[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ20838.1

[Show Plain Result]


## Summary of Sequence Search
    1::483
 2337::2403    2e-04  34% 3120 aa  RPOC2_CHLRE RecName: Full=DNA-directed RNA polymerase subunit beta'';
   81::176     3e-04  36%  360 aa  Y871_RICPR RecName: Full=Uncharacterized protein RP871;
    1::483

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPOC2_CHLRE     ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPOC2_CHLRE     ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPOC2_CHLRE     ----------------------------------------------------------------------
Y871_RICPR      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKDQIVIFQSDGSRIYNS
RPOC2_CHLRE     --------------------------------------------------------------------NG
Y871_RICPR      ----------------------------------------------------VERQLIILQTSGVN----


                         .         *         .         .         .         .         +:350
query           KIDYNGQLAINPFDLNLKINLYDYKISNLFTPNSIIYEFIKSGLLFNENISVQTLVNIKSTKKDKIFNEA
RPOC2_CHLRE     IIQAKSLLHTLPTNLNYNLKWINYKQKNIFTTNKVGFFFLKGNTFFNTS---QKLFNKKITKQTTFLN--
Y871_RICPR      ----NIQLALPALYVALTIMLLAYYISSTILPLSHIN--LKSRLNFIKNNYISSMIEEKTTKNITVFIDK


                         .         .         .         .         *         .         .:420
query           KLELKVLNGKINFDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPOC2_CHLRE     ----------------------------------------------------------------------
Y871_RICPR      KLTGNIMNGIIIFD--------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPOC2_CHLRE     ---------------------------------------------------------------
Y871_RICPR      ---------------------------------------------------------------