------------------------------------------
1v3tB           -----------------------------------------------------
1v3tA           -----------------------------------------------------
2dm6A           -----------------------------------------------------
1wlyA           -----------------------------------------------------
1lluA           --------DLQEALDFEGLVKTIHPGKLDDINQILDQMRAGQIEGRIVLEM--
1v3uA           -----------------------------------------------------
2hcyA           ---SYVGNDTREALDFRGLVKSIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK
3gmsA           -----------------------------------------------------
1zsvA           ARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIV----
2j3hB           -----------------------------------------------------
2j3hA           -----------------------------------------------------
1qorA           -----------------------------------------------------
1h2bB           -----------------------------------------------------
1h2bA           -----------------------------------------------------
2c0cB           -----------------------------------------------------
2c0cA           -----------------------------------------------------
2eihA           -----------------------------------------------------
2j8zA           -----------------------------------------------------
2obyA           -----------------------------------------------------
2zb3A           -----------------------------------------------------
3gqvA           -----------------------------------------------------
3b70A           -----------------------------------------------------
3b6zA           -----------------------------------------------------
2iodB           -----------------------------------------------------
3f9iB           -----------------------------------------------------
3f9iA           -----------------------------------------------------