[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:AAZ22059.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zx1B.bssp"
#ERROR : Can't open dsspfile "1sg0A.bssp"
#ERROR : Can't open dsspfile "3fw1A.bssp"
#ERROR : Can't open dsspfile "1zx1A.bssp"
#ERROR : Can't open dsspfile "1qrdA.bssp"
#ERROR : Can't open dsspfile "1dxqA.bssp"
#ERROR : Can't open dsspfile "1qbgA.bssp"
#ERROR : Can't open dsspfile "1kbqB.bssp"
#ERROR : Can't open dsspfile "1kbqA.bssp"
#ERROR : Can't open dsspfile "1h69A.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "3f2vA.bssp"
#ERROR : Can't open dsspfile "3eywB.bssp"
#ERROR : Can't open dsspfile "3eywA.bssp"
#ERROR : Can't open dsspfile "2v9cA.bssp"

## Summary of PDB Search
:189
    1e-17  29%  1zx1B  [x.x.x] NRH DEHYDROGENASE [QUINONE] 2
    1e-17  29%  1sg0A  [c.23.5 (1qr2A)] NRH DEHYDROGENASE [QUINONE] 2
    1e-17  29%  3fw1A  [x.x.x] RIBOSYLDIHYDRONICOTINAMIDE DEHYDROGENASE
    2e-17  30%  1zx1A  [x.x.x] NRH DEHYDROGENASE [QUINONE] 2
    9e-15  26%  1qrdA  [c.23.5] QUINONE-REDUCTASE
    2e-14  26%  1dxqA  [c.23.5] QUINONE REDUCTASE
    2e-12  25%  1qbgA  [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
    2e-12  25%  1kbqB  [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
    2e-12  25%  1kbqA  [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
    2e-12  25%  1h69A  [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
    2e-12  25%  1d4aA  [c.23.5] QUINONE REDUCTASE
    7e-06  34%  3f2vA  [x.x.x] GENERAL STRESS PROTEIN 14
    8e-05  34%  3eywB  [x.x.x] C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED
    8e-05  34%  3eywA  [x.x.x] C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED
    3e-04  32%  2v9cA  [x.x.x] FMN-DEPENDENT NADH-AZOREDUCTASE 1
:189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
1zx1B           -KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPAYKQRSLASDITDEQKKVREADL
1sg0A           -KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPAYKQRSLASDITDEQKKVREADL
3fw1A           -KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPAYKQRSLASDITDEQKKVREADL
1zx1A           -KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPAYKQRSLASDITDEQKKVREADL
1qrdA           VRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISGERLSPDIVAEQKKLEAADL
1dxqA           -RRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISGERLSPDIVAEHKKLEAADL
1qbgA           VRRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
1kbqB           -RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
1kbqA           -RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
1h69A           -RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
1d4aA           -RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDISPDIVAEQKKLEAADL
3f2vA           -----------------------------------DAVRQHTDRFHELYAVYPQGKDVAAEQKLIETHDS
3eywB           --------------------------------------------------------DIAAEQEALSRADL
3eywA           --------------------------------------------------------DIAAEQEALSRADL
2v9cA           --------------------------------------------------------------------DL


                         .         .         *         .         .         .         .:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
1zx1B           VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVN
1sg0A           VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVN
3fw1A           VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVN
1zx1A           VIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIP------FYDSGLLQGKLALLSVTTGGTAEMYTKTGVN
1qrdA           VIFQFPLYWFGVPAILKGWFERVLVAGFAYTYATM-----YDKGPFQNKKTLLSITTGGSSLQGVHGDMN
1dxqA           VIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAM-----YDNGPFQNKKTLLSITTGGSSLQGVHGDMN
1qbgA           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
1kbqB           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
1kbqA           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
1h69A           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
1d4aA           VIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSSLQGIHGDMN
3f2vA           LVWQFPIYWFNCPPLLKQWLDEVLTYGWAYGSKGKA---------LKGRKIALAVSLGAP----------
3eywB           IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
3eywA           IVWQHPMQWYSIPPLLKLWIDKVFSHGWAY----------------------------------------
2v9cA           LVISTPMYNFSVPSGLKAWIDQIVRLGVTFDFVLDVAQY-RPL--LRGKRALIVTSRG------------


                         +         .         .         .         .         *         .:210
query           LPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI
1zx1B           GDSRPLQHGTLHFCGFKVLAPQISFAPEIASEEERK-------------
1sg0A           GDSRPLQHGTLHFCGFKVLAPQISFAPEIASEEERK-------------
3fw1A           GDSRPLQHGTLHFCGFKVLAPQISFAPEIASEEERK-------------
1zx1A           GDSRPLQHGTLHFCGFKVLAPQISFAPEIASEEERK-------------
1qrdA           VILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETV
1dxqA           VILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETV
1qbgA           VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
1kbqB           VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
1kbqA           VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
1h69A           VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
1d4aA           VILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI
3f2vA           -------------------------------------------------
3eywB           -------------------------------------------------
3eywA           -------------------------------------------------
2v9cA           -------------------------------------------------