[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ20846.1

[Show Plain Result]


## Summary of Sequence Search
    1::304
    1::304     e-158 100%  304 aa  DDL_PELUB RecName: Full=D-alanine--D-alanine ligase;       
    1::298     6e-60  42%  302 aa  DDL_RHORT RecName: Full=D-alanine--D-alanine ligase;       
    5::305     2e-59  44%  321 aa  DDL_ZYMMO RecName: Full=D-alanine--D-alanine ligase;       
    1::302     2e-59  41%  305 aa  DDL_MAGSA RecName: Full=D-alanine--D-alanine ligase;       
    6::306     2e-58  42%  306 aa  DDL_BARHE RecName: Full=D-alanine--D-alanine ligase;       
    1::304     3e-58  42%  304 aa  DDL_MARMM RecName: Full=D-alanine--D-alanine ligase;       
    3::308     5e-58  43%  308 aa  DDLB_RHILO RecName: Full=D-alanine--D-alanine ligase B;       
    3::301     2e-57  43%  317 aa  DDL_WOLWR RecName: Full=D-alanine--D-alanine ligase;       
    1::299     2e-57  43%  315 aa  DDL_WOLPM RecName: Full=D-alanine--D-alanine ligase;       
    1::307     3e-57  41%  307 aa  DDL_METRJ RecName: Full=D-alanine--D-alanine ligase;       
    1::307     4e-57  42%  307 aa  DDL_METPB RecName: Full=D-alanine--D-alanine ligase;       
    5::308     1e-56  43%  308 aa  DDL_PARL1 RecName: Full=D-alanine--D-alanine ligase;       
    4::306     2e-56  41%  306 aa  DDL_RHISN RecName: Full=D-alanine--D-alanine ligase;       
    3::305     3e-56  43%  317 aa  DDL_WOLPP RecName: Full=D-alanine--D-alanine ligase;       
   23::318     3e-56  41%  321 aa  DDL_RICB8 RecName: Full=D-alanine--D-alanine ligase;       
    1::307     3e-56  39%  307 aa  DDL_BEII9 RecName: Full=D-alanine--D-alanine ligase;       
    1::307     4e-56  41%  307 aa  DDL_METEP RecName: Full=D-alanine--D-alanine ligase;       
    1::307     4e-56  41%  307 aa  DDL_METC4 RecName: Full=D-alanine--D-alanine ligase;       
   23::318     6e-56  41%  321 aa  DDL_RICTY RecName: Full=D-alanine--D-alanine ligase;       
   23::318     6e-56  41%  321 aa  DDL_RICBR RecName: Full=D-alanine--D-alanine ligase;       
    9::303     7e-56  44%  305 aa  DDL_GEOSM RecName: Full=D-alanine--D-alanine ligase;       
    4::306     1e-55  41%  306 aa  DDL_BART1 RecName: Full=D-alanine--D-alanine ligase;       
    1::307     2e-55  39%  307 aa  DDL_METSB RecName: Full=D-alanine--D-alanine ligase;       
    7::305     5e-55  41%  312 aa  DDL_SPHWW RecName: Full=D-alanine--D-alanine ligase;       
   23::318     5e-55  40%  321 aa  DDL_RICFE RecName: Full=D-alanine--D-alanine ligase;       
   19::329     8e-55  43%  339 aa  DDL_WOLTR RecName: Full=D-alanine--D-alanine ligase;       
    8::306     1e-54  42%  310 aa  DDL_GEOUR RecName: Full=D-alanine--D-alanine ligase;       
    4::306     1e-54  41%  306 aa  DDL_BARBK RecName: Full=D-alanine--D-alanine ligase;       
    8::306     2e-54  40%  308 aa  DDL_SPHAL RecName: Full=D-alanine--D-alanine ligase;       
    1::306     2e-54  40%  306 aa  DDL_XANP2 RecName: Full=D-alanine--D-alanine ligase;       
   56::351     2e-54  40%  354 aa  DDL_RICCK RecName: Full=D-alanine--D-alanine ligase;       
    8::307     2e-54  42%  316 aa  DDL_GEOSL RecName: Full=D-alanine--D-alanine ligase;       
    4::308     3e-54  43%  308 aa  DDL_MESSB RecName: Full=D-alanine--D-alanine ligase;       
   10::306     4e-54  41%  306 aa  DDL_SILST RecName: Full=D-alanine--D-alanine ligase;       
    7::308     4e-54  38%  308 aa  DDL_OLICO RecName: Full=D-alanine--D-alanine ligase;       
    4::304     7e-54  39%  307 aa  DDL_GRABC RecName: Full=D-alanine--D-alanine ligase;       
    9::303     1e-53  43%  305 aa  DDL_GEOBB RecName: Full=D-alanine--D-alanine ligase;       
    9::305     2e-53  39%  305 aa  DDL_PELCD RecName: Full=D-alanine--D-alanine ligase;       
    2::294     3e-53  42%  296 aa  DDL_THELT RecName: Full=D-alanine--D-alanine ligase;       
   23::318     3e-53  39%  321 aa  DDL_RICRS RecName: Full=D-alanine--D-alanine ligase;       
   23::318     3e-53  39%  321 aa  DDL_RICRO RecName: Full=D-alanine--D-alanine ligase;       
    4::308     3e-53  43%  308 aa  DDL_OCHA4 RecName: Full=D-alanine--D-alanine ligase;       
    5::308     3e-53  38%  308 aa  DDL_RHOPB RecName: Full=D-alanine--D-alanine ligase;       
   23::318     5e-53  39%  321 aa  DDL_RICPR RecName: Full=D-alanine--D-alanine ligase;       
   23::318     5e-53  39%  321 aa  DDL_RICCN RecName: Full=D-alanine--D-alanine ligase;       
   23::318     6e-53  39%  321 aa  DDL_RICAE RecName: Full=D-alanine--D-alanine ligase;       
    9::307     6e-53  40%  323 aa  DDL_ERYLH RecName: Full=D-alanine--D-alanine ligase;       
    2::296     8e-53  43%  304 aa  DDL_THEYD RecName: Full=D-alanine--D-alanine ligase;       
    5::308     1e-52  37%  308 aa  DDL_RHOP5 RecName: Full=D-alanine--D-alanine ligase;       
    8::306     1e-52  39%  313 aa  DDL_NOVAD RecName: Full=D-alanine--D-alanine ligase;       
    4::308     2e-52  45%  308 aa  DDL_AGRT5 RecName: Full=D-alanine--D-alanine ligase;       
   23::318     3e-52  38%  321 aa  DDL_RICM5 RecName: Full=D-alanine--D-alanine ligase;       
    5::306     3e-52  43%  306 aa  DDL_HYPNA RecName: Full=D-alanine--D-alanine ligase;       
    2::303     4e-52  40%  312 aa  DDL_CARHZ RecName: Full=D-alanine--D-alanine ligase;       
   24::317     5e-52  39%  320 aa  DDL_RICAH RecName: Full=D-alanine--D-alanine ligase;       
   11::307     7e-52  40%  307 aa  DDL_RHOS5 RecName: Full=D-alanine--D-alanine ligase;       
    2::290     7e-52  41%  291 aa  DDL_AQUAE RecName: Full=D-alanine--D-alanine ligase;       
    7::306     8e-52  40%  308 aa  DDL_ANADF RecName: Full=D-alanine--D-alanine ligase;       
   10::306     1e-51  39%  306 aa  DDL_SILPO RecName: Full=D-alanine--D-alanine ligase;       
   12::308     1e-51  37%  308 aa  DDL_DINSH RecName: Full=D-alanine--D-alanine ligase;       
   11::307     2e-51  39%  307 aa  DDL_RHOS4 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     2e-51  39%  307 aa  DDL_RHOS1 RecName: Full=D-alanine--D-alanine ligase;       
   23::320     7e-51  39%  323 aa  DDL_RICPU RecName: Full=D-alanine--D-alanine ligase;       
    6::306     9e-51  39%  310 aa  DDL_PELPD RecName: Full=D-alanine--D-alanine ligase;       
    2::295     4e-50  40%  303 aa  DDL_THEP1 RecName: Full=D-alanine--D-alanine ligase;       
    3::308     4e-50  39%  308 aa  DDL_RHIME RecName: Full=D-alanine--D-alanine ligase;       
    9::307     4e-50  41%  313 aa  DDL_GEOLS RecName: Full=D-alanine--D-alanine ligase;       
    2::295     5e-50  39%  303 aa  DDL_THESQ RecName: Full=D-alanine--D-alanine ligase;       
    2::295     5e-50  39%  303 aa  DDL_THEMA RecName: Full=D-alanine--D-alanine ligase;       
    5::312     5e-50  44%  316 aa  DDL_FERNB RecName: Full=D-alanine--D-alanine ligase;       
    1::306     6e-50  38%  306 aa  DDL_AZOC5 RecName: Full=D-alanine--D-alanine ligase;       
    2::300     1e-49  38%  303 aa  DDL_GLUOX RecName: Full=D-alanine--D-alanine ligase;       
   35::306     4e-49  41%  306 aa  DDL_BARQU RecName: Full=D-alanine--D-alanine ligase;       
    3::308     5e-49  39%  308 aa  DDL_SINMW RecName: Full=D-alanine--D-alanine ligase;       
   11::315     5e-49  39%  315 aa  DDLB_BRUME RecName: Full=D-alanine--D-alanine ligase B;       
    7::316     7e-49  38%  316 aa  DDL_JANSC RecName: Full=D-alanine--D-alanine ligase;       
    4::308     9e-49  39%  308 aa  DDLB_BRUSU RecName: Full=D-alanine--D-alanine ligase B;       
   14::316     1e-48  39%  322 aa  DDL_CAUSK RecName: Full=D-alanine--D-alanine ligase;       
   23::319     3e-48  38%  319 aa  DDL_ROSDO RecName: Full=D-alanine--D-alanine ligase;       
    4::295     3e-48  37%  296 aa  DDL_FRATN RecName: Full=D-alanine--D-alanine ligase;       
    7::306     3e-48  38%  308 aa  DDL_ANASK RecName: Full=D-alanine--D-alanine ligase;       
    7::306     3e-48  38%  308 aa  DDL_ANAD2 RecName: Full=D-alanine--D-alanine ligase;       
    2::298     3e-48  38%  301 aa  DDL_ACICJ RecName: Full=D-alanine--D-alanine ligase;       
    4::295     4e-48  37%  296 aa  DDL_FRATT RecName: Full=D-alanine--D-alanine ligase;       
    4::295     4e-48  37%  296 aa  DDL_FRATO RecName: Full=D-alanine--D-alanine ligase;       
    4::295     4e-48  37%  296 aa  DDL_FRATF RecName: Full=D-alanine--D-alanine ligase;       
    4::295     4e-48  37%  296 aa  DDL_FRAT1 RecName: Full=D-alanine--D-alanine ligase;       
    4::295     1e-47  37%  296 aa  DDL_FRATW RecName: Full=D-alanine--D-alanine ligase;       
    2::297     1e-47  39%  302 aa  DDL_GLOVI RecName: Full=D-alanine--D-alanine ligase;       
    4::295     1e-47  37%  296 aa  DDL_FRATH RecName: Full=D-alanine--D-alanine ligase;       
    3::302     2e-47  38%  323 aa  DDL_SYNJA RecName: Full=D-alanine--D-alanine ligase;       
    7::306     8e-47  38%  308 aa  DDL_ANADE RecName: Full=D-alanine--D-alanine ligase;       
   14::314     1e-46  38%  324 aa  DDL_CAUCR RecName: Full=D-alanine--D-alanine ligase;       
    4::295     2e-46  37%  297 aa  DDL_FRAP2 RecName: Full=D-alanine--D-alanine ligase;       
    3::306     2e-46  39%  309 aa  DDL_SYNWW RecName: Full=D-alanine--D-alanine ligase;       
    3::302     7e-46  38%  325 aa  DDL_SYNJB RecName: Full=D-alanine--D-alanine ligase;       
    1::301     1e-45  35%  306 aa  DDL_DESAP RecName: Full=D-alanine--D-alanine ligase;       
   15::312     4e-44  37%  317 aa  DDL_COLP3 RecName: Full=D-alanine--D-alanine ligase;       
    1::303     9e-44  38%  306 aa  DDL_PECCP RecName: Full=D-alanine--D-alanine ligase;       
    6::309     1e-43  36%  310 aa  DDL_MAGSM RecName: Full=D-alanine--D-alanine ligase;       
    6::303     1e-43  37%  306 aa  DDL_HAEIN RecName: Full=D-alanine--D-alanine ligase;       
    1::303     1e-43  44%  306 aa  DDL_BUCAP RecName: Full=D-alanine--D-alanine ligase;       
    6::300     3e-43  37%  303 aa  DDL_HAEDU RecName: Full=D-alanine--D-alanine ligase;       
   15::301     6e-43  39%  307 aa  DDL_ALCBS RecName: Full=D-alanine--D-alanine ligase;       
    6::303     7e-43  37%  306 aa  DDL_HAEI8 RecName: Full=D-alanine--D-alanine ligase;       
    2::299     9e-43  43%  302 aa  DDLB_CLOPE RecName: Full=D-alanine--D-alanine ligase B;       
    6::303     1e-42  37%  306 aa  DDL_HAEIG RecName: Full=D-alanine--D-alanine ligase;       
    2::274     1e-42  37%  287 aa  DDL_FUSNN RecName: Full=D-alanine--D-alanine ligase;       
    2::296     2e-42  38%  301 aa  DDL_CLOB8 RecName: Full=D-alanine--D-alanine ligase;       
    1::303     3e-42  37%  306 aa  DDLB_ECOLI RecName: Full=D-alanine--D-alanine ligase B;       
    1::303     4e-42  37%  306 aa  DDLB_ECO57 RecName: Full=D-alanine--D-alanine ligase B;       
    1::294     6e-42  37%  297 aa  DDL_HAEIE RecName: Full=D-alanine--D-alanine ligase;       
    6::300     6e-42  36%  303 aa  DDL_ACTPJ RecName: Full=D-alanine--D-alanine ligase;       
    6::300     6e-42  36%  303 aa  DDL_ACTP7 RecName: Full=D-alanine--D-alanine ligase;       
    6::300     6e-42  36%  303 aa  DDL_ACTP2 RecName: Full=D-alanine--D-alanine ligase;       
    1::303     8e-42  37%  306 aa  DDLB_SHIFL RecName: Full=D-alanine--D-alanine ligase B;       
    2::296     1e-41  35%  301 aa  DDL_CLOBA RecName: Full=D-alanine--D-alanine ligase;       
    7::304     1e-41  34%  307 aa  DDL_ACTSZ RecName: Full=D-alanine--D-alanine ligase;       
    8::305     2e-41  35%  309 aa  DDL_PASMU RecName: Full=D-alanine--D-alanine ligase;       
   18::309     3e-41  38%  314 aa  DDL_SACD2 RecName: Full=D-alanine--D-alanine ligase;       
    1::312     3e-41  35%  318 aa  DDL_PELTS RecName: Full=D-alanine--D-alanine ligase;       
    7::304     4e-41  34%  307 aa  DDL_MANSM RecName: Full=D-alanine--D-alanine ligase;       
    2::293     5e-41  34%  304 aa  DDL_BACAN RecName: Full=D-alanine--D-alanine ligase;       
    2::293     5e-41  34%  304 aa  DDL_BACAC RecName: Full=D-alanine--D-alanine ligase;       
    2::293     5e-41  34%  304 aa  DDL_BACAA RecName: Full=D-alanine--D-alanine ligase;       
    2::293     5e-41  37%  301 aa  DDLA_CLOTE RecName: Full=D-alanine--D-alanine ligase A;       
   10::303     7e-41  35%  306 aa  DDL_PSEHT RecName: Full=D-alanine--D-alanine ligase;       
    1::307     7e-41  35%  312 aa  DDL_DESRM RecName: Full=D-alanine--D-alanine ligase;       
    2::293     7e-41  36%  300 aa  DDL_CLOBL RecName: Full=D-alanine--D-alanine ligase;       
    2::296     7e-41  35%  301 aa  DDL_CLOBB RecName: Full=D-alanine--D-alanine ligase;       
    2::296     7e-41  36%  305 aa  DDL_BACHD RecName: Full=D-alanine--D-alanine ligase;       
   12::318     9e-41  36%  319 aa  DDL_METPP RecName: Full=D-alanine--D-alanine ligase;       
    1::303     9e-41  37%  306 aa  DDLB_SALTY RecName: Full=D-alanine--D-alanine ligase B;       
   20::314     9e-41  36%  319 aa  DDLB_PSESM RecName: Full=D-alanine--D-alanine ligase B;       
    8::306     1e-40  37%  311 aa  DDL_SYNFM RecName: Full=D-alanine--D-alanine ligase;       
    1::303     1e-40  37%  306 aa  DDL_SALPK RecName: Full=D-alanine--D-alanine ligase;       
    1::303     1e-40  37%  306 aa  DDL_SALPA RecName: Full=D-alanine--D-alanine ligase;       
    7::301     1e-40  37%  302 aa  DDL_METFK RecName: Full=D-alanine--D-alanine ligase;       
    2::293     1e-40  36%  300 aa  DDL_CLOBK RecName: Full=D-alanine--D-alanine ligase;       
    2::293     1e-40  36%  300 aa  DDL_CLOBJ RecName: Full=D-alanine--D-alanine ligase;       
    2::293     1e-40  36%  300 aa  DDL_CLOBH RecName: Full=D-alanine--D-alanine ligase;       
    2::293     1e-40  36%  300 aa  DDL_CLOB1 RecName: Full=D-alanine--D-alanine ligase;       
    1::303     1e-40  37%  306 aa  DDLB_SALTI RecName: Full=D-alanine--D-alanine ligase B;       
   20::314     1e-40  36%  319 aa  DDLB_PSEAE RecName: Full=D-alanine--D-alanine ligase B;       
    5::293     2e-40  37%  303 aa  DDL_METI4 RecName: Full=D-alanine--D-alanine ligase;       
    2::293     2e-40  37%  300 aa  DDL_CLOBM RecName: Full=D-alanine--D-alanine ligase;       
    1::303     3e-40  36%  306 aa  DDL_PHOLL RecName: Full=D-alanine--D-alanine ligase;       
    2::303     3e-40  34%  309 aa  DDL_MOOTA RecName: Full=D-alanine--D-alanine ligase;       
    7::312     3e-40  35%  320 aa  DDL_JANMA RecName: Full=D-alanine--D-alanine ligase;       
    2::294     3e-40  36%  297 aa  DDL_CLOK5 RecName: Full=D-alanine--D-alanine ligase;       
    2::294     3e-40  36%  297 aa  DDL_CLOK1 RecName: Full=D-alanine--D-alanine ligase;       
    9::300     3e-40  37%  308 aa  DDL_ACIBY RecName: Full=D-alanine--D-alanine ligase;       
    9::301     3e-40  36%  308 aa  DDL_ACIBT RecName: Full=D-alanine--D-alanine ligase;       
    9::301     3e-40  36%  308 aa  DDL_ACIBC RecName: Full=D-alanine--D-alanine ligase;       
    9::300     3e-40  37%  308 aa  DDL_ACIB5 RecName: Full=D-alanine--D-alanine ligase;       
    9::300     3e-40  37%  308 aa  DDL_ACIB3 RecName: Full=D-alanine--D-alanine ligase;       
    8::300     6e-40  36%  305 aa  DDL_NITEU RecName: Full=D-alanine--D-alanine ligase;       
   10::310     6e-40  37%  317 aa  DDL_MARMS RecName: Full=D-alanine--D-alanine ligase;       
    8::305     6e-40  36%  308 aa  DDL_HAES1 RecName: Full=D-alanine--D-alanine ligase;       
   18::315     7e-40  35%  318 aa  DDL_XANAC RecName: Full=D-alanine--D-alanine ligase;       
    8::305     7e-40  35%  308 aa  DDL_HAES2 RecName: Full=D-alanine--D-alanine ligase;       
    1::303     7e-40  37%  306 aa  DDLB_ECOL6 RecName: Full=D-alanine--D-alanine ligase B;       
    2::300     7e-40  33%  301 aa  DDLA_CLOPE RecName: Full=D-alanine--D-alanine ligase A;       
    9::301     1e-39  36%  308 aa  DDL_ACIBS RecName: Full=D-alanine--D-alanine ligase;       
    8::300     1e-39  36%  306 aa  DDL_NITEC RecName: Full=D-alanine--D-alanine ligase;       
   19::310     2e-39  35%  324 aa  DDL_PSEPF RecName: Full=D-alanine--D-alanine ligase;       
    2::300     2e-39  33%  301 aa  DDL_CLOPS RecName: Full=D-alanine--D-alanine ligase;       
    1::290     2e-39  33%  301 aa  DDLA_BACCR RecName: Full=D-alanine--D-alanine ligase A;       
   18::315     2e-39  40%  318 aa  DDLB_XANCP RecName: Full=D-alanine--D-alanine ligase B;       
    8::303     3e-39  34%  309 aa  DDL_IDILO RecName: Full=D-alanine--D-alanine ligase;       
   23::329     4e-39  35%  338 aa  DDL_POLSJ RecName: Full=D-alanine--D-alanine ligase;       
   14::317     6e-39  33%  334 aa  DDL_HERAR RecName: Full=D-alanine--D-alanine ligase;       
    6::299     8e-39  37%  301 aa  DDL_DECAR RecName: Full=D-alanine--D-alanine ligase;       
   14::308     8e-39  33%  334 aa  DDL_ANAMM RecName: Full=D-alanine--D-alanine ligase;       
   14::308     8e-39  33%  334 aa  DDL_ANAMF RecName: Full=D-alanine--D-alanine ligase;       
    9::300     8e-39  36%  309 aa  DDL_ACIAD RecName: Full=D-alanine--D-alanine ligase;       
   68::308     1e-38  38%  314 aa  DDL_CHRSD RecName: Full=D-alanine--D-alanine ligase;       
   17::304     1e-38  36%  313 aa  DDL_THICR RecName: Full=D-alanine--D-alanine ligase;       
   24::317     1e-38  36%  325 aa  DDL_MARAV RecName: Full=D-alanine--D-alanine ligase;       
   14::308     3e-38  34%  313 aa  DDL_PSEMY RecName: Full=D-alanine--D-alanine ligase;       
   29::325     3e-38  36%  337 aa  DDL_POLNS RecName: Full=D-alanine--D-alanine ligase;       
    6::303     3e-38  37%  304 aa  DDL_NEIMB RecName: Full=D-alanine--D-alanine ligase;       
    1::316     3e-38  38%  320 aa  DDL_HAMD5 RecName: Full=D-alanine--D-alanine ligase;       
    1::303     3e-38  36%  306 aa  DDL_ERWCT RecName: Full=D-alanine--D-alanine ligase;       
    2::293     3e-38  34%  300 aa  DDL_CLOB6 RecName: Full=D-alanine--D-alanine ligase;       
    6::289     3e-38  36%  303 aa  DDLB_CHRVO RecName: Full=D-alanine--D-alanine ligase B;       
    6::303     4e-38  36%  304 aa  DDL_NEIG2 RecName: Full=D-alanine--D-alanine ligase;       
    6::303     4e-38  36%  304 aa  DDL_NEIG1 RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPY RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPS RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPP RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPN RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPG RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPE RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPB RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERPA RecName: Full=D-alanine--D-alanine ligase;       
    1::302     5e-38  34%  306 aa  DDL_YERP3 RecName: Full=D-alanine--D-alanine ligase;       
    6::303     5e-38  36%  304 aa  DDL_NEIMA RecName: Full=D-alanine--D-alanine ligase;       
    7::306     5e-38  36%  317 aa  DDL_BORA1 RecName: Full=D-alanine--D-alanine ligase;       
   16::317     9e-38  33%  327 aa  DDL_RALEJ RecName: Full=D-alanine--D-alanine ligase;       
    3::347     9e-38  37%  351 aa  DDL_LEPIN RecName: Full=D-alanine--D-alanine ligase;       
  101::366     9e-38  40%  376 aa  DDL_CLOTH RecName: Full=D-alanine--D-alanine ligase;       
    6::303     1e-37  36%  304 aa  DDL_NEIMF RecName: Full=D-alanine--D-alanine ligase;       
   19::317     2e-37  34%  318 aa  DDL_PSEE4 RecName: Full=D-alanine--D-alanine ligase;       
   10::316     2e-37  34%  325 aa  DDL_POLNA RecName: Full=D-alanine--D-alanine ligase;       
   11::307     2e-37  37%  308 aa  DDL_LARHH RecName: Full=D-alanine--D-alanine ligase;       
    1::303     2e-37  35%  306 aa  DDL_ERWT9 RecName: Full=D-alanine--D-alanine ligase;       
    3::347     3e-37  37%  351 aa  DDL_LEPIC RecName: Full=D-alanine--D-alanine ligase;       
    2::339     3e-37  37%  351 aa  DDL_PEDPA RecName: Full=D-alanine--D-alanine ligase;       
   15::309     5e-37  33%  314 aa  DDL_PSEU5 RecName: Full=D-alanine--D-alanine ligase;       
   12::303     5e-37  36%  316 aa  DDL_NITOC RecName: Full=D-alanine--D-alanine ligase;       
    9::300     6e-37  35%  306 aa  DDL_NITMU RecName: Full=D-alanine--D-alanine ligase;       
    6::300     6e-37  33%  303 aa  DDL_HAEPS RecName: Full=D-alanine--D-alanine ligase;       
   16::317     6e-37  33%  327 aa  DDL_CUPTR RecName: Full=D-alanine--D-alanine ligase;       
   19::317     8e-37  34%  318 aa  DDLB_PSEPK RecName: Full=D-alanine--D-alanine ligase B;       
   19::317     1e-36  35%  318 aa  DDL_PSEPG RecName: Full=D-alanine--D-alanine ligase;       
    3::303     1e-36  33%  304 aa  DDL_COPPD RecName: Full=D-alanine--D-alanine ligase;       
   11::303     1e-36  37%  311 aa  DDL_ALHEH RecName: Full=D-alanine--D-alanine ligase;       
   11::307     1e-36  35%  313 aa  DDL_BURXL RecName: Full=D-alanine--D-alanine ligase;       
   28::330     2e-36  38%  346 aa  DDL_RHOFD RecName: Full=D-alanine--D-alanine ligase;       
    1::311     2e-36  33%  325 aa  DDL_SOLUE RecName: Full=D-alanine--D-alanine ligase;       
   73::341     3e-36  35%  365 aa  DDL_NATTJ RecName: Full=D-alanine--D-alanine ligase;       
    7::332     3e-36  35%  346 aa  DDLA_PSEAE RecName: Full=D-alanine--D-alanine ligase A;       
    2::290     7e-36  34%  308 aa  DDL_DESDG RecName: Full=D-alanine--D-alanine ligase;       
  105::358     7e-36  40%  376 aa  DDL_CLOCE RecName: Full=D-alanine--D-alanine ligase;       
   12::308     7e-36  34%  309 aa  DDL_AZOSE RecName: Full=D-alanine--D-alanine ligase;       
    3::347     9e-36  36%  351 aa  DDL_LEPBL RecName: Full=D-alanine--D-alanine ligase;       
    3::347     9e-36  36%  351 aa  DDL_LEPBJ RecName: Full=D-alanine--D-alanine ligase;       
    2::294     9e-36  33%  304 aa  DDL_DESMR RecName: Full=D-alanine--D-alanine ligase;       
   12::302     1e-35  34%  304 aa  DDL_HALHL RecName: Full=D-alanine--D-alanine ligase;       
   34::343     2e-35  33%  343 aa  DDL_HALOH RecName: Full=D-alanine--D-alanine ligase;       
   17::316     3e-35  33%  326 aa  DDL_BORPD RecName: Full=D-alanine--D-alanine ligase;       
   12::306     4e-35  35%  310 aa  DDL_THIDA RecName: Full=D-alanine--D-alanine ligase;       
   25::317     4e-35  33%  327 aa  DDL_RALEH RecName: Full=D-alanine--D-alanine ligase;       
   19::317     4e-35  33%  318 aa  DDL_PSEA6 RecName: Full=D-alanine--D-alanine ligase;       
    2::340     4e-35  38%  350 aa  DDL_LACSS RecName: Full=D-alanine--D-alanine ligase;       
   37::328     7e-35  37%  332 aa  DDL_PSYWF RecName: Full=D-alanine--D-alanine ligase;       
   52::351     7e-35  37%  363 aa  DDL_CHLL2 RecName: Full=D-alanine--D-alanine ligase;       
    1::301     9e-35  32%  304 aa  DDL_XYLFT RecName: Full=D-alanine--D-alanine ligase;       
    1::301     9e-35  32%  304 aa  DDL_XYLFA RecName: Full=D-alanine--D-alanine ligase;       
    2::292     9e-35  38%  293 aa  DDL_VESOH RecName: Full=D-alanine--D-alanine ligase;       
    2::292     1e-34  38%  293 aa  DDL_RUTMC RecName: Full=D-alanine--D-alanine ligase;       
   27::317     1e-34  34%  327 aa  DDL_RALME RecName: Full=D-alanine--D-alanine ligase;       
   11::307     1e-34  34%  313 aa  DDL_BURVG RecName: Full=D-alanine--D-alanine ligase;       
   43::317     2e-34  36%  337 aa  DDL_POLSQ RecName: Full=D-alanine--D-alanine ligase;       
   15::317     2e-34  35%  332 aa  DDL_DIAST RecName: Full=D-alanine--D-alanine ligase;       
   15::317     2e-34  35%  332 aa  DDL_ACISJ RecName: Full=D-alanine--D-alanine ligase;       
    2::295     2e-34  32%  303 aa  DDL_DESVH RecName: Full=D-alanine--D-alanine ligase;       
   11::307     2e-34  34%  313 aa  DDL_BURCJ RecName: Full=D-alanine--D-alanine ligase;       
    7::306     2e-34  33%  316 aa  DDL_BORPE RecName: Full=D-alanine--D-alanine ligase;       
    7::306     2e-34  33%  316 aa  DDL_BORBR RecName: Full=D-alanine--D-alanine ligase;       
    2::295     4e-34  32%  303 aa  DDL_DESVV RecName: Full=D-alanine--D-alanine ligase;       
   11::307     4e-34  34%  313 aa  DDL_BURM1 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     4e-34  34%  313 aa  DDL_BURCM RecName: Full=D-alanine--D-alanine ligase;       
    3::295     5e-34  33%  302 aa  DDL_DESAD RecName: Full=D-alanine--D-alanine ligase;       
    7::306     5e-34  33%  316 aa  DDL_BORPA RecName: Full=D-alanine--D-alanine ligase;       
   11::307     6e-34  34%  313 aa  DDL_BURPP RecName: Full=D-alanine--D-alanine ligase;       
   11::307     6e-34  34%  313 aa  DDL_BURCC RecName: Full=D-alanine--D-alanine ligase;       
    4::345     8e-34  34%  359 aa  DDL_THEPX RecName: Full=D-alanine--D-alanine ligase;       
    4::345     8e-34  34%  359 aa  DDL_THEP3 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     8e-34  34%  312 aa  DDL_BURTA RecName: Full=D-alanine--D-alanine ligase;       
   11::307     1e-33  33%  313 aa  DDL_BURA4 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     2e-33  33%  313 aa  DDL_BURCH RecName: Full=D-alanine--D-alanine ligase;       
   11::307     2e-33  33%  313 aa  DDL_BURCA RecName: Full=D-alanine--D-alanine ligase;       
    1::346     2e-33  34%  364 aa  DDL_CALS8 RecName: Full=D-alanine--D-alanine ligase;       
   15::317     3e-33  35%  326 aa  DDL_DELAS RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURPS RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURP6 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURP1 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURP0 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURMS RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURMA RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURM9 RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-33  34%  312 aa  DDL_BURM7 RecName: Full=D-alanine--D-alanine ligase;       
   13::305     4e-33  33%  309 aa  DDL_METCA RecName: Full=D-alanine--D-alanine ligase;       
    1::338     4e-33  39%  343 aa  DDL_CLOAB RecName: Full=D-alanine--D-alanine ligase;       
    3::347     4e-33  35%  365 aa  DDL_BDEBA RecName: Full=D-alanine--D-alanine ligase;       
    1::345     5e-33  35%  364 aa  DDL_ANATD RecName: Full=D-alanine--D-alanine ligase;       
    4::309     7e-33  39%  309 aa  DDL_BUCBP RecName: Full=D-alanine--D-alanine ligase;       
   46::348     9e-33  32%  370 aa  DDL_LACPL RecName: Full=D-alanine--D-alanine ligase;       
   10::310     9e-33  33%  322 aa  DDL_DESPS RecName: Full=D-alanine--D-alanine ligase;       
    1::330     1e-32  37%  348 aa  DDL_STRTD RecName: Full=D-alanine--D-alanine ligase;       
    1::330     1e-32  37%  348 aa  DDL_STRT2 RecName: Full=D-alanine--D-alanine ligase;       
    1::330     2e-32  36%  348 aa  DDL_STRT1 RecName: Full=D-alanine--D-alanine ligase;       
    1::331     3e-32  35%  349 aa  DDL_STRMU RecName: Full=D-alanine--D-alanine ligase;       
   11::307     3e-32  32%  313 aa  DDL_BURP8 RecName: Full=D-alanine--D-alanine ligase;       
    1::338     3e-32  35%  366 aa  DDL_OCEIH RecName: Full=D-alanine--D-alanine ligase;       
  101::354     4e-32  37%  363 aa  DDL_CHLPD RecName: Full=D-alanine--D-alanine ligase;       
    7::303     4e-32  32%  304 aa  DDL_AZOSB RecName: Full=D-alanine--D-alanine ligase;       
   17::319     4e-32  33%  334 aa  DDL_ACIAC RecName: Full=D-alanine--D-alanine ligase;       
    2::334     7e-32  34%  357 aa  DDL_LACCB RecName: Full=D-alanine--D-alanine ligase;       
    2::334     7e-32  34%  357 aa  DDL_LACC3 RecName: Full=D-alanine--D-alanine ligase;       
   86::358     7e-32  40%  358 aa  DDLB_CLOTE RecName: Full=D-alanine--D-alanine ligase B;       
   95::336     7e-32  35%  361 aa  DDLB_BACCR RecName: Full=D-alanine--D-alanine ligase B;       
    3::291     1e-31  35%  298 aa  DDL_PETMO RecName: Full=D-alanine--D-alanine ligase;       
   98::345     1e-31  34%  349 aa  DDL_LEPBP RecName: Full=D-alanine--D-alanine ligase;       
   98::345     1e-31  34%  349 aa  DDL_LEPBA RecName: Full=D-alanine--D-alanine ligase;       
    3::294     1e-31  31%  302 aa  DDL_LAWIP RecName: Full=D-alanine--D-alanine ligase;       
    9::304     2e-31  40%  310 aa  DDL_DICNV RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRU0 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRPZ RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRPM RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRPG RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRPD RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRPC RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRPB RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRP8 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRP6 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRP3 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     2e-31  35%  348 aa  DDL_STRP1 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     3e-31  35%  348 aa  DDL_STRPF RecName: Full=D-alanine--D-alanine ligase;       
    1::329     4e-31  34%  347 aa  DDL_STRPN RecName: Full=D-alanine--D-alanine ligase;       
    1::329     5e-31  33%  347 aa  DDL_STRZJ RecName: Full=D-alanine--D-alanine ligase;       
    1::329     5e-31  33%  347 aa  DDL_STRR6 RecName: Full=D-alanine--D-alanine ligase;       
    1::329     5e-31  33%  347 aa  DDL_STRPJ RecName: Full=D-alanine--D-alanine ligase;       
    1::329     5e-31  33%  347 aa  DDL_STRP2 RecName: Full=D-alanine--D-alanine ligase;       
   88::334     5e-31  35%  348 aa  DDL_STREM RecName: Full=D-alanine--D-alanine ligase;       
    3::301     5e-31  32%  328 aa  DDL_FLAPJ RecName: Full=D-alanine--D-alanine ligase;       
   88::334     6e-31  35%  348 aa  DDL_STRE4 RecName: Full=D-alanine--D-alanine ligase;       
    1::343     1e-30  40%  350 aa  DDL_WIGBR RecName: Full=D-alanine--D-alanine ligase;       
    1::329     1e-30  33%  347 aa  DDL_STRZP RecName: Full=D-alanine--D-alanine ligase;       
    1::329     1e-30  33%  347 aa  DDL_STRP4 RecName: Full=D-alanine--D-alanine ligase;       
  101::354     1e-30  36%  360 aa  DDL_CHLPB RecName: Full=D-alanine--D-alanine ligase;       
    2::295     2e-30  30%  306 aa  DDL_DESDA RecName: Full=D-alanine--D-alanine ligase;       
    4::348     2e-30  32%  368 aa  DDL_BACSK RecName: Full=D-alanine--D-alanine ligase;       
    1::333     2e-30  33%  347 aa  DDL_STRPI RecName: Full=D-alanine--D-alanine ligase;       
    4::352     2e-30  33%  366 aa  DDL_CHLT3 RecName: Full=D-alanine--D-alanine ligase;       
    1::329     3e-30  33%  347 aa  DDL_STRPS RecName: Full=D-alanine--D-alanine ligase;       
   88::334     4e-30  34%  348 aa  DDL_STRS7 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     4e-30  33%  348 aa  DDL_STRA5 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     4e-30  33%  348 aa  DDL_STRA3 RecName: Full=D-alanine--D-alanine ligase;       
   88::330     4e-30  33%  348 aa  DDL_STRA1 RecName: Full=D-alanine--D-alanine ligase;       
   19::307     4e-30  35%  331 aa  DDL_RALPJ RecName: Full=D-alanine--D-alanine ligase;       
   38::350     5e-30  34%  368 aa  DDL_TREDE RecName: Full=D-alanine--D-alanine ligase;       
    1::329     5e-30  33%  347 aa  DDL_STRZT RecName: Full=D-alanine--D-alanine ligase;       
  126::383     5e-30  32%  391 aa  DDL_STRGG RecName: Full=D-alanine--D-alanine ligase;       
   19::320     7e-30  32%  331 aa  DDL_RALSO RecName: Full=D-alanine--D-alanine ligase;       
    1::335     7e-30  33%  343 aa  DDL_CLONN RecName: Full=D-alanine--D-alanine ligase;       
    4::330     1e-29  33%  348 aa  DDL_STRSV RecName: Full=D-alanine--D-alanine ligase;       
   99::350     1e-29  35%  361 aa  DDL_PROVI RecName: Full=D-alanine--D-alanine ligase;       
    4::330     2e-29  34%  348 aa  DDL_STRGC RecName: Full=D-alanine--D-alanine ligase;       
    7::352     2e-29  32%  364 aa  DDL_LEGPL RecName: Full=D-alanine--D-alanine ligase;       
   97::348     2e-29  32%  380 aa  DDL_LACBA RecName: Full=D-alanine--D-alanine ligase;       
   75::315     2e-29  33%  319 aa  DDL_THET2 RecName: Full=D-alanine--D-alanine ligase;       
   51::343     2e-29  35%  364 aa  DDL_CHLP8 RecName: Full=D-alanine--D-alanine ligase;       
    7::352     3e-29  31%  364 aa  DDL_LEGPC RecName: Full=D-alanine--D-alanine ligase;       
    7::352     3e-29  31%  364 aa  DDL_LEGPA RecName: Full=D-alanine--D-alanine ligase;       
   92::343     3e-29  34%  360 aa  DDL_CHLCH RecName: Full=D-alanine--D-alanine ligase;       
  124::381     3e-29  31%  389 aa  DDL_STRCO RecName: Full=D-alanine--D-alanine ligase;       
  120::377     3e-29  31%  385 aa  DDL_STRAW RecName: Full=D-alanine--D-alanine ligase;       
   81::352     5e-29  33%  360 aa  DDL_PROA2 RecName: Full=D-alanine--D-alanine ligase;       
    7::352     5e-29  32%  364 aa  DDL_LEGPH RecName: Full=D-alanine--D-alanine ligase;       
    1::344     5e-29  34%  363 aa  DDLA_PSESM RecName: Full=D-alanine--D-alanine ligase A;       
    4::330     6e-29  33%  356 aa  DDL_STAS1 RecName: Full=D-alanine--D-alanine ligase;       
    1::334     6e-29  34%  357 aa  DDL_STAES RecName: Full=D-alanine--D-alanine ligase;       
    1::334     6e-29  34%  357 aa  DDL_STAEQ RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAW RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAT RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAS RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAN RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAM RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAE RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAC RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAAB RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAA9 RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAA8 RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAA3 RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAA2 RecName: Full=D-alanine--D-alanine ligase;       
    1::339     6e-29  33%  356 aa  DDL_STAA1 RecName: Full=D-alanine--D-alanine ligase;       
   89::334     6e-29  33%  356 aa  DDL_MACCJ RecName: Full=D-alanine--D-alanine ligase;       
  101::343     8e-29  37%  360 aa  DDL_PELPB RecName: Full=D-alanine--D-alanine ligase;       
   96::337     8e-29  34%  362 aa  DDL_BACCN RecName: Full=D-alanine--D-alanine ligase;       
    1::339     1e-28  32%  356 aa  DDL_STAAR RecName: Full=D-alanine--D-alanine ligase;       
    1::318     1e-28  34%  350 aa  DDL_FINM2 RecName: Full=D-alanine--D-alanine ligase;       
  100::339     1e-28  29%  366 aa  DDLA_CHRVO RecName: Full=D-alanine--D-alanine ligase A;       
   92::346     2e-28  33%  358 aa  DDL_ENTHR RecName: Full=D-alanine--D-alanine ligase;       
   96::337     3e-28  35%  367 aa  DDL_GEOKA RecName: Full=D-alanine--D-alanine ligase;       
    1::328     3e-28  32%  339 aa  DDL_DEIGD RecName: Full=D-alanine--D-alanine ligase;       
    4::339     4e-28  32%  356 aa  DDL_STACT RecName: Full=D-alanine--D-alanine ligase;       
   90::352     4e-28  33%  356 aa  DDL_CORA7 RecName: Full=D-alanine--D-alanine ligase;       
   49::346     5e-28  31%  378 aa  DDL_LACRD RecName: Full=D-alanine--D-alanine ligase;       
   96::347     5e-28  32%  377 aa  DDL_LACF3 RecName: Full=D-alanine--D-alanine ligase;       
    2::309     5e-28  34%  323 aa  DDL_FLAJ1 RecName: Full=D-alanine--D-alanine ligase;       
   70::319     7e-28  36%  331 aa  DDL_VEREI RecName: Full=D-alanine--D-alanine ligase;       
   96::337     9e-28  32%  364 aa  DDL_GEOTN RecName: Full=D-alanine--D-alanine ligase;       
   85::331     1e-27  34%  349 aa  DDL_LACLS RecName: Full=D-alanine--D-alanine ligase;       
   85::331     1e-27  34%  349 aa  DDL_LACLM RecName: Full=D-alanine--D-alanine ligase;       
    2::322     1e-27  36%  324 aa  DDL_AZOPC RecName: Full=D-alanine--D-alanine ligase;       
  100::348     2e-27  28%  364 aa  DDLA_SALTY RecName: Full=D-alanine--D-alanine ligase A;       
  100::348     2e-27  28%  364 aa  DDLA_SALTI RecName: Full=D-alanine--D-alanine ligase A;       
   78::334     3e-27  32%  356 aa  DDL_STAHJ RecName: Full=D-alanine--D-alanine ligase;       
   99::355     3e-27  33%  361 aa  DDL_HERA2 RecName: Full=D-alanine--D-alanine ligase;       
  101::343     4e-27  36%  364 aa  DDL_CHLTE RecName: Full=D-alanine--D-alanine ligase;       
    1::340     6e-27  33%  361 aa  DDL_BORAP RecName: Full=D-alanine--D-alanine ligase;       
    5::348     6e-27  30%  375 aa  DDL_BAUCH RecName: Full=D-alanine--D-alanine ligase;       
  101::360     6e-27  32%  373 aa  DDLA_BRAJA RecName: Full=D-alanine--D-alanine ligase A;       
   77::335     7e-27  33%  368 aa  DDL_BLOPB RecName: Full=D-alanine--D-alanine ligase;       
  100::348     7e-27  29%  364 aa  DDLA_SHIFL RecName: Full=D-alanine--D-alanine ligase A;       
  100::348     7e-27  29%  364 aa  DDLA_ECOLI RecName: Full=D-alanine--D-alanine ligase A;       
  100::348     7e-27  29%  364 aa  DDLA_ECOL6 RecName: Full=D-alanine--D-alanine ligase A;       
  100::348     7e-27  29%  364 aa  DDLA_ECO57 RecName: Full=D-alanine--D-alanine ligase A;       
    1::340     9e-27  33%  361 aa  DDL_BORBZ RecName: Full=D-alanine--D-alanine ligase;       
    2::315     1e-26  35%  319 aa  DDL_THET8 RecName: Full=D-alanine--D-alanine ligase;       
   85::331     1e-26  33%  349 aa  DDL_LACLA RecName: Full=D-alanine--D-alanine ligase;       
   99::350     2e-26  33%  361 aa  DDL_PELLD RecName: Full=D-alanine--D-alanine ligase;       
    1::310     2e-26  32%  326 aa  DDL_GRAFK RecName: Full=D-alanine--D-alanine ligase;       
   84::317     3e-26  32%  367 aa  DDL_THEAB RecName: Full=D-alanine--D-alanine ligase;       
    1::328     3e-26  32%  339 aa  DDL_DEIRA RecName: Full=D-alanine--D-alanine ligase;       
   81::367     3e-26  29%  378 aa  DDL_ARTAT RecName: Full=D-alanine--D-alanine ligase;       
   95::341     4e-26  32%  361 aa  DDL_BACLD RecName: Full=D-alanine--D-alanine ligase;       
    2::344     5e-26  32%  365 aa  DDL_BORT9 RecName: Full=D-alanine--D-alanine ligase;       
   88::338     5e-26  33%  354 aa  DDL_BACSU RecName: Full=D-alanine--D-alanine ligase;       
   96::349     6e-26  30%  396 aa  DDL_TREPS RecName: Full=D-alanine--D-alanine ligase;       
   96::349     6e-26  30%  396 aa  DDL_TREPA RecName: Full=D-alanine--D-alanine ligase;       
  100::348     6e-26  38%  370 aa  DDL_LISIN RecName: Full=D-alanine--D-alanine ligase;       
   88::338     6e-26  33%  354 aa  DDL_BACA2 RecName: Full=D-alanine--D-alanine ligase;       
   59::344     1e-25  31%  352 aa  DDL_MICAN RecName: Full=D-alanine--D-alanine ligase;       
   91::346     1e-25  32%  348 aa  DDL_PROMT RecName: Full=D-alanine--D-alanine ligase;       
  100::348     1e-25  29%  366 aa  DDL_PROMH RecName: Full=D-alanine--D-alanine ligase;       
   91::346     1e-25  32%  348 aa  DDL_PROM1 RecName: Full=D-alanine--D-alanine ligase;       
   70::335     2e-25  32%  356 aa  DDL_BORBU RecName: Full=D-alanine--D-alanine ligase;       
   95::339     2e-25  32%  354 aa  DDL_BLOFL RecName: Full=D-alanine--D-alanine ligase;       
    7::340     2e-25  32%  360 aa  DDL_BACP2 RecName: Full=D-alanine--D-alanine ligase;       
   94::341     2e-25  30%  353 aa  DDLA_BRUSU RecName: Full=D-alanine--D-alanine ligase A;       
   58::344     5e-25  31%  352 aa  DDL_CYAP7 RecName: Full=D-alanine--D-alanine ligase;       
    2::342     7e-25  31%  354 aa  DDL_SYNY3 RecName: Full=D-alanine--D-alanine ligase;       
    1::343     7e-25  31%  364 aa  DDL_BORDL RecName: Full=D-alanine--D-alanine ligase;       
  104::358     9e-25  32%  366 aa  DDL_TRIEI RecName: Full=D-alanine--D-alanine ligase;       
    1::343     9e-25  31%  364 aa  DDL_BORRA RecName: Full=D-alanine--D-alanine ligase;       
  105::353     9e-25  26%  373 aa  DDLA_XANCP RecName: Full=D-alanine--D-alanine ligase A;       
   57::345     1e-24  38%  355 aa  DDL_PROM9 RecName: Full=D-alanine--D-alanine ligase;       
  124::364     1e-24  33%  383 aa  DDL_FRASC RecName: Full=D-alanine--D-alanine ligase;       
   94::341     1e-24  30%  353 aa  DDLA_BRUME RecName: Full=D-alanine--D-alanine ligase A;       
    5::337     2e-24  31%  343 aa  VANA_ENTFC RecName: Full=Vancomycin/teicoplanin A-type resistance
   42::336     2e-24  31%  377 aa  DDL_OENOB RecName: Full=D-alanine--D-alanine ligase;       
   87::350     2e-24  29%  357 aa  DDLA_RHILO RecName: Full=D-alanine--D-alanine ligase A;       
    2::335     2e-24  32%  343 aa  VANC_ENTGA RecName: Full=Vancomycin C-type resistance protein vanC;
   15::204     2e-24  32%  205 aa  DDL_ANACE RecName: Full=D-alanine--D-alanine ligase;       
   60::341     3e-24  31%  365 aa  DDL_BORHD RecName: Full=D-alanine--D-alanine ligase;       
    5::334     3e-24  29%  346 aa  VANL_STRCO RecName: Full=Putative D-alanine--D-lactate ligase;     
  100::348     3e-24  32%  370 aa  DDL_LISW6 RecName: Full=D-alanine--D-alanine ligase;       
  100::348     3e-24  32%  370 aa  DDL_LISMO RecName: Full=D-alanine--D-alanine ligase;       
   76::344     3e-24  31%  351 aa  DDL_CYAP8 RecName: Full=D-alanine--D-alanine ligase;       
  109::391     4e-24  30%  395 aa  DDL_BIFLI RecName: Full=D-alanine--D-alanine ligase;       
   90::346     6e-24  30%  353 aa  DDL_SYNP2 RecName: Full=D-alanine--D-alanine ligase;       
  100::348     6e-24  32%  370 aa  DDL_LISMF RecName: Full=D-alanine--D-alanine ligase;       
  105::352     7e-24  27%  366 aa  DDL_SODGM RecName: Full=D-alanine--D-alanine ligase;       
  106::360     1e-23  31%  368 aa  DDL_RHOE4 RecName: Full=D-alanine--D-alanine ligase;       
  451::755     1e-23  35%  802 aa  MUDD_CHLMU RecName: Full=Bifunctional enzyme murC/ddl;Includes:
    1::346     1e-23  31%  361 aa  DDL_BORGA RecName: Full=D-alanine--D-alanine ligase;       
    1::322     2e-23  29%  324 aa  DDL_BACFR RecName: Full=D-alanine--D-alanine ligase;       
   61::355     2e-23  28%  363 aa  DDL_NOCFA RecName: Full=D-alanine--D-alanine ligase;       
  108::359     2e-23  30%  362 aa  DDL_CORU7 RecName: Full=D-alanine--D-alanine ligase;       
  103::357     2e-23  32%  367 aa  DDL_ANAVT RecName: Full=D-alanine--D-alanine ligase;       
  142::424     3e-23  30%  428 aa  DDL_BIFLO RecName: Full=D-alanine--D-alanine ligase;       
   46::347     4e-23  29%  378 aa  DDL_LACS1 RecName: Full=D-alanine--D-alanine ligase;       
  109::391     4e-23  30%  395 aa  DDL_BIFLD RecName: Full=D-alanine--D-alanine ligase;       
   57::345     5e-23  32%  355 aa  DDL_PROMS RecName: Full=D-alanine--D-alanine ligase;       
    1::322     5e-23  28%  324 aa  DDL_BACFN RecName: Full=D-alanine--D-alanine ligase;       
   57::342     6e-23  30%  347 aa  DDL_SYNP6 RecName: Full=D-alanine--D-alanine ligase;       
   57::342     6e-23  30%  347 aa  DDL_SYNE7 RecName: Full=D-alanine--D-alanine ligase;       
    7::345     6e-23  34%  355 aa  DDL_PROMP RecName: Full=D-alanine--D-alanine ligase;       
   98::345     6e-23  39%  355 aa  DDL_PROM0 RecName: Full=D-alanine--D-alanine ligase;       
  120::371     6e-23  29%  373 aa  DDL_CORJK RecName: Full=D-alanine--D-alanine ligase;       
  116::371     6e-23  30%  382 aa  DDL_ARTS2 RecName: Full=D-alanine--D-alanine ligase;       
   93::351     6e-23  30%  352 aa  DDLA_PSEPK RecName: Full=D-alanine--D-alanine ligase A;       
   92::346     8e-23  32%  348 aa  DDL_ENTFA RecName: Full=D-alanine--D-alanine ligase;       
   91::360     1e-22  32%  389 aa  DDL_THETN RecName: Full=D-alanine--D-alanine ligase;       
  105::359     1e-22  29%  367 aa  DDL_MYCGI RecName: Full=D-alanine--D-alanine ligase;       
    2::341     1e-22  30%  366 aa  DDL_HELMI RecName: Full=D-alanine--D-alanine ligase;       
   93::341     2e-22  36%  347 aa  DDL_TROWT RecName: Full=D-alanine--D-alanine ligase;       
   93::341     2e-22  36%  347 aa  DDL_TROW8 RecName: Full=D-alanine--D-alanine ligase;       
   34::342     2e-22  29%  345 aa  DDL_SYNR3 RecName: Full=D-alanine--D-alanine ligase;       
   90::360     2e-22  29%  368 aa  DDL_RHOOB RecName: Full=D-alanine--D-alanine ligase;       
  104::355     2e-22  28%  361 aa  DDL_COREF RecName: Full=D-alanine--D-alanine ligase;       
  109::362     2e-22  28%  365 aa  DDL_CORDI RecName: Full=D-alanine--D-alanine ligase;       
  100::354     2e-22  32%  364 aa  DDL_ANASP RecName: Full=D-alanine--D-alanine ligase;       
  111::358     3e-22  31%  373 aa  DDL_MYCSM RecName: Full=D-alanine--D-alanine ligase;       
  111::358     3e-22  31%  373 aa  DDL_MYCS2 RecName: Full=D-alanine--D-alanine ligase;       
   85::308     3e-22  32%  316 aa  DDL_ENTGA RecName: Full=D-alanine--D-alanine ligase;       
  116::371     4e-22  31%  382 aa  DDL_ARTCA RecName: Full=D-alanine--D-alanine ligase;       
   90::360     5e-22  29%  368 aa  DDL_RHOSR RecName: Full=D-alanine--D-alanine ligase;       
  119::372     5e-22  32%  383 aa  DDL_KOCRD RecName: Full=D-alanine--D-alanine ligase;       
    5::336     7e-22  30%  342 aa  VANB_ENTFA RecName: Full=Vancomycin B-type resistance protein vanB;
  111::365     7e-22  29%  373 aa  DDL_MYCBP RecName: Full=D-alanine--D-alanine ligase;       
  108::362     7e-22  29%  370 aa  DDL_MYCBO RecName: Full=D-alanine--D-alanine ligase;       
   84::349     7e-22  27%  372 aa  DDL_COXBU RecName: Full=D-alanine--D-alanine ligase;       
   84::349     7e-22  27%  372 aa  DDL_COXBR RecName: Full=D-alanine--D-alanine ligase;       
   84::349     7e-22  27%  372 aa  DDL_COXBN RecName: Full=D-alanine--D-alanine ligase;       
   84::349     7e-22  27%  372 aa  DDL_COXB1 RecName: Full=D-alanine--D-alanine ligase;       
    1::322     9e-22  28%  324 aa  DDL_BACTN RecName: Full=D-alanine--D-alanine ligase;       
    1::317     2e-21  31%  329 aa  DDL_VIBHB RecName: Full=D-alanine--D-alanine ligase;       
  111::363     2e-21  29%  373 aa  DDL_MYCTU RecName: Full=D-alanine--D-alanine ligase;       
  111::363     2e-21  29%  373 aa  DDL_MYCTA RecName: Full=D-alanine--D-alanine ligase;       
    6::326     2e-21  35%  329 aa  DDL_AERS4 RecName: Full=D-alanine--D-alanine ligase;       
    1::327     2e-21  28%  330 aa  DDL_PARD8 RecName: Full=D-alanine--D-alanine ligase;       
   38::322     3e-21  29%  336 aa  Y4SG_RHISN RecName: Full=Uncharacterized protein y4sG;
  452::779     3e-21  33%  803 aa  MUDD_CHLTR RecName: Full=Bifunctional enzyme murC/ddl;Includes:
    1::332     5e-21  28%  334 aa  DDL_VIBCM RecName: Full=D-alanine--D-alanine ligase;       
    1::332     5e-21  28%  334 aa  DDL_VIBCH RecName: Full=D-alanine--D-alanine ligase;       
  108::366     5e-21  28%  376 aa  DDL_KINRD RecName: Full=D-alanine--D-alanine ligase;       
  110::360     5e-21  29%  376 aa  DDLB_BRAJA RecName: Full=D-alanine--D-alanine ligase B;       
   82::336     6e-21  31%  343 aa  DDL_THEEB RecName: Full=D-alanine--D-alanine ligase;       
  108::359     6e-21  29%  367 aa  DDL_MYCVP RecName: Full=D-alanine--D-alanine ligase;       
    1::322     6e-21  29%  324 aa  DDL_BACV8 RecName: Full=D-alanine--D-alanine ligase;       
  107::361     8e-21  29%  369 aa  DDL_MYCPA RecName: Full=D-alanine--D-alanine ligase;       
  107::361     8e-21  29%  369 aa  DDL_MYCA1 RecName: Full=D-alanine--D-alanine ligase;       
    3::323     1e-20  30%  331 aa  DDL_VIBSL RecName: Full=D-alanine--D-alanine ligase;       
    1::322     1e-20  29%  329 aa  DDL_VIBC3 RecName: Full=D-alanine--D-alanine ligase;       
  104::378     1e-20  32%  378 aa  DDL_BIFAA RecName: Full=D-alanine--D-alanine ligase;       
    6::328     1e-20  35%  329 aa  DDL_AERHH RecName: Full=D-alanine--D-alanine ligase;       
   55::348     2e-20  26%  377 aa  DDL_LEUMM RecName: Full=D-alanine--D-alanine ligase;       
   55::348     2e-20  26%  377 aa  DDL_LEUME RecName: Full=D-alanine--D-alanine ligase;       
  100::340     2e-20  31%  367 aa  DDL_BRASO RecName: Full=D-alanine--D-alanine ligase;       
  100::340     4e-20  30%  367 aa  DDL_BRASB RecName: Full=D-alanine--D-alanine ligase;       
   63::351     5e-20  31%  351 aa  DDL_PROMA RecName: Full=D-alanine--D-alanine ligase;       
  111::365     5e-20  28%  373 aa  DDL_MYCUA RecName: Full=D-alanine--D-alanine ligase;       
   90::351     7e-20  29%  353 aa  DDL_SYNS3 RecName: Full=D-alanine--D-alanine ligase;       
   75::326     9e-20  30%  330 aa  DDL_TOLAT RecName: Full=D-alanine--D-alanine ligase;       
   93::348     9e-20  28%  350 aa  DDL_SYNSC RecName: Full=D-alanine--D-alanine ligase;       
    1::343     9e-20  29%  360 aa  DDL_LACAC RecName: Full=D-alanine--D-alanine ligase;       
   95::348     1e-19  28%  377 aa  DDL_LEUCK RecName: Full=D-alanine--D-alanine ligase;       
  104::355     1e-19  29%  360 aa  DDL_CORGL RecName: Full=D-alanine--D-alanine ligase;       
   58::345     1e-19  27%  362 aa  DDL_LACDB RecName: Full=D-alanine--D-alanine ligase;       
   58::345     1e-19  27%  362 aa  DDL_LACDA RecName: Full=D-alanine--D-alanine ligase;       
  104::355     1e-19  29%  360 aa  DDL_CORGB RecName: Full=D-alanine--D-alanine ligase;       
   97::351     2e-19  28%  353 aa  DDL_SYNPX RecName: Full=D-alanine--D-alanine ligase;       
    7::345     2e-19  31%  355 aa  DDL_PROM2 RecName: Full=D-alanine--D-alanine ligase;       
  103::357     2e-19  29%  366 aa  DDL_NOSP7 RecName: Full=D-alanine--D-alanine ligase;       
  104::376     2e-19  31%  378 aa  DDL_BIFA0 RecName: Full=D-alanine--D-alanine ligase;       
   89::343     3e-19  27%  360 aa  DDL_LACH4 RecName: Full=D-alanine--D-alanine ligase;       
  456::786     7e-19  31%  809 aa  MUDD_CHLPN RecName: Full=Bifunctional enzyme murC/ddl;Includes:
    7::345     7e-19  31%  355 aa  DDL_PROM5 RecName: Full=D-alanine--D-alanine ligase;       
   92::348     2e-18  29%  353 aa  DDL_PROMM RecName: Full=D-alanine--D-alanine ligase;       
   92::348     2e-18  29%  353 aa  DDL_PROM3 RecName: Full=D-alanine--D-alanine ligase;       
  109::356     2e-18  27%  371 aa  DDL_MYCSS RecName: Full=D-alanine--D-alanine ligase;       
  109::356     2e-18  27%  371 aa  DDL_MYCSK RecName: Full=D-alanine--D-alanine ligase;       
  109::356     2e-18  27%  371 aa  DDL_MYCSJ RecName: Full=D-alanine--D-alanine ligase;       
  122::376     2e-18  27%  384 aa  DDL_MYCLE RecName: Full=D-alanine--D-alanine ligase;       
   94::348     3e-18  26%  350 aa  DDL_SYNS9 RecName: Full=D-alanine--D-alanine ligase;       
   77::319     4e-18  29%  331 aa  DDL_VIBVU RecName: Full=D-alanine--D-alanine ligase;       
    4::317     4e-18  29%  330 aa  DDL_VIBF1 RecName: Full=D-alanine--D-alanine ligase;       
    4::317     5e-18  29%  330 aa  DDL_VIBFM RecName: Full=D-alanine--D-alanine ligase;       
   94::332     6e-18  31%  361 aa  DDL_THEM4 RecName: Full=D-alanine--D-alanine ligase;       
  529::763     8e-18  31%  811 aa  MUDD_CHLCV RecName: Full=Bifunctional enzyme murC/ddl;Includes:
   77::319     1e-17  29%  331 aa  DDL_VIBVY RecName: Full=D-alanine--D-alanine ligase;       
   88::342     2e-17  29%  352 aa  DDL_ACAM1 RecName: Full=D-alanine--D-alanine ligase;       
    6::324     2e-17  25%  330 aa  DDL_PORGI RecName: Full=D-alanine--D-alanine ligase;       
    1::328     4e-17  29%  329 aa  DDL_VIBPA RecName: Full=D-alanine--D-alanine ligase;       
   96::351     5e-17  28%  353 aa  DDL_SYNPW RecName: Full=D-alanine--D-alanine ligase;       
    3::320     1e-16  28%  332 aa  DDL_SHEPW RecName: Full=D-alanine--D-alanine ligase;       
    6::324     2e-16  25%  330 aa  DDL_PORG3 RecName: Full=D-alanine--D-alanine ligase;       
   38::311     4e-16  26%  346 aa  DDL_SULNB RecName: Full=D-alanine--D-alanine ligase;       
   88::302     6e-16  29%  346 aa  DDL_CAMJE RecName: Full=D-alanine--D-alanine ligase;       
   88::302     8e-16  29%  346 aa  DDL_CAMJ8 RecName: Full=D-alanine--D-alanine ligase;       
   79::326     1e-15  27%  336 aa  DDL_SHEAM RecName: Full=D-alanine--D-alanine ligase;       
   88::302     1e-15  29%  346 aa  DDL_CAMJD RecName: Full=D-alanine--D-alanine ligase;       
    6::339     2e-15  30%  361 aa  DDL_LACGA RecName: Full=D-alanine--D-alanine ligase;       
   88::302     2e-15  28%  346 aa  DDL_CAMJR RecName: Full=D-alanine--D-alanine ligase;       
   88::302     2e-15  28%  346 aa  DDL_CAMJJ RecName: Full=D-alanine--D-alanine ligase;       
    6::331     6e-15  27%  337 aa  DDL_SHESW RecName: Full=D-alanine--D-alanine ligase;       
    6::329     6e-15  28%  335 aa  DDL_SHEDO RecName: Full=D-alanine--D-alanine ligase;       
    6::329     8e-15  28%  337 aa  DDL_SHEPC RecName: Full=D-alanine--D-alanine ligase;       
   88::300     8e-15  31%  346 aa  DDL_CAMC1 RecName: Full=D-alanine--D-alanine ligase;       
    6::339     1e-14  29%  361 aa  DDL_LACJO RecName: Full=D-alanine--D-alanine ligase;       
    4::324     1e-14  28%  333 aa  DDL_SHEHH RecName: Full=D-alanine--D-alanine ligase;       
   79::325     3e-14  28%  336 aa  DDL_SHEFN RecName: Full=D-alanine--D-alanine ligase;       
    6::329     4e-14  29%  337 aa  DDL_SHEB9 RecName: Full=D-alanine--D-alanine ligase;       
    6::329     4e-14  29%  337 aa  DDL_SHEB8 RecName: Full=D-alanine--D-alanine ligase;       
    6::329     4e-14  29%  337 aa  DDL_SHEB2 RecName: Full=D-alanine--D-alanine ligase;       
   94::338     4e-14  29%  382 aa  DDL_METS4 RecName: Full=D-alanine--D-alanine ligase;       
   88::302     7e-14  30%  345 aa  DDL_WOLSU RecName: Full=D-alanine--D-alanine ligase;       
   79::330     7e-14  28%  336 aa  DDL_SHESR RecName: Full=D-alanine--D-alanine ligase;       
   79::320     9e-14  25%  335 aa  DDL_SHEWM RecName: Full=D-alanine--D-alanine ligase;       
    6::329     9e-14  28%  336 aa  DDL_SHESA RecName: Full=D-alanine--D-alanine ligase;       
   79::329     2e-13  27%  336 aa  DDL_SHESM RecName: Full=D-alanine--D-alanine ligase;       
   79::329     2e-13  27%  336 aa  DDL_SHEON RecName: Full=D-alanine--D-alanine ligase;       
    6::324     3e-13  28%  333 aa  DDL_SHESH RecName: Full=D-alanine--D-alanine ligase;       
   79::324     3e-13  31%  334 aa  DDL_SHEPA RecName: Full=D-alanine--D-alanine ligase;       
   87::320     3e-13  28%  342 aa  DDL_NITSB RecName: Full=D-alanine--D-alanine ligase;       
   90::302     5e-13  29%  345 aa  DDL_SULDN RecName: Full=D-alanine--D-alanine ligase;       
   71::320     2e-12  25%  334 aa  DDL_SHELP RecName: Full=D-alanine--D-alanine ligase;       
   76::307     7e-12  24%  350 aa  DDL_HELHP RecName: Full=D-alanine--D-alanine ligase;       
   90::306     9e-12  27%  347 aa  DDL_HELPS RecName: Full=D-alanine--D-alanine ligase;       
   90::306     9e-12  28%  347 aa  DDL_HELPJ RecName: Full=D-alanine--D-alanine ligase;       
   90::306     2e-11  27%  347 aa  DDL_HELP2 RecName: Full=D-alanine--D-alanine ligase;       
   78::309     7e-11  27%  350 aa  DDL_HELAH RecName: Full=D-alanine--D-alanine ligase;       
   90::306     1e-10  26%  347 aa  DDL_HELPH RecName: Full=D-alanine--D-alanine ligase;       
   88::302     1e-09  25%  346 aa  DDL_CAMLR RecName: Full=D-alanine--D-alanine ligase;       
  705::868     6e-08  28% 1069 aa  CARB_CLOB8 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  629::854     2e-07  28% 1068 aa  CARB_CLOBL RecName: Full=Carbamoyl-phosphate synthase large chain; 
  705::869     4e-07  27% 1069 aa  CARB_CLOBA RecName: Full=Carbamoyl-phosphate synthase large chain; 
  631::854     5e-07  28% 1068 aa  CARB_CLOBM RecName: Full=Carbamoyl-phosphate synthase large chain; 
  705::863     8e-07  27% 1067 aa  CARB_CLOPS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  705::863     8e-07  27% 1067 aa  CARB_CLOPE RecName: Full=Carbamoyl-phosphate synthase large chain; 
  705::863     8e-07  27% 1067 aa  CARB_CLOP1 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  636::854     1e-06  28% 1068 aa  CARB_CLOBJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  737::890     1e-06  30% 1106 aa  CARB_NATTJ RecName: Full=Carbamoyl-phosphate synthase large chain; 
  705::869     1e-06  27% 1069 aa  CARB_CLOBB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  703::869     2e-06  26% 1067 aa  CARB_HALOH RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::855     7e-06  25% 1072 aa  CARB_THEPX RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::855     9e-06  28% 1072 aa  CARB_THEP3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::867     9e-06  25% 1062 aa  CARB_LACH4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::867     9e-06  25% 1062 aa  CARB_LACDB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  692::853     3e-05  27% 1056 aa  CARB_PYRFU RecName: Full=Carbamoyl-phosphate synthase large chain; 
  784::874     3e-05  30% 1096 aa  CARB_CLAM3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  140::239     3e-05  28%  287 aa  Y012_MYCGE RecName: Full=Uncharacterized protein MG012;
  702::860     3e-05  25% 1071 aa  CARB_BACSU RecName: Full=Carbamoyl-phosphate synthase
  702::855     5e-05  28% 1072 aa  CARB_THETN RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::865     8e-05  26% 1062 aa  CARB_LACJO RecName: Full=Carbamoyl-phosphate synthase large chain; 
  704::856     1e-04  24% 1083 aa  CARB_PELTS RecName: Full=Carbamoyl-phosphate synthase large chain; 
  704::862     1e-04  25% 1065 aa  CARB_CLOAB RecName: Full=Carbamoyl-phosphate synthase large chain; 
  706::867     2e-04  27% 1030 aa  CARY_BACSU RecName: Full=Carbamoyl-phosphate synthase
  744::867     4e-04  26% 1043 aa  CARY_BACST RecName: Full=Carbamoyl-phosphate synthase
  703::867     5e-04  27% 1070 aa  CARB_METAC RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::855     7e-04  28% 1058 aa  CARB_STRP3 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::865     9e-04  23% 1058 aa  CARB_STRU0 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::851     9e-04  27% 1058 aa  CARB_STRE4 RecName: Full=Carbamoyl-phosphate synthase large chain; 
  702::850     9e-04  22% 1058 aa  CARB_FUSNN RecName: Full=Carbamoyl-phosphate synthase large chain; 
    1::304

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
DDL_PELUB       MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
DDL_RHORT       MSKRVTVLMGGFSTERAVSLNSGAAAGEALRQAGYAVTLLDVGRDVAAFITQTRPDVVFNALHGRFGEDG
DDL_ZYMMO       --KHVVVLMGGWSSEREISLLSGRHVGKALEEAGYRVTLLDMDRDIAFKLREAKPDVVFNALHGTPGEDG
DDL_MAGSA       MSKRVTVLMGGASAERDVSLRSGXXXXXXLEQAGFEVALVDCDRNLVRAITETRPDVVFNALHGRFGEDG
DDL_BARHE       ----IAVLMGGFSSERSVSLSSGTACADVLEAQGYRVSRVDVDGHIASVLEQLQPDIAFNALHGPFGEDG
DDL_MARMM       MSKRIAVLMGGLSPERDVSLVTGAACAKGLRDAGYEVVEIDAGRHLSQQLADADPDVVFNALHGEWGEDG
DDLB_RHILO      -SKHVAVLLGGFSSERPVSLSSGKACADALENEGYQVTRVDVGRDVGSVLAELKPDVAFNALHGPFGEDG
DDL_WOLWR       MIPTIAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDSNIAEKLKKINPGLAFIALHGPYGEDG
DDL_WOLPM       MIPTIAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDSNIAEKLKKINPGLAFIALHGPYGEDG
DDL_METRJ       MSKHVAVLLGGTSAEREVSLNSGKACADALEGEGYRVTRVDVGPDIASVLTALRPDAAFNALHGPDGEDG
DDL_METPB       MSKHVAVLMGGWSSEREISLRSGNACAEALEGEGYRVTRVDVGPDIATVLTDLKPDAALNALHGPAGEDG
DDL_PARL1       --KHVAVLKGGWSAEREVSLVSGKGCAEALRKHGYRVTEIDAGRDLADQILKVKPDVAFNALHGRWGEDG
DDL_RHISN       --KHVAVLMGGFSSERPVSLSSGAACADALEAEGYRVSRVDVGRDVAAVLADLRPDIVFNALHGPFGEDG
DDL_WOLPP       MVPNIAILSGGFSCEREISLMSGKAVKKALDSLSYNAIEIDVDSNIAQKLKKTNPALAFIALHGPYGEDG
DDL_RICB8       --KHIALVAGGMSAEREVSLISAEGVGKALIEAGYKVTFIDMGADIAVKLHEIKPDIVFNCLHGTYGEDG
DDL_BEII9       MAKHVAVLMGGLSAEREVSLCSGAACAEALRGEGFEVTEVDVDRQIGERLAALRPDVAFNALHGRFGEDG
DDL_METEP       MSKHVAVLMGGWSSEREISLRSGNACAEALEGEGYRVTRVNVGPDIATVLTELRPDAALNALHGPAGEDG
DDL_METC4       MSKHVAVLMGGWSSEREISLRSGNACAAALEGEGYRVTRVDVGPDIATVLTELRPDAALNALHGPAGEDG
DDL_RICTY       --KHIALVAGGMSAEREVSLISSVGVSKALIELGYKVTFIDMGADIAVKLQEINPDIVFNCLHGTYGEDG
DDL_RICBR       --KHIALVAGGMSAEREVSLISAEGVGKALIEAGYKVTFIDMGADITVKLHEIKPDIVFNCLHGTYGEDG
DDL_GEOSM       --KKIAVLMGGLSAEREVSLNSGKAVLASLVRQGFQAVGIDVGRDLPQRLAEEKAEVAFIALHGRFGEDG
DDL_BART1       --KHIAVLMGGFSSERSISLSSGAACADVLEEQGYRVSRVDVGAHIASVLEQLQPDIAFNALHGPFGEDG
DDL_METSB       MSKHVAVLMGGLSAEREVSLRSGAACAKALEAEGFRVTTLDVDRDIAQKLAALRPDAALNALHGRYGEDG
DDL_SPHWW       ----IAVLMGGWSSEREVSLTSGNGVADALESLGHKVTRIDMDRDVALRLAEAKPDVVFNALHGTPGEDG
DDL_RICFE       --KHIALVAGGMSAEREVSLVSSEGVSKALIELGYKVTFIDMGADIAVKLQEIKPDIVFNCLHGTYGEDG
DDL_WOLTR       ----ITILSGGFSRERKISLMSGKAVKKALDSLSYNAIEIDVNSNTAEKLKKINPDLAFIALHGPYGEDG
DDL_GEOUR       -TKKIGVLMGGLSAEREVSLKSGAAVHQALLARGYXXXXXXXXXXXXQVLVREWVDVAFIALHGRYGEDG
DDL_BARBK       --KHVTVLMGGWSSERSVSLSSGTACADILEAQGYNXXXXXXXXXXXXXLEELRPTTVFNALHGPFGEDG
DDL_SPHAL       ----VAVLMGGWSAEREVSLMSGKGVADALESRGHKVTRIDMDRDVALRLAEAKPDVVFNALHGVPGEDG
DDL_XANP2       MAKHVAVLMGGWSSEREVSLRSXXXXXXXXXXXXYRVTRVDVGRDVAEVLTHLKPDVAFNVLHGQPGEDG
DDL_RICCK       --KHIALVAGGMSAEREVSLVSSKGVSKALIALGYKVTFIDMGADIAFKLQEIKPDIVFNCLHGTYGEDG
DDL_GEOSL       -TTKIGVLMGGLSAEREVSLASGGAVLKALQSRGYDAVPVDVGRDLPQVLVREWIDVAFICLHGRYGEDG
DDL_MESSB       --KHVAVLMGGFSSERPVSLSSGNSCADALEAEGYXXXXXXXXXXXXXXLSELKPDVAFNALHGPFGEDG
DDL_SILST       ---KVAMLMGGPSAEREVSLSTGRECARALRGQGYEVVEVDAGPDLVAQLNDIKPDVAFNALHGRWGEDG
DDL_OLICO       ----VAVLMGGWSSEREVSLRSGAACAAALERKGYRVTRIDVQRDIATVLQNLKPDVALVMLHGKPGEDG
DDL_GRABC       --RRVVVLYGGISEERAVSLISGQQVVAALREAGYEVTPIEVGADLRDTIAALTPDVVFNALHGRFGEDG
DDL_GEOBB       --KKIAVLMGGLSAEREVSLNSGKAVLASLVKQGFRAVGIDVGRDLPQRLAEEQVELAFIALHGRFGEDG
DDL_PELCD       --KKIAVLMGGLSAEREVSLRTGKAISQALTRCGYEVTDIDAGRDLAQQLEKTGVEVAFIALHGRFGEDG
DDL_THELT       ---KIAVLLGGISRERPISLKSGENVLKALKKLGHDVVPIDVDENFLEIAPKLKEEVVFNALHGHFGEDG
DDL_RICRS       --KHIALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDG
DDL_RICRO       --KHIALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDG
DDL_OCHA4       --KHVAVLMGGFSSERPVSLSSGTACAATLEERGYCVTRIDVDRNVASVLAELKPDVAFNALHGPFGEDG
DDL_RHOPB       --KHVAVLLGGWSSEREVSLRSGKACADALERCGYQVTRVDVQRNIGTVLDQLKPDVALVMLHGRPGEDG
DDL_RICPR       --KHIALVAGGMSAEREVSLVSSAGVSKALIELGYKVTFVDMGADIAVKLQEINPDIVFNCLHGTYGEDG
DDL_RICCN       --KHIALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDG
DDL_RICAE       --KHIALMVGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDG
DDL_ERYLH       ----VVVLMGGWANEREVSLMSGEGVAKALEKRGHTVTRIDMDRQVAAKIAEAAPDVVFNALHGVPGEDG
DDL_THEYD       ---KVGVIAGGISSEREVSLRSGQAVFNALKELGYDVVFIDAGIDLCEKIKIEKIDIAFLVLHGGWGENG
DDL_RHOP5       --KHVAVLLGGWSSEREVSLRSGNACADALERRGFEVTRIDVARDIATVLDQLRPDSALMMLHGHPGEDG
DDL_NOVAD       ----VAVLMGGWSSERPVSLMSGEGVAKALESKGHQVTRIDMDRDVALRLAEAKPDVVFNALHGTPGEDG
DDL_AGRT5       --KHVAVLLGGFSSERPVSLSSGNACALALEGEGYKVTRVDVGRDVAAVLDELRPDVAFNALHGPFGEDG
DDL_RICM5       --KYIALMAGGMSAEREVSLVSSEGVSKALIELGYSVTFIDMGADITVRLQEIKPDIVFNCLHGTYGEDG
DDL_HYPNA       -TKRVAVIYGGWSSERPVSLSSGQQMAAAARKAGYDVTEIDVTRELASQLAEAEPDVVLNGLHGPWGEDG
DDL_CARHZ       ---KIGVICGGLSSEREVSLRTGDAIFRALLKKGYNVVKIDMDRNIAETLKKENIDFAFIALHGKYGEDG
DDL_RICAH       ----IALVAGGMSAEREVSLVSSEGVQQALIALGYKVTFIDMGADIAVKLQEIKPDIVFNCLHGTYGEDG
DDL_RHOS5       ---RVAVLMGGTSSEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAEVQPDAVFNALHGRWGEDG
DDL_AQUAE       ---RVVVLMGGRSSEREISLKTGKAVAKALRELGHEVYELDLDKELPCKLLEIKPDKVFIALHGRYGEDG
DDL_ANADF       --KKVAVLYGGRSSEREVSLRTGAACADALRARGHDVTLVDVDAELPARLRELRVDVAFVALHGRWGEDG
DDL_SILPO       ---KVAVLMGGPSAEREVSLVSGRECAAALRGEGFEVVELDAGSDLCDRLRASAPDVVFNALHGRWGEDG
DDL_DINSH       ---KVAMMMGGTSSERAVSLSSGRECGAALRAEGFEVIDLDAGPDLAARLEDLRPDVVFNALHGRWGEDG
DDL_RHOS4       ---RVAVLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAELSPDAVFNALHGRWGEDG
DDL_RHOS1       ---RVAVLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAELSPDAVFNALHGRWGEDG
DDL_RICPU       --KHIALMAGGMSAEREVSLVSSEGVSKALIELGYRVTFIDMGADIAVRLQEIKPDIVFNCLHGTYGEDG
DDL_PELPD       -SRKIAVLMGGLSAEREVSLASGAAVCQALVARGFDALSVDVARDLPLVLSREGIGAAFIALHGRYGEDG
DDL_THEP1       ---RVALLMGGVSREREISLRSGERVKKALEKLGYEYTVFDVKEDFLKEVDQLKSDVVFNVLHGTFGEDG
DDL_RHIME       -SKHVAVLLGGFSSERPVSLSSGTACADALEAEGYRVTRVDVGRDVAAVLQELRPDVVFNALHGPFGEDG
DDL_GEOLS       --KRIGVLMGGLSAERDVSLKSGMAVHQALLAMGYDSTALDVRHNVALILREEKIDLAFIALHGRYGEDG
DDL_THESQ       ---RVALLMGGVSREREISLRSGERVKKALEKLGYEHTVFDVREDFLKKVDQLKSDVVFNVLHGTFGEDG
DDL_THEMA       ---RVALLMGGVSREREISLRSGERVKKALEKLGYEHTVFDVREDFLKKVDQLKSDVVFNVLHGTFGEDG
DDL_FERNB       ------VLLGGISREREISIRSGKRIAQALRNMGHVVDEIDVDDNFIYKLSELKKDALFNILHGTFGEDG
DDL_AZOC5       MAKHVAVLMGGWSPEREVSLRSGAGCAKALEEVGYXXXXXXXXXXXAEVLARLKPDVALNLLHGCPGEDG
DDL_GLUOX       ---KVAVLLGGTSSERPVSLVSGEAAIEALREKGHDVTPIDVGPDIATTIASLKPDVVFNALHGPRGEDG
DDL_BARQU       ---------------------------------GYRVSRVDVDSHIASVLERLQPDVAFNALHGPFGEDG
DDL_SINMW       -SKHVAVLLGGFSSERPVSLSSGTACADALEGEGYRVTRVDVGHDVAAVLQELRPDVVFNALHGPFGEDG
DDLB_BRUME      --KHVAVLMGGFXXXXXXXXXXGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVFNALHGPFGEDG
DDL_JANSC       LPSRVVVLMGGPSAEREVSLSTGRGCAEALRGEGFDVIEVDPGAELCARLQEIQPDVVFNALHGRWGEDG
DDLB_BRUSU      --KHVAVLMGGFXXXXXXXXXXGVACATTLEECGYRVTRIDVDRNVASILVELKPDVVFNALHGPFGEDG
DDL_CAUSK       ----IAVLLGGPSAEREVSLVTXXXXXXXXXXXXXXVSRVDPGKDVAQVLTALAPDLVFNGLHGRWGEDG
DDL_ROSDO       ---KVAVLLGGPSVEREVSLSSGQACAAALRDEGYDVVEIDAGHDLGARLIDAGPDAVLNCLHGRWGEDG
DDL_FRATN       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_ANASK       --KRVAVLYGGRSSEREVSLRTGAACADALRQKGHXXXXXXXXXXXXXXXXXXXXXXXXXXXHGRFGEDG
DDL_ANAD2       --KRVAVLYGGRSSEREVSLRTGAACADALRQKGHXXXXXXXXXXXXXXXXXXXXXXXXXXXHGRFGEDG
DDL_ACICJ       --KRVAVLLGGISEEREVSLASGRQVAAALRKAGYDVFEIEVGADLGAVIAALTPDAVFNALHGRFGEDG
DDL_FRATT       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_FRATO       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_FRATF       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_FRAT1       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_FRATW       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_GLOVI       ---RITVLSGSDSPEREVSLVSGRAVQAALETLGHEVTMVDPGPDLPVRLLENPPDFVWIALHGDKGENG
DDL_FRATH       --EKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVVDASGKELVAKLLELKPDKCFVALHGEDGENG
DDL_SYNJA       ----IVILAGGRSAERQVSLVTGKACKRALEDLGHRAKLIDPEEDLPLRLWQERQDFVWIALHGPGGEDG
DDL_ANADE       --KRVAVLYGGRSSEREVSLRTGAACAEALRQKGHXXXXXXXXXXXXXXXXXXXXXXXXXXXHGRWGEDG
DDL_CAUCR       --RHIAVLLGGPSSERKVSLVSGAACAEALERLGAKVSRIDPGPDVAQVLAATKPDMVFNALHGEWGEDG
DDL_FRAP2       --EKIVVLYGGDSPEREVSLKSGKAVLDSLLNQGYDAVLDASSKDLVVKLLELNPDKCFIALHGEDGENG
DDL_SYNWW       ---KVLVLMGGTSEEREVSLKSGKAVYEGLKDAGYEVEALDFTPETIHRIREYSPDVVFITLHGKNGEDG
DDL_SYNJB       ----IVVLAGGRSAERQVSWVTGKACKRALEDLGHRVKVIDPDEDLPLRLWQERQDFVWIALHGPGGEDG
DDL_DESAP       MVRRIGVLMGGLSAEREVSLRSGRAVCAALESRGYEVVPIDVNRDVARTVRETGIELAFIALHGPLGEDG
DDL_COLP3       --EKIAVLYGGNSAEREVSLNSGQAIAKGLEDAGFNVVLIDTKVVPLTDLVSNKIDRVFIALHGRGGEDG
DDL_PECCP       MTEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGINAHAVD---TRDVSVTTLKEEKIFIALHGRGGEDG
DDL_MAGSM       --KKIGVLYGGLSEEREVSLRSGQALFVALQSLGYQVVAIDVDRHITKVLEREGIEVAVLALHGPMGEDG
DDL_HAEIN       --EKIAVLLGGTSAEREVSLNSGKAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDG
DDL_BUCAP       MKKKIAVLLGGNSSERKISIKSGYAILQSLLRSGFNAYAIDTRDFPIMQLKKQGFDSAYIALHGTGGEDG
DDL_HAEDU       --EKIAVLYGGTSQEREVSLHSGAAVTEALKSLGYNVEGIDTKDIAIEKLKEKGIQRVFNILHGGIGENG
DDL_ALCBS       ---RVAVLAGGRSAERAVSLKSGAAVHAGLRNLGLLAELVDPADKSVDTLRGF--DAAFIALHGRGGEDG
DDL_HAEI8       --EKIAVLLGGTSAEREVSFNSGKAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDG
DDLB_CLOPE      ---KVGIIMGGISSEREVSLASGESIFNHIDKEKYEV---------SKIIINNKIDILEKALHGKFGEDG
DDL_HAEIG       --EKIAVLLGGTSAEREVSFNSGRAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDG
DDL_FUSNN       ---RIAVFMGGTSSEKEISLKSGEAVLESLQKQGYDAYVILDERNQVSAFVDNDYDLAYLVLHGGNGENG
DDL_CLOB8       ---KIGVIMGGISSEREISLQSGKSIIENINKEKYEVLPIVIDKNKSKGI-----DFALLALHGQFGEDG
DDLB_ECOLI      MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDG
DDLB_ECO57      MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDG
DDL_HAEIE       ------MLLGGTSAEREVSFNSGKAVLEALLKQGYNAHPIDPKEYNVANLKKDGFNRAFNILHGRGGEDG
DDL_ACTPJ       --EKIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGIDTKDFPIEKLKEKGIQRVFNILHGGIGENG
DDL_ACTP7       --EKIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGIDTKDFPIEKLKEKGIQRVFNILHGGIGENG
DDL_ACTP2       --EKIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGIDTKDFPIEKLKEKGIQRVFNILHGGIGENG
DDLB_SHIFL      MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDG
DDL_CLOBA       ---KVGVIMGGISSEREISLKSGKSIVDSINKNKYEVIVIDEKEDIINKVKGI--DFALLALHGQFGEDG
DDL_ACTSZ       --QKIAVLLGGTASEREVSLNSGAAVLDALRSQGYDAHPVDPKDMPVADLKQQGFERVFNILHGRGGEDG
DDL_PASMU       --EKIAVLLGGTSAEREVSLDSGQAVLNALLSAGFDAHPIDPKTFPVATLKEQGFDRVFNILHGRGGEDG
DDL_SACD2       ---RTLVLFGGTSSEREVSLRSXXXXXXXXXXXXXDAHGLDVQADAIAKIEAFAPDRVFIALHGPGGEDG
DDL_PELTS       MTLKVGVLMGGRSSEREVSLKTGEAVYNALKVKNYLAVKIDVGLDVVERIKEERIDLAFIALHGRYGEDG
DDL_MANSM       --QKIAVLLGGTSAEREVSLTSGDAVLTALRNQGYDAHPIDPKEYPVAQLKEQGFERAFNILHGRGGEDG
DDL_BACAN       ---RIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDG
DDL_BACAC       ---RIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDG
DDL_BACAA       ---RIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDG
DDLA_CLOTE      ---QIGVVMGGVSTEKEISNLTGKYIIENLDKSKYEIL-PIPINTKFELIDKIKCEFAFIALHGNFGEDG
DDL_PSEHT       ---KVAVLLGGNSAEREVSLRSGQAVLNALQNHGINAIAFDPKERPLWELNELAIDRVFIALHGRGGEDG
DDL_DESRM       MALRIGVLCGGRSAEREVSLRSGEAVYQALMAAGYNDVVKDVGYDLVEQLKGNEIQVAFLALHGKYGEDG
DDL_CLOBL       ---KIGIIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGEFGEDG
DDL_CLOBB       ---KVGVIMGGISSEREISLKSGKSIVDSINKNKYEVIVIDEKEDIINKVKGI--DFALLALHGQFGEDG
DDL_BACHD       ---KIAVLYGGTSAEREVSLSSGKGIMEALKANGHEVIGIDFHPDQVRXXXXXXXXXXFIGLHGRLGEDG
DDL_METPP       ---KVAVLMGGTSAERDISLMSGGGVLKALQDAGVDAHAFDPKDHELVELRRQGFQRCFIALHGRHGEDG
DDLB_SALTY      MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGINAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDG
DDLB_PSESM      ---RVAVLFGGKSAEREVSLNSGNAVLKALLDAGVDAFGIDVGDDFLQRLVSEKIDRAFIVLHGRGGEDG
DDL_SYNFM       ----VALLSGGASAEREVSLKSGEQVFNALDKQRYLVLRYDPAHDLTRLAADAKIDVALIILHGRMGEDG
DDL_SALPK       MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDG
DDL_SALPA       MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDG
DDL_METFK       ---KVAVLLGGKSGEREVSLKSGAAVLAALRRNGVDAHAFDPAERALSELAGF--DRVFIALHGRYGEDG
DDL_CLOBK       ---KIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDG
DDL_CLOBJ       ---KIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDG
DDL_CLOBH       ---KIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDG
DDL_CLOB1       ---KIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDG
DDLB_SALTI      MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFIALHGRGGEDG
DDLB_PSEAE      ---RVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDAFGIDVGEDLLQRLVEEKIDRAFIILHGRGGEDG
DDL_METI4       LPRHIAVLKGGPSEEREISLRTAKAVEDALSSLGYE--ISSIDVTTEKFEIPRDAEICFLCIHGSFGEDG
DDL_CLOBM       ---KIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXDKKEDVMEKAKGIDFAFLALHGKFGEDG
DDL_PHOLL       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLREAG---IDAHPVDTKDFPVTQLKEEKVFIALHGRGGEDG
DDL_MOOTA       ---KIAVLMGGPSSEREIXXXXXXXXXXXXXXXXHQVITIDLNREVVARLKNFAPDVVFNALHGKPGEDG
DDL_JANMA       ---KVGVLFGGRSAEREVSLMSGKGVLAALLSKGIDAHPFDPAERSLAELAAEKFDRVFIALHGRFGEDG
DDL_CLOK5       ---KVGIIMGGISSEREVSLNSGKSIINYMDKNKYEIVPIVIDKKNDVFEKVKDIDFAFIALHGKFGEDG
DDL_CLOK1       ---KVGIIMGGISSEREVSLNSGKSIINYMDKNKYEIVPIVIDKKNDVFEKVKDIDFAFIALHGKFGEDG
DDL_ACIBY       ---KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQNRSVTELVNY--DRAFIVLHGRGGEDG
DDL_ACIBT       ---KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNY--DRAFIVLHGRGGEDG
DDL_ACIBC       ---KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNY--DRAFIVLHGRGGEDG
DDL_ACIB5       ---KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQNRSVTELVNY--DRAFIVLHGRGGEDG
DDL_ACIB3       ---KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQNRSVTELVNY--DRAFIVLHGRGGEDG
DDL_NITEU       ---KVAVLLGGRSAEREISLRSGQAVLAALQRSRVNAHAFDPAGQPLENLLQQGFDRVFIALHGRYGEDG
DDL_MARMS       ----IAVIYGGRSAEREVSLQSGPLVAEGLRAKGYQVVESNAALDPIVQLQSIEFDLAFIALHGGEGEDG
DDL_HAES1       --QKIAVLLGGTSAEREVSLNSGNAVLTALRNQGFDAHPIDPKEYPVAMLKEQGFDRVFNILHGRGGEDG
DDL_XANAC       ---RVAVLLGGTSSEREVSLNSGGNVLDALRARGVDAQPVDGIPALAKALVAQQFDRVFNVLHGHNGEDG
DDL_HAES2       --QKIAVLLGGTSAEREVSLNSGNAVLTALRNQGFDAHPIDPKEYPVAMLKEQGFDRVFNILHGRGGEDG
DDLB_ECOL6      MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDG
DDLA_CLOPE      ---KVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIVLNEKEDLIEKVKGI--DFALLALHGKFGEDG
DDL_ACIBS       ---KVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNY--DRAFIVLHGRGGEDG
DDL_NITEC       ---KVAVLLGGRSAEREISLKSGHAVLAALQRSQVDAHAFDPVGQPLEDLLKQGFDRAFIALHGRYGEDG
DDL_PSEPF       ---RVAVLFGGLSAEREVSLKSGNAVLTALQSAGVDAFGIDVGADILQRLLSEKIDRAFIILHGRGGEDG
DDL_CLOPS       ---KVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIVLNEKEDLIEKVKGI--DFALLALHGKFGEDG
DDLA_BACCR      -----MLLWAGYASEKQVSIMTGNEMIAHLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDG
DDLB_XANCP      ---RVAVLLGGTSSEREVSLNSGSNVLDALRARGVDAQPVDGIPALAQALVAQRFDRVFNVLHGHNGEDG
DDL_IDILO       ---KVAVMLGGTSAERDVSLKSGMAVLKGLVAKGIDAHAFDPAAHSLQELVEQKFDRVFIALHGRGGEDG
DDL_POLSJ       ---KVAVLMGGMSAEREISLMSGRGVLQALRSRGVDAHAFDPAE---RDISELKKDEFFIALHGRFGEDG
DDL_HERAR       ---KVGVLFGGRSAEREVSLMSGKGVLAALQSKGVDAHAFDPAERSLAELAAEKFDRVFIALHGSYGEDG
DDL_DECAR       ---KVAVLFGGTSAEREVSLNSGSRVLAALQGQGIDAHAFDPAEQPLDALKGY--DRAFIALHGRHGEDG
DDL_ANAMM       ----VAVLCGGSSPEREVSLAGGKRVADALGRLGYNATVLDLNRESVGQLLAMAPDLVYNALHGVQGEDG
DDL_ANAMF       ----VAVLCGGSSPEREVSLAGGKRVADALGRLGYNATVLDLNRESVGQLLAMAPDLVYNALHGVQGEDG
DDL_ACIAD       ---KVAVLFGGKSAERDVSLDSGQAVLDALLRSGVQAEAFDPKERSVTELVGY--DRAFIVLHGRGGEDG
DDL_CHRSD       ------------------------------------------------------PDRVFIAMHGRDGEDG
DDL_THICR       ---KVAVLMGGVAAERDVSLRSGAEVLKALKSEGVDAVGCDVTSVAQLVEIAQKYDRAFIALHGRWGEDG
DDL_MARAV       ---RVAVFMGGDSAEREVSLKSGKAVLAALQSAGIDAVGRDIQGCLLRTVDEPDFDRVFIALHGRGGEDG
DDL_PSEMY       ---RVAVLFGGKSAEREVSLKSGNAVLSALQAAGVDAFGIDVGDDFLQRLASEKIDRAFIVLHGRGGEDG
DDL_POLNS       ---RVGVLLGGKSGEREISLMSGNGVLEALRSKGVDAHAFDAGLRCPTELVKEKFDRIFISLHGRFGEDG
DDL_NEIMB       ---KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHGTYGEDG
DDL_HAMD5       MPEKVAVLLGGTSSERQISLQSGHAVVAGLREAGIDARPIDTKNFLVTELKEKGFTKAFIALHGRDGEDG
DDL_ERWCT       MTEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGINAHAVD---TRDFPVTTLKEEGVFIALHGRGGEDG
DDL_CLOB6       ---KIGVIMGGISTEREVSLNSGREVIKYXXXXXXXXXXXXXXXXXXXXXXXXXXXFAFLALHGEFGEDG
DDLB_CHRVO      ---KVAVLMGGSSSEREVSLMSGAGVLSALRSKGVDAHGFDPSEKPLSALKEEGFDCVFNILHGPFGEDG
DDL_NEIG2       ---KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKERGFQTAFNILHGTYGEDG
DDL_NEIG1       ---KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKERGFQTAFNILHGTYGEDG
DDL_YERPY       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPS       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPP       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPN       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPG       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPE       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPB       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERPA       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_YERP3       MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDG
DDL_NEIMA       ---KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHGTYGEDG
DDL_BORA1       ---KVGVLYGGRSAEREVSLMSGAGVHEALRSAGVDAHLFDTGLQDLTALEAAGFERVFIALHGRFGEDG
DDL_RALEJ       ---KVGVLYGGRSAEREISLMSGSGVLAALQSRGVDAHGFDPATQSVAELAAAGFDRVFIALHGRYGEDG
DDL_LEPIN       ---KIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVVSNSPDLSRTNQIFSLDADIVFLGLHGGQGEDG
DDL_CLOTH       ----------------------------------------------SENEKSKKIDVVFPVLHGCNGEDG
DDL_NEIMF       ---KVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHGTYGEDG
DDL_PSEE4       ---RVAVLYGGKSAEREVSLKSGAAVIEALTSXXXXXXXXXXXXXLLARLQNEKIDRAFIILHGRGGEDG
DDL_POLNA       ---KVAVLMGGRSAEREISLMSGSGVVQALRSQGIDAHAFDPAERDLGELKTGGFARCFIALHGRFGEDG
DDL_LARHH       ---KVAVMMGGNSCEREISLMSGQGVLNALRGQGVDAHAFDPAEKPLAALQSEGFDRVFIALHGAFGEDG
DDL_ERWT9       MAEKVAVLLGGTSAERDVSLLSGAAVLKGLKEAGIDAHAIDIRDFPAMRLKEEGFDKAFIALHGRGGEDG
DDL_LEPIC       ---KIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVVSNSPDLSRTNQIFSLDADIAFLGLHGGQGEDG
DDL_PEDPA       ---KIAVLAGGKSTERNVSLSSGSKITNALRSKGYDVLTEEDIEELGKNVLPIAADFVFLALHGGDGENG
DDL_PSEU5       ---RVAVLFGGKSAEREVSLKSXXXXXXXXXXXXXXXFGIDAGDDLLQRLSSERIDRAFIVLHGRGGEDG
DDL_NITOC       ---KVVVLMGGYSAEREISLKSGTAVLQSLLRQGIEAHGIDVDKGVLTQLSKGQFTRAFIALHGRGGEDG
DDL_NITMU       ---KVAVLLGGRSAEREISLESGKAVLDALRSSGVDAHPFDPSEQHMDALLQQGYTRAHIALHGRYGEDG
DDL_HAEPS       --EKIAVLFGGVSAEREISLNSGKSVFEALQSLGYNVEAIDTKEFPIEKLKEKGIQRVFNILHGGIGENG
DDL_CUPTR       ---KVGVLLGGRSAEREISLMSGNGVLAALQSRGVDAHGFDPGLQGVAELAAAGFDRVFIALHGRYGEDG
DDLB_PSEPK      ---RVAVLYGGKSAEREVSLKSGAAVIDALSTXXXXXXXXXXXXXLLARLQSEKIDRAFIILHGRGGEDG
DDL_PSEPG       ---RVAVLYGGKSAEREVSLKSGAAVIDALTTXXXXXXXXXXXXXLLARLQSEEIDRAFIILHGRGGEDG
DDL_COPPD       ----IVVLFGGTSPEREISLKSGENIAATLRARGHQVTLDTAVPNFVEQLMQLKPDCVFPALHGADGEDG
DDL_ALHEH       ---RVAVLMGGDSAEREISLISGRAVFEALRRRGVDAEAVDTAQVALAELTGF--DRAFIALHGRGGEDG
DDL_BURXL       ---KVAVLLGGNSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAERPLAALKEEGFFNALHGGYGENG
DDL_RHOFD       ---KVAVLMGGASAEREVSLMSGQGVLQALISQGVDAHAFDPERDLAEKVEGFSH--CFIALHGRFGEDG
DDL_SOLUE       MKLRVAVIYGGRTGEHEVSVRSAKSILAGLDCEKYETIEYFIDQNGKWSPGPILPDVVFPVLHGTFGEDG
DDL_NATTJ       -------------------------------------ILPDPSKKVLWKLDPFEKDLIFPVLHGTFGEDG
DDLA_PSEAE      ---KVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDPDSDSLAIIRSGKQDVFFLALHGGTGEDG
DDL_DESDG       ---RILLIAGGWSEERDVSLSGARGIHAALERLGHQVTLFDPCRTLAGLLEAAQADFAFLNLHGQPGEDG
DDL_CLOCE       -------------------------------------------------------DVIFPVLHGCNGEDG
DDL_AZOSE       ---KVAVLLGGTSAEREVSLMSXXXXXXXXXXXXXXXXXFDPAQQDLHILKEQGFDRAFIALHGRGGEDG
DDL_LEPBL       ---KIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKISIPYEAVNSSISNLDADIVFLGLHGGKGEDG
DDL_LEPBJ       ---KIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKISIPYEAVNSSISNLDADIVFLGLHGGKGEDG
DDL_DESMR       ---KILLVAGGWSSERAVSLSGAVQIEKALTSLGHEVVPYDLSHDFPGFVRRAKADFVFLSLHGAPGEDG
DDL_HALHL       ---RVAVLMGGTSAERDISLRSGGAILAALQRCGYDAEAYDPRDRALEGLRGY--DVVFIALHGRGGEDG
DDL_HALOH       --EKYKVIPFGITKK---GQWVGPEESWNILNNGINEVKASKDRCITESVRVFKLDIVFPVLHGPYGEDG
DDL_BORPD       ---KVGVLYGGRSAERDVSLMSGKGVHQALLSAGVDAHLFDTGERTLAELAAAGFDRVFIALHGRYGEDG
DDL_THIDA       ---KVAVMLGGTSAERPVSLNSGNAVLAALTRQGIDAHAFDPATRSLGDLMSGEFDRVFIALHGRYGEDG
DDL_RALEH       ------------SAEREISLMSGNGVLAALQSRGVDAHGFDPGLQSVAELAAAGFDRVFIALHGRYGEDG
DDL_PSEA6       ---KVAVMFGGRSAEREVSLRSGQAVLSALISAGVNAHGFDPAESELHQLVEQKFDRVLIMLHGRGGEDG
DDL_LACSS       ---KIVVLAGGRSTERNVSLTSGHKITHALQTKGHDVAFVDKDGATIDSLYSSDPDIVFLALHGGDGENG
DDL_PSYWF       ---KVAVVFGGNSNERAVSLDSGNAVLQALQSQGIDATHFDPK---DQDVTELKNDRVFNVLHGRXXXXX
DDL_CHLL2       ----------GDSAAEILSLDLSSIMRKSSVGNTETLLRNSAEKPFDFNFRAAGIDVVFIALHGSYGEDG
DDL_XYLFT       MFGRVAVLLGGTSAEREVSLLSGRNVLEVLRMRGVDAQSVDGVPALAQALVERRFDRVFNVLHGHNGEDG
DDL_XYLFA       MFGRVAVLLGGTSAEREVSLLSGRNVLEVLRVRGVDAQSVDGVPALAQALVERRFDRVFNVLHGHNGEDG
DDL_VESOH       ----IAILMGGNSAERAISLKSGEAIYQTLNNQNIDCFTFDWYGDNLSEFWQQEFDQVFIILHGRGGEDG
DDL_RUTMC       ----IAVLMGGNSAERAVSLKSGEAVYQALINQNINCFEFDWHGYNLSELWQQEFDQAFIVLHGRGGEDG
DDL_RALME       --------------EREISLLSGNGVLAALKSRGVDAHPFDPGLQPISELAAAGFDRVFIALHGRYGEDG
DDL_BURVG       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAGIDAHLFDPAE---RPLSALKDEGFFNALHGGYGENG
DDL_POLSQ       -----------------ISLMSGNGVLQALLSKGVDAHGFDPGLRNPTELATEKFDRIFISLHGRFGEDG
DDL_DIAST       ---KVAVLMGGTSAEREVSLMSGGGVLQALRSRGVDAHAFDPAHSDLSELKAHGYSRCFIALHGRHGEDG
DDL_ACISJ       ---KVAVLMGGTSAEREVSLMSGGGVLQALRSRGVDAHAFDPAHSDLSELKAHGYSRCFIALHGRHGEDG
DDL_DESVH       ---KVLLIAGGWSSERDVSLAGARGIEKALCALGHDVTWFDPATSLDGLLEAASSDFAFINLHGSPGEDG
DDL_BURCJ       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVD---AHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_BORPE       ---KVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFERVFIALHGRYGEDG
DDL_BORBR       ---KVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFERVFIALHGRYGEDG
DDL_DESVV       ---KVLLIAGGWSSERDVSLAGARGIEKALRALGHDVTWFDPATSLDGLLEAASSDFAFINLHGSPGEDG
DDL_BURM1       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVD---AHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_BURCM       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAG---IDAHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_DESAD       ----VLLIAGGWSEEREVSLSGAKGIEQALLELGHDVEFVDPAKDF-KNILLLAEDFAFINLHGSPGEDG
DDL_BORPA       ---KVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFERVFIALHGRYGEDG
DDL_BURPP       ---KVAVLLGGNSAEREVSLNSGRLVLQGLRDAGVD---AHPFDPAERPLAALKEEGFFNALHGGYGENG
DDL_BURCC       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVD---AHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_THEPX       --KKIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITKKGERGIITFEDDVVFPVLHGPNGEDG
DDL_THEP3       --KKIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITKKGERGIITFEDDVVFPVLHGPNGEDG
DDL_BURTA       ---KVAVLLGGESAERDVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURA4       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAG---IDAHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_BURCH       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVD---AHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_BURCA       ---KVAVLFGGESAEREVSLTSGRLVLQGLRDAGVD---AHPFDPAERPLSALKDEGFFNALHGGYGENG
DDL_CALS8       MTKKVAVLFGGVSTEHEVSIVSAKSVMQNLDKEKYEIIFISPDRTKKALVTFIDIDVVFPVLHGLNGEDG
DDL_DELAS       ---KVAVLLGGRSAEREVSLMSGTGVLKALLSHGVDAHAFDPAERDLGELKKEGFDRCFIALHGRYGEDG
DDL_BURPS       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURP6       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURP1       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURP0       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURMS       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURMA       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURM9       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_BURM7       ---KVAVLLGGDSAEREVSLNSGRLVLQGLRDAG---IDAHPFDPAQRPLAALKDEGFFNALHGGYGENG
DDL_METCA       ---KVAVLMGGSAAEREISLKSGKAVLEALRSGGIDAEGIDVGRDLIAPLLERRFDRVFNVIHGRGGEDG
DDL_CLOAB       MKKKVAILFGGQSTEHEVSRVSAASVLRNIDTSKYKIENGEWEKNGQAILFNKEVDVVFPVMHGLYGEDG
DDL_BDEBA       MKKIVALIFGGKSAEHEVSLRSAKNVADALDKDKFTVLIGIPDMGVFTEATKIKPDVAFPILHGTMGEDG
DDL_ANATD       MTKKVAVLFGGVSTEHEISIVSAKSIMQNMDKEKYEVIFVSPDRTKKALVTFIDIDVVFPVLHGLNGEDG
DDL_BUCBP       ITEKIAVLLGGTSQERNISLISGYNILNSLLKSGHAVAIDTKDFPITQ-LPHQKFTKAFIALHGRDGEDG
DDL_LACPL       ITKNGIVLSDAATRRVFDGEPEDQVVAEEMPK----LDMSDPLAPI-KNLTLAKDDIFYPVVHGNLGEDG
DDL_DESPS       ---RIALIAGGTSGEREVSLTGADGVERILDKEKYLVSRYDSATDLPRXXXXXXXXXXXXXLHGLHGEDG
DDL_STRTD       MSKQTLILLGGRSAEREVSVLSAESVMRAVDYNAFEVFIETPDEKLMTNDTAIKPSVVFPVLHGPMGEDG
DDL_STRT2       MSKQTLILLGGRSAEREVSVLSAESVMRAVDYNAFEVFIETPDEKLMTNDTAIKPSVVFPVLHGPMGEDG
DDL_STRT1       MSKQTLILLGGRSAEREVSVLSAESVMRAVDYNAFEVFIETPDEKLMTNDTAIKPSVVFPVLHGPMGEDG
DDL_STRMU       MSKETLVLLGGRSAERDVSVLSAESVMRAINYDNFLVKTSETDKLMTNDTIKIKPSVVFPVLHGPMGEDG
DDL_BURP8       ---KVAVLLGGASAEREVSLNSGRLVLQGLRDAGVDAYAFDPAE---RPLAALKDEGFFNALHGGYGENG
DDL_OCEIH       MKKKVGIVFGGKSAEHEVSLQSAKNIVDAIDSDKYDVLINEEDPKLEKNVTSNSTDVIFPIVHGTLGEDG
DDL_CHLPD       -------------------------------------------------------DLAFIALHGSYGEDG
DDL_AZOSB       ---KVAVLFGGSSAERDVSLMSXXXXXXXXXXXXXXXHAFDPAERDLHILKEEGYDRVFIALHGRGGEDG
DDL_ACIAC       ---KVAVLMGGDSAEREVSLMSGGGVLQALRARGVDAHAFDPSQSDLSELKSHGYARCFIALHGRHGEDG
DDL_LACCB       ---KIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDDDANTSKDINKLRPDIVFLALHGGDGENG
DDL_LACC3       ---KIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDDDANTSKDINKLRPDIVFLALHGGDGENG
DDLB_CLOTE      ---------------------------KNKLENGYNVLFNK------------EVELVFPVLHGLYGEDG
DDLB_BACCR      -------------------------------------------------------DVIFPLLHGPNGEDG
DDL_PETMO       ----IPIITGGKSKEREISLTSAKNVFNSISNLGYKVILDLIDDDFINKIQNYK--FAFNVVHGDYGEDG
DDL_LEPBP       ----------------------------------------------------------FLGLHGGAGEDG
DDL_LEPBA       ----------------------------------------------------------FLGLHGGAGEDG
DDL_LAWIP       ----ILLLAGGWSSEREVSLQSAELITSAMIEYGHTVTCLDPLYDFDKIVVAEKQDVAFILLHGSPGEDG
DDL_DICNV       ---KVAVLYGGNSSEREISLIGGRAVHAALCAAGIDALLDTGDPNRIWTLKDEHFSRAFVMLHGRGGEDG
DDL_STRU0       --------------------------------------------------------VVFPLLHGPMGEDG
DDL_STRPZ       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPM       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPG       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPD       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPC       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPB       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRP8       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRP6       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRP3       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRP1       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPF       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRPN       MKQTIILLYGGRSAEREVSVLSAESVMRAVDYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_STRZJ       MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVFISQSGDSIKTQEFSHAPGVVFPVLHGPMGEDG
DDL_STRR6       MKQTIILLYGGRSAEREVSVLSAESVMRAVDYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_STRPJ       MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVFISQSGDSIKTQEFSHAPGVVFPVLHGPMGEDG
DDL_STRP2       MKQTIILLYGGRSAEREVSVLSAESVMRAVDYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_STREM       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_FLAPJ       ----VAVVMGGYSDESVISLRSGQLILNNLDKSKYNIFINKADFSFTKNGVITKFDVAINTVHGTPGEDG
DDL_STRE4       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_WIGBR       MKKTVAVLFGGESKEHEISLQSSISIINAIDKKKYNIILIGVEKNGKKNKKMLKIDVIFSILHGSNGENG
DDL_STRZP       MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_STRP4       MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_CHLPB       -------------------------------------------------------EVAFPVLHGAYGEDG
DDL_DESDA       ---KILLIAGGWSPERQVSLNGARAMVPALEARGHEVTFFDLLENFNGLLAAAEQDFALINLHGAPGEDG
DDL_BACSK       --KRVGIIFGGKSAEHEVSLQSAKNIVEAIDKDRFDVTLIGIDKNKSNQGVALIPDVVFPIVHGTLGEDG
DDL_STRPI       MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVFISQSDKKVAPSAIYEERAVVFPVLHGPMGEDG
DDL_CHLT3       --KKVALLFGGRSSEHEISVISARSIANALDKTKYKIAIKSPTKKIEKEIVTAKIDVAFPVLHGPYGEDG
DDL_STRPS       MKQTIILLYGGRSAEREVSVLSAESVMRAVDYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_STRS7       --------------------------------------------------------VVFPVLHGPMGEDG
DDL_STRA5       --------------------------------------------------------IVFPVLHGPMGEDG
DDL_STRA3       --------------------------------------------------------IVFPVLHGPMGEDG
DDL_STRA1       --------------------------------------------------------IVFPVLHGPMGEDG
DDL_RALPJ       ---KVGVLMGGRSAEREISLMSGNGVLAALRARGVDAHAFDPGLQAVADLAKQGFDRVVISLHGRFGEDG
DDL_TREDE       ----------GISKNGAWYLH-GDEERERIIKNEKAVLKIKKDE--AKRVTEFLPDAVFAVLHGRFGEDG
DDL_STRZT       MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVFISQSDKKVAPSAIYEEGAVVFPVLHGPMGEDG
DDL_STRGG       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_RALSO       ---KVGVILGGRSAEREISLLSGNGVLAALRSRGVDAHPFDPGTQPVAGLAAQGFHRVVISLHGRFGEDG
DDL_CLONN       MKKKVAILFGGQSTEHEVSRVSASSVLKNIDLSKYDVYITKDGKNGQEILFNREVDVVFPVMHGLYGEDG
DDL_STRSV       --QRLILLYGGRSAEREVSVLSAESVMRAITKDGDFIQTQEADEKLMTNATKIKPSVVFPVLHGPMGEDG
DDL_PROVI       -------------------------------------------------------DIAFPILHGSYGEDG
DDL_STRGC       --KSLILLYGGRSAEREVSVLSAESVMRAINYDLFSVFSSKPDVRLMTNDTKIKPSVVFPVLHGPMGEDG
DDL_LEGPL       ----LVLLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSLINGRLAVDAEIVFPVVHGPLYEDG
DDL_LACBA       -------------------------------------------------------DVFFPIIHGNLGEDG
DDL_THET2       -------------------------------------------------------DVVFPLLHGRFGEDG
DDL_CHLP8       ---------GGACAKRILALDVAV-----LLRNGGQDEVFERDEGKRFDLTAFSIDVAFLTLHGSYGEDG
DDL_LEGPC       ----LVLLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSLINGRLAVDAEIVFPVVHGPLYEDG
DDL_LEGPA       ----LVLLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSLINGRLAVDAEIVFPVVHGPLYEDG
DDL_CHLCH       ----------------------------------------------NRNLAALGVDVAFLALHGSFGEDG
DDL_STRCO       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_STRAW       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_PROA2       -----------------------------------EISFSDPRNRFLFDFSEEGIDVALPIIHGSTGEDG
DDL_LEGPH       ----LVLLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSLINGRLAVDAKIVFPVVHGPLYEDG
DDLA_PSESM      MKKSVAIVFGGQSSEHEVSLQSARNVINAIDRESYALTLDEADYLLNANVESGKPDVVFPLIHGAFGEDG
DDL_STAS1       --ENVCIVYGGKSAEHDVSILTAQNVLNAIDKEQYQIDIGEISKLLSQGSTGNAYSAVFPLLHGPNGEDG
DDL_STAES       MTKEICIVFGGKSAEHDVSILTAQNVLNAIDKERYQVITNDGEWKKKDNITQXXYDAVFPLLHGPNGEDG
DDL_STAEQ       MTKEICIVFGGKSAEHDVSILTAQNVLNAIDKERYQVITNDGEWKKKDNITQXXYDAVFPLLHGPNGEDG
DDL_STAAW       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAT       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAS       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAN       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAM       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAE       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAC       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAAB       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAA9       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAA8       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAA3       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAA2       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_STAA1       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_MACCJ       -------------------------------------------------------DAVFPLLHGPNGEDG
DDL_PELPB       -------------------------------------------------------EVAFLTLHGTYGEDG
DDL_BACCN       -------------------------------------------------------DVIFPLLHGPNGEDG
DDL_STAAR       MTKEICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVITNDGDWRKQNNITSGQPDAVFPLLHGPNGEDG
DDL_FINM2       MQKNIYVLYGGPSTEHEVSITSARTLINNLSKEKYNVLILDTDESVSECIRKINPEVIFPAIHGSYGEDG
DDLA_CHRVO      -------------------------------------------------------DVAFPIVHGTLGEDG
DDL_ENTHR       --------------------------------------------------------IVFPVLHGPNGEDG
DDL_GEOKA       -------------------------------------------------------DVIFPLLHGPNGEDG
DDL_DEIGD       MKKRILLLAGGQSEEHEVSLRSARSVLAALPRDQFDVVVISPDLVLHRAASAEGYDAVFPLLHGPMGEDG
DDL_STACT       --ENICIIYGGKSAEHDVSILTAQNVLNAINKDDYQVDIEEVEENLLTNSSSGQPAAVFPLLHGPNGEDG
DDL_CORA7       --------------------------------------------NVTRHEHYTEVDVIVPVLHGPYGEDG
DDL_LACRD       ------ILLGNEDSQKIFDGEPEDQVVAEAYQ---KMDMSSPLAPIMALNEQKEIDFFFPVIHGNLGEDG
DDL_LACF3       -------------------------------------------------------DFFYPVIHGNLGEDG
DDL_FLAJ1       --KNIAIIMGGYSSEYKISLISGNVVYQYLDKNGFRIHIFKEDFSVTVNGEKITFDCVFNAIHGTPGEDG
DDL_VEREI       ----------------------------------------------------------FIALHGRHGEDG
DDL_GEOTN       -------------------------------------------------------DVIFPLLHGPNGEDG
DDL_LACLS       -----------------------------------------------------KDAVVFPVLHGPMGEDG
DDL_LACLM       -----------------------------------------------------KDAVVFPVLHGPMGEDG
DDL_AZOPC       --KNVAIVSGGYSSECVISLKSAEEVYLSIDKNPYIVLITKTEFPINKNDFSFRFDFAYIIIHGTPGEDG
DDLA_SALTY      -------------------------------------------------------DVIFPIVHGTLGEDG
DDLA_SALTI      -------------------------------------------------------DVIFPIVHGTLGEDG
DDL_STAHJ       ---------------------------------------------LLKESSNGKPDAIFPLLHGPNGEDG
DDL_HERA2       -------------------------------------------------------DVIIPVLHGPFGEDG
DDL_CHLTE       -------------------------------------------------------DVAFIALHGSYGEDG
DDL_BORAP       MKKNLMLIFGGVSFEHEISCKSAYSVYLALLDNKYNIYVSDPPKPIDTDIVSLLPDVVFPVVHGRTGEDG
DDL_BAUCH       ---RVGIIFGGQSAEHEVSLQSAKNIVETIDENKFEVVLFGIDKNKSNKHIAIIPDVIFPIVHGTLGEDG
DDLA_BRAJA      -------------------------------------------------------DVVFPVIHGPLCEDG
DDL_BLOPB       -----------------------------------------PFKFHTKNINILKFDVIFPVVHGTLGEDG
DDLA_SHIFL      -------------------------------------------------------DVIFPIVHGTLGEDG
DDLA_ECOLI      -------------------------------------------------------DVIFPIVHGTLGEDG
DDLA_ECOL6      -------------------------------------------------------DVIFPIVHGTLGEDG
DDLA_ECO57      -------------------------------------------------------DVIFPIVHGTLGEDG
DDL_BORBZ       MKKNLMLIFGGVSFEHEISCKSAYSIYLALLDNKYNIYVSDPPKPINTDIVSLLPDVVFPVVHGRTGEDG
DDL_THET8       ---RVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRXXPEGEHPFPPDVVFPLLHGRFGEDG
DDL_LACLA       -----------------------------------------------------KAAVVFPVLHGPMGEDG
DDL_PELLD       -------------------------------------------------------DVAFPVLHGSYGEDG
DDL_GRAFK       MKKKIAIAMGGYSSEYRISINSGNIVYKHLILKGEWFVVADDDTPYPINKSNFTVDCVFNTIHGTPGENG
DDL_THEAB       ---------------------------------------------LHSNIKKITIDVCLLTFHGSNGEDG
DDL_DEIRA       MKRRILLLAGGQSGEHEVSLRSARSVLAALPRDQFDVVISETQKALETGVSSQGGDLVFPLLHGPMGEDG
DDL_ARTAT       ---------------------SGRTVTLAEVGGEHQLIVTEPNA-VPQELGSV--DVVFPLLHGPWGEDG
DDL_BACLD       -------------------------------------------------------DVVFPLLHGPNGEDG
DDL_BORT9       MKKNLMLIFGGVSFEHEISLRSACGIYSALMKDKYNVFSSFIDKGIFVNNKDLKIDVVFPIVHGRTGEDG
DDL_BACSU       -------------------------------------------------------DVVFPLLHGPNGEDG
DDL_TREPS       -------------------------------------------------------DVVFPVLHGSYGEDG
DDL_TREPA       -------------------------------------------------------DVVFPVLHGSYGEDG
DDL_LISIN       --------------------------------------------------------VVFPLLHGPNGEDG
DDL_BACA2       -------------------------------------------------------DVVFPLLHGPNGEDG
DDL_MICAN       --------------------------ARQILTSGQPLAI---ESNIKVNIWQFPPEVRFPILHGPNGEDG
DDL_PROMT       -------------------------------------------------------DVWFPCLHGPNGEDG
DDL_PROMH       -------------------------------------------------------DVVFPIVHGAYGEDG
DDL_PROM1       -------------------------------------------------------DVWFPCLHGPNGEDG
DDL_BORBU       -----------------------------------------PGFGIFSNNKNLEIDVVFPVVHGRTGEDG
DDL_BLOFL       -------------------------------------------------------DVIFPIIHGALGEDG
DDL_BACP2       ------LIYGGKSAEHNVSLQTALAVTKALNTEKFDIKLTEPVSNVEQNAKTFLPDVVFPLLHGPNGEDG
DDLA_BRUSU      -----------------------------------------------------KIDIIFPVLHGLHGEDG
DDL_CYAP7       -------------------------VAQQVLESA-QPLSTPTDK--SPQLWQFPPDVWFPILHGPNGEDG
DDL_SYNY3       ---RVGLLFGGCSGEHEVSIKSAQAIAKALASDDNQTKYQVSPFYIQKNGVWLGPDVSFPILHGPNGEDG
DDL_BORDL       MKKNLMLIFGGVSFEHEISLRSAYGIYSSLLKNVFSVFVAELIKRHTTSIVNFIPDVIFPIIHGRTGEDG
DDL_TRIEI       -------------------------------------------------------DVWFPILHGPNGEDG
DDL_BORRA       MKKNLMLIFGGVSFEHEISLRSAYGIYSSLLKNVFSIFVAELIKRHTTSIVNFIPDVIFPIIHGRTGEDG
DDLA_XANCP      -------------------------------------------------------DVVFPIVHGTLGEDG
DDL_PROM9       -------IDNDISVKILIGEIEHKKTKKQELFNQKKI-------NFLDGIEFQNIDIWFPLLHGFNGEDG
DDL_FRASC       -------------------------------------------------------DVVFPLLHGPFGEDG
DDLA_BRUME      -----------------------------------------------------KIDIIFPVLHGLHGEDG
VANA_ENTFC      ---KVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLVLSPDKKMHGLLVKKNHDVAFSALHGKSGEDG
DDL_OENOB       ----VLISKKGI----MIDSETSKRVL--FGEDEDELLAGLPNKNADDSIRNLKLDVLFPSVHGNLGEDG
DDLA_RHILO      ---------------------------------------------LTKNGEQPDPDVVFPVLHGPFGEDG
VANC_ENTGA      --KKIAVLFGGNSPEYSVSLTSAASVIQAIDPLKYEVMTIEDHKNCHQLTFSSQPDVLFPVLHGKYGEDG
DDL_ANACE       ----IAVLCGGSSPEREVSLAGGKRIADALGRLGHRAAVVDLNRESAHQLLAMAPDLVYNALHGGQGEDG
DDL_BORHD       --------------------------APELIKRDSSAIISLPGCGIFVNDEDLEIDVVFPIVHGRTGEDG
VANL_STRCO      ---KVGIVFGGSSEEHAVSVKSAQEVARNLDTEKYRPVVLSPDRSVHGLLVSVRLDVVLPVLHGTLGEDG
DDL_LISW6       --------------------------------------------------------VVFPLLHGPNGEDG
DDL_LISMO       --------------------------------------------------------VVFPLLHGPNGEDG
DDL_CYAP8       ----------------------------------------------SQQLWTFPPDVWFPILHGPNGEDX
DDL_BIFLI       --------------------------------------VSMPDPEMHHALTSLHVDAVLPVLHGPYGEDG
DDL_SYNP2       -------------------------------------------------------DAWFPIVHGPNGEDG
DDL_LISMF       --------------------------------------------------------VVFPLLHGPNGEDG
DDL_SODGM       -------------------------------------------------------DVAFSVLHGASGEDG
DDL_RHOE4       -------------------------------------------------------DVVFPVLHGAYGEDG
MUDD_CHLMU      ------LICGGRSCEHDISILSAQNIAKYLSHSFYEVLITELSEETGKTIFDSKVDVILPILHGPYGEDG
DDL_BORGA       MKKNLMLIFGGVSFEHEISCKSAYSIYLALLDNKYNIYVSDPPKLIDIDIVSLLPDVVFPVVHGRTGEDG
DDL_BACFR       MKRNIAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEPDGSVDRNDFSFAEKVVFDTIHGTPGEDG
DDL_NOCFA       ----------GLSHEALPSVDAGGTLTADPTRGGELVALDDAGAVLGT------VDVVFPILHGPFGEDG
DDL_CORU7       -------------------------------------------------------DVIFPVLHGANGEDG
DDL_ANAVT       -------------------------------------------------------DVWFPILHGPNGEDG
DDL_BIFLO       --------------------------------------VSMSDPEMHHVLTSLHVDAVLPVLHGPYGEDG
DDL_LACS1       -TKKGFLL-GNKDSMRIFDGENEDDVVTEVIKD---VDFSNPLANI-QNLAEVKDDVFYPVIHGNMGEDG
DDL_BIFLD       --------------------------------------VSMSDPEMHHVLTSLHVDAVLPVLHGPYGEDG
DDL_PROMS       -------LDSDSSEKILIDESKNKNTTKKQIFNQEKI-------NFLDGVDFQNVDVWFPLLHGINGEDG
DDL_BACFN       MKRNIAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEMEGRVDRNDFSFMNDFAYITIHGTPGEDG
DDL_SYNP6       ------------------------ETAAQVLANQKPLFVEEPSDRWQFPADCRDVEVWFPILHGPNGEDG
DDL_SYNE7       ------------------------ETAAQVLANQKPLFVEEPSDRWQFPADCRDVEVWFPILHGPNGEDG
DDL_PROMP       --KCIGIIFGGESNEHDVSVSSAKTVFKALIKHGVLVLLKEKRKNETIDKNQVFPDIWFPLLHGVNGEDG
DDL_PROM0       -------------------------------------------------------DVWFPLLHGFNGEDG
DDL_CORJK       -------------------------------------------------------DVVFPVLHGVNGEDG
DDL_ARTS2       -------------------------------------------------------DVVFPLLHGPFGEDG
DDLA_PSEPK      -------------------------------------------------------DLLFPALHGRWGEDG
DDL_ENTFA       --------------------------------------------------------IVFPVLHGPNGEDG
DDL_THETN       -------------------------------------------KFMSKEYDYIDVDVIFPAFHGTHGEDG
DDL_MYCGI       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_HELMI       MKQTIAVICGGRSGEHEVSLTSAQSIVDALDRFRFNVLTIGIDRHIEENPVTRKPDVFFPVLHGPNGEDG
DDL_TROWT       -------------------------------------------------------DLVFPLLHGVFGEDG
DDL_TROW8       -------------------------------------------------------DLVFPLLHGVFGEDG
DDL_SYNR3       -------LSSGANKERYVYIDRGDATARQVLSSGQALA----DDGSRPGFSGFEVEIWYPVLHGPNGEDG
DDL_RHOOB       -------------------------------------LVALDDGEAGKILASV--DVVFPVLHGAYGEDG
DDL_COREF       -------------------------------------------------------DVIFPVLHGRFGEDG
DDL_CORDI       -----------------------------------------------------KVDVVFPVLHGRFGEDG
DDL_ANASP       -------------------------------------------------------DVWFPILHGPNGEDG
DDL_MYCSM       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCS2       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_ENTGA       --------------------------------------------------------IVFPLLHGPNGEDG
DDL_ARTCA       -------------------------------------------------------DVVFPLLHGPFGEDG
DDL_RHOSR       -------------------------------------LVALDDGEAGKILASV--DVVFPVLHGAYGEDG
DDL_KOCRD       -------------------------------------------------------DAVFPLLHGPFGEDG
VANB_ENTFA      ---KVAIIFGGCSEEHDVSVKSAIEIAANITKNGVWKLIFSPDRKTEREYETRRIDVAFPVLHGKCGEDG
DDL_MYCBP       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCBO       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_COXBU       ---------------------------------------AKPWQSLNGDGRRYSADCVFPMVHGTQGEDG
DDL_COXBR       ---------------------------------------AKPWQSLNGDGRRYSADCVFPMVHGTQGEDG
DDL_COXBN       ---------------------------------------AKPWQSLNGDGRRYSADCVFPMVHGTQGEDG
DDL_COXB1       ---------------------------------------AKPWQSLNGDGRRYSADCVFPMVHGTQGEDG
DDL_BACTN       MKRTIAIVAGGDTSEFHVSLRSAQGIYSFIDKEKYTLYIVEPDAPVDRNDFSFRFDFAYITIHGTPGEDG
DDL_VIBHB       MIKNILLLCGGGSSEHEISLLSANFVEQQLIKNGELVYLDPNQKKLCSDNLSLDVDFIVPCIHGFPGETG
DDL_MYCTU       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCTA       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_AERS4       ----VLLLCGGGGSEHEVSLRSANFLEQQLLVPGVEVTRVEMDKLLSFDSVARPVDYVVPCIHGYPGETG
DDL_PARD8       MKKNIAIVAGGDSSEIVISLKSADGIYSFIDKDKYNLYIAIVKRDIDKNDFSFKEDFAYITIHGTPGEDG
Y4SG_RHISN      -------------------------VVAALQECGHETLLCEGDKGLLTTLERFMPPMVFNLAEGIQGEYR
MUDD_CHLTR      ------IICGGKSCEHEISVLSAKNIAKHLSKSFYDVLITR--EGLWESVSSLKVDVVLPILHGPYGEDG
DDL_VIBCM       MTKTILLLCGGGSSEHEISLVSANYIQQQLSEQGALVYLDTNSATLNSDKASYPIDFVVPCIHGFPGETG
DDL_VIBCH       MTKTILLLCGGGSSEHEISLVSANYIQQQLSEQGALVYLDTNSATLNSDKASYPIDFVVPCIHGFPGETG
DDL_KINRD       -------------------------------------------------------DVVLPLLHGPFGEDG
DDLB_BRAJA      -------------------------------------------------------DVAFPILHGPNGEDG
DDL_THEEB       -------------------------------------------------------DVWFPIVHGPNGEDG
DDL_MYCVP       ----------------------------------------------------------FPVLHGPYGEDG
DDL_BACV8       MKRTIAIVAGGDSSELVVSLRSAQGLYSFIDKERYNLYIVEPDGSIDRNDFSFMEDFAYITIHGTPGENG
DDL_MYCPA       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCA1       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_VIBSL       -TTNILLLCGGGSSEHEVSIVSANYLFEQLIKNGELVYLDINDQTLRGDNLESKVDFIVPCIHGFPGETG
DDL_VIBC3       MTKTILLLCGGGSSEHEISLVSANYIQQQLSEQGALVYLDTNSATLNSDKASYPIDFVVPCIHGFPGETG
DDL_BIFAA       -------------------------------------------------------DAVFPVLHGPYGEDG
DDL_AERHH       ----VLLLCGGGGSEHEVSLRSANFLEKQLLLPGVEVTRVEMDKLLSFDSVARPVDYVVPCIHGYPGETG
DDL_LEUMM       ------------SSKKILALEDEQPIVDAFMKT---VDASDPLARIHALKSAGDFDIFFPVVHGNLGEDG
DDL_LEUME       ------------SSKKILALEDEQPIVDAFMKT---VDTSDPLARIHALKSAGDFDIFFPVVHGNLGEDG
DDL_BRASO       -------------------------------------------------------DVIFPVLHGPNGEDG
DDL_BRASB       -------------------------------------------------------DVIFPVLHGPNGEDG
DDL_PROMA       -----------------------------------KVLESDPDKNIFFKQVEFKIQIWFPVLHGPNGEDG
DDL_MYCUA       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_SYNS3       -------------------------------------------------IDNDRVDVWFPVLHGPNGEDG
DDL_TOLAT       -------------------------------------------------------DFVVPCIHGFPGETG
DDL_SYNSC       -------------------------------------------------------DLWYPVLHGPNGEDG
DDL_LACAC       MTKKIQVIFGGNSSEYEVSIVSGHNIYKAIDKDSFKVLVENPHKNNISNIIELKNDVFFPIVHGNLGEDG
DDL_LEUCK       -------------------------------------------------------DIFFPVVHGNLGEDG
DDL_CORGL       -------------------------------------------------------DVIFPVLHGRFGEDG
DDL_LACDB       ---------------------------KVLEEPGYMVEKNDKTANLSNLIEASRPDVLFPIVHGNLGEDG
DDL_LACDA       ---------------------------KVLEEPGYMVEKNDKTANLSNLIEASRPDVLFPIVHGNLGEDG
DDL_CORGB       -------------------------------------------------------DVIFPVLHGRFGEDG
DDL_SYNPX       --------------------------------------------------------VWYPVLHGPNGEDG
DDL_PROM2       --KRIGLIFGGYSNEHEVSISSAKTVFQEINKKRFKVIVNQQKINFLDGIEFQNIDVWFPLLHGLNGEDG
DDL_NOSP7       -------------------------------------------------------DIWFPVLHGPNGEDG
DDL_BIFA0       -------------------------------------------------------DVVLPALHGPFGEDG
DDL_LACH4       -------------------------------------------------------DVFFPIVHGNLGEDG
MUDD_CHLPN      ------LVCGGKSCEHDISLLSAQHVSKYISPEFYDVLIEETDSPLSSEIASAKVDCLFPVLHGPFGEDG
DDL_PROM5       --KCIGIIFGGTSNEHYVSISSAKTVFKALISRTNKELFELPNRNFLNNLEFQNIDIWFPLLHGCNGEDG
DDL_PROMM       ---------------------------------------------------SERVQVWYPVLHGPNGEDG
DDL_PROM3       ---------------------------------------------------SERVQVWYPVLHGPNGEDG
DDL_MYCSS       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCSK       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCSJ       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_MYCLE       -------------------------------------------------------DVVFPVLHGPYGEDG
DDL_SYNS9       --------------------------------------------------------VWYPVLHGPNGEDG
DDL_VIBVU       -------------------------------------------------------DFIVPCIHGFPGETG
DDL_VIBF1       ----ILLLCGGGGTEHEVSLVSSKYISQQLIESGLKYELRSDKTLLSGETVSSPVDYVVPCIHGYPGETG
DDL_VIBFM       ----ILLLCGGGGTEHEVSLVSSKYIAQQLIESGLKYELRSDKTLLSGETVSSPVDYVVPCIHGYPGETG
DDL_THEM4       -------------------------------------------------------DFCFLVFHGTNGEDG
MUDD_CHLCV      -------------------------------------------------------DFVLPILHGPFGEDG
DDL_VIBVY       -------------------------------------------------------DFIVPCIHGFPGETG
DDL_ACAM1       -------------------------------------------------------DVWFPILHGPNGEDG
DDL_PORGI       ----VAVIAGGYSGEHSVSLKSAAGILSWLERDRWSVRVSEQEVPLDKNDFSFRFDYAYITIHGTPGENG
DDL_VIBPA       MIKNILLLCGGGSSEHEISLLSANFVEQQLIKNGELVYLDLNTKQLCSNESNQTIDFIVPCIHGFPGETG
DDL_SYNPW       -------------------------------------------------------DLWYPVLHGPNGEDG
DDL_SHEPW       -TTNILLLCGGGGDEHAISLLSANYLRVELDVNGYRTAAGESCELNSRNRAPWEVDFAIPCIHGFPGETG
DDL_PORG3       ----VAVIAGGYSGEHSVSLKSAAGILSWLERDRWSVRVSEQEVPLDKNDFSFRFDYAYITIHGTPGENG
DDL_SULNB       -----------VSADRKFYLIDTEKINSKLFSSGEKQLVLKNDGFFTKGMFGSKQDVLLNLIHGRDGEDG
DDL_CAMJE       -------------------------------------------------------ECVINLIHGRDGEDG
DDL_CAMJ8       -------------------------------------------------------ECVINLIHGRDGEDG
DDL_SHEAM       -------------------------------------------------------DYVIPCIHGYPGETG
DDL_CAMJD       -------------------------------------------------------ECVINLIHGGDGEDG
DDL_LACGA       ---KVGLIFGGNSSEYEVSIMSAHNIYEEIDTNGYKMEVANPHKNIS-NIVELKDDVFFPIVHGNLGEDG
DDL_CAMJR       -------------------------------------------------------ECVINLIHGRDGEDG
DDL_CAMJJ       -------------------------------------------------------ECVINLIHGRDGEDG
DDL_SHESW       ----LLLLCGGGSAEHDISLMSANYFESSLAKSDFSVLRVELDKELTNNRAPWPVDYVIPCIHGYPGETG
DDL_SHEDO       ----VLLLCGGGGAEHDISLMSARFFETSLAKSDFSVLTLTLDKNLCSSIAPWAVDYVIPCIHGFPGETG
DDL_SHEPC       ----LLLLCGGGSAEHDISLMSANYFESSLAKSDFSVLRVELDKELTNNRAPWPVDYVIPCIHGYPGETG
DDL_CAMC1       -------------------------------------------------------DVIINLIHGMDGEDG
DDL_LACJO       ---KVGLIFGGNSSEYEVSIMSAHNIYEEIDTNGYKMEVANPHKNIS-NIIELKDDVFFPIVHGNLGEDG
DDL_SHEHH       --KNLLLLCGGGGDEHSISLLSANFFETQLAKGQYRTQAGENSKQIRFNDQSKAPDYVIPCIHGYPGETG
DDL_SHEFN       -------------------------------------------------------DYVIPCIHGFPGETG
DDL_SHEB9       ----LLLLCGGGSAEHDISLMSANYFETSLAKSEFSVLRVELDKTNSREITPWPVDYVIPCIHGYPGETG
DDL_SHEB8       ----LLLLCGGGSAEHDISLMSANYFETSLAKSEFSVLRVELDKTNSREITPWPVDYVIPCIHGYPGETG
DDL_SHEB2       ----LLLLCGGGSAEHDISLMSANYFETSLAKSEFSVLRVELDKTNSREITPWPVDYVIPCIHGYPGETG
DDL_METS4       -------------------------------------------------------DVVVPVLHGPNGEDG
DDL_WOLSU       -------------------------------------------------------DTALNLIHGGDGEDG
DDL_SHESR       -------------------------------------------------------DYVIPCIHGYPGETG
DDL_SHEWM       -------------------------------------------------------DYVIPCIHGFPGETG
DDL_SHESA       ----LLLLCGGGSAEHDISLLSANYFETSLAKNVLRVVLDKDDCELTNNREAWPVDYVIPCIHGYPGETG
DDL_SHESM       -------------------------------------------------------DYVIPCIHGYPGETG
DDL_SHEON       -------------------------------------------------------DYVIPCIHGYPGETG
DDL_SHESH       ----LLLLCGGGGDEHAISLLSANFFETSLADTGFNVLRVELDKQIRFEDESKRPDYVIPCIHGYPGETG
DDL_SHEPA       -------------------------------------------------------DYVIPCIHGYPGETG
DDL_NITSB       -------------------------------------------------------DVVINLVHGADGEDG
DDL_SULDN       ---------------------------------------------------------VLNLIHGGDGEDG
DDL_SHELP       -----------------------------------------------ESLAPWPVDYVIPCIHGYPGETG
DDL_HELHP       ---------------------------------------------VKKTFFGFKPIILINLIHGADGEDG
DDL_HELPS       --------------------------------------------------------LVINLVHGGDGEDG
DDL_HELPJ       --------------------------------------------------------LVINLVHGGDGEDG
DDL_HELP2       --------------------------------------------------------LVINLVHGGDGEDG
DDL_HELAH       -------------------------------------------KNSFLGAKTIELPLMINLVHGGDGEDG
DDL_HELPH       --------------------------------------------------------LVINLVHGGDGEDG
DDL_CAMLR       -------------------------------------------------------DVAVNIVHGKDGEDG
CARB_CLOB8      ----------------------------------------------------------------------
CARB_CLOBL      -----------------------------------------------------KPDGVILQFGGQTAIK-
CARB_CLOBA      ----------------------------------------------------------------------
CARB_CLOBM      -----------------------------------------------------------NGIILQFGGQT
CARB_CLOPS      ----------------------------------------------------------------------
CARB_CLOPE      ----------------------------------------------------------------------
CARB_CLOP1      ----------------------------------------------------------------------
CARB_CLOBJ      ----------------------------------------------------------------QFGGQT
CARB_NATTJ      ----------------------------------------------------------------------
CARB_CLOBB      ----------------------------------------------------------------------
CARB_HALOH      ----------------------------------------------------------------------
CARB_THEPX      ----------------------------------------------------------------------
CARB_THEP3      ----------------------------------------------------------------------
CARB_LACH4      ----------------------------------------------------------------------
CARB_LACDB      ----------------------------------------------------------------------
CARB_PYRFU      ----------------------------------------------------------------------
CARB_CLAM3      ----------------------------------------------------------------------
Y012_MYCGE      ----------------------------------------------------------------------
CARB_BACSU      ----------------------------------------------------------------------
CARB_THETN      ----------------------------------------------------------------------
CARB_LACJO      ----------------------------------------------------------------------
CARB_PELTS      ----------------------------------------------------------------------
CARB_CLOAB      ----------------------------------------------------------------------
CARY_BACSU      ----------------------------------------------------------------------
CARY_BACST      ----------------------------------------------------------------------
CARB_METAC      ----------------------------------------------------------------------
CARB_STRP3      ----------------------------------------------------------------------
CARB_STRU0      ----------------------------------------------------------------------
CARB_STRE4      ----------------------------------------------------------------------
CARB_FUSNN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYXXXXXXXXXXXXXXXXXXXXXFPVVV
DDL_PELUB       YIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYXXXXXXXXXXXXXXXXXXXXXFPVVV
DDL_RHORT       AIQGILDIMALPYTHSGRLASAIAMDKPSAKLVFERFAIPVAPHVVADRASVLAETAMAR------PYVV
DDL_ZYMMO       SIQGLMDLMAIRYTHSGLTASAIAIDKELTK------KILTPENIPMPQGCLVERESLYTKDPLPRPYVL
DDL_MAGSA       CVQGVLNLLGVPYTHSGLLASAAAMDKAFARALFASAGIPVAEGRVITRTDRNGPDPLPR------PFVV
DDL_BARHE       RIQGVLEYLKIPYTHSGVMASALAMDKGRAKIVVASVGVIAPSCVMSRFAVGKEHPMEP-------PYVI
DDL_MARMM       LVQGVLEHFGKPYTHSGVLASALAMDKQKAKDVLRAAGIPCPEGIIANRFEAAKAHVMKP------PYVA
DDLB_RHILO      TIQGILEYLGIPYTHSGVLASALAMNKEQAKKIVKTVGVPVAESKVANRFAIQNKHPMKP------PYVI
DDL_WOLWR       CIQGLLEILGIKYTHSGVMASAVAINKVMSKHIFRSLNIDTPK-----GYVISREDVLKNNIKIDYPYVL
DDL_WOLPM       CIQGLLEILGIKYTHSGVMASAVAINKVMSKHIFRSLNIDTPK-----GYVISREDVLKNNIKIDYPYVL
DDL_METRJ       TIQGLLEILKIPYTHSGVLASALAMNKERAKTVMRAAGVDVPEGRIVNRREAARTHPLPP------PYVV
DDL_METPB       TIQGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRVVNRHDAAKSHPLTP------PYVV
DDL_PARL1       CVQGLLEILRVPYTHSGVLASALAMHKERAKFVFVAESVVVPREQAAHGHVMDP------------PYVI
DDL_RHISN       TIQGILEYLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVADALIMDRREFGNAHPMKP------PYVV
DDL_WOLPP       CIQGLLEILGIKYTHSEVMASAVAMNKVMSKHIFHSLNIDTPR-----GYVISREDVLKNNIKVDYPYVL
DDL_RICB8       CLPGLLNIMRIPYTHSGVLASSLAFDKVHSRSWFLTNNINMAESIVISKGDNIKTDPIKR------PYVI
DDL_BEII9       IIQGVLEMLAIPYTHSGVLASALAMRKDRARDVLAAAGVPIAKGVTVDRLEAAQRHILPP------PYVI
DDL_METEP       TIQGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRVVNRHDAAKSHPLTP------PYVV
DDL_METC4       TIQGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRVVNRHDAAKSHPLTP------PYVV
DDL_RICTY       CLPGLLNIMRIPYTHSGVLSSALAFDKIHSRSCFLKNNI------NMADSIVVSKSDHINTDPMKRPYVI
DDL_RICBR       CLPGLLNIMRIPYTHSGVLASSLAFDKVHSRSWFLTNNINMAESIVISKGDNIKTDPIKR------PYVI
DDL_GEOSM       SVQGLLELMGIPYTGSGVLASALAIDKIASKVIFASAGLTLAPY-------QVLRRGEEFKLANPLPVVV
DDL_BART1       RIQGILEYLKIPYTHSGVMASALAMDKGRAKIIAANAGVCVAPSRIMNRFSIGKTHPMEP------PYVI
DDL_METSB       VIQGVLEMLAIPYTHSGVLASALAMQKDRAKDVLRAAGVPVAEGVTIGRFEAAKAHVMTP------PYVV
DDL_SPHWW       TVQGMMDLMGLTYTHSGLTTSVIAIDKELTKQQLVPHGIRMPE------GIIVESESLHAGDPMPRPYVL
DDL_RICFE       CLPGLLNIMRIPYTHSGVLSSALAFDKIHSRSWFLTNNINMAESIIVNKSDNIKSDPVKR------PYVI
DDL_WOLTR       CIQGLLEILGIKYTHSGVMASAIAMNKAMSKHIFRSLGIDTPK-----GYIISRGDILKNNIKIDYPYVL
DDL_GEOUR       AIQGLLEIMGIPYTGSGVLASALAMNKIFAKQAFQAARLTVAPY----KVFCRGDKAALAELEFSLPVVV
DDL_BARBK       CIQGILEYLKIPYTHSGVMASALAMDKGRAKIIAASAGVSVAPSCVMSRFSLGAEHPMKP------PYVI
DDL_SPHAL       TVQGMLDLMGFRYTHSGLVTSVIAIDKELTKQALVPHGIPMP------TGTMVDSESLFSVDPLPRPYVL
DDL_XANP2       TIQGILEILRIPYSHSGVLASALAMDKAQARIMLAAAGVPVAK------GGLVSRAEAAKAHIMPTPYVL
DDL_RICCK       CLSGLLNIMRIPYTHSGVLSSALAFDKIYSRSWFLTNNINMAESIVVNKSDNIKIEPMKR------PYVI
DDL_GEOSL       TVQGLLELMGIPYTGSGVLASALAMNKIVAKEVFAARGLTIAPY----RVVRRGETVDPVAEGFGYPVVV
DDL_MESSB       TVQGVLEYLGIPYTHSGVLASALAMDKDLAKTVAKSAGIPVASSRVMNRFEIGDKHPMEP------PYVV
DDL_SILST       CVQGLLEWLRIPYTHSGVLASALAMDKERSKAAYVVDSVIAAKADVMARHVIAP------------PYVV
DDL_OLICO       TIQGVLETLGIPYSHSGVLSSSLAMRKDLAKTVMATAGVPVAEGLTLTRAEIAKAHVMAP------PYVI
DDL_GRABC       AIQGVLDWLNIPYTHSGVRASAIAMDKXXXXXXXXXXGLPVAEGRLVTVEELAEQDPLPR------PFVI
DDL_GEOBB       SVQGLLELMGIPYTGSGVLASALAIDKIASKVIFASAGLKLAPY-------QVLRRGEELKLANPLPVVV
DDL_PELCD       TVQGLLELADIPYTGSGVLASSLAMDKVATKKMLCYHGIATPGF------AVMRRGQKICGTLPDYPLVV
DDL_THELT       TVQAILDWVGVSYTGSKVLASAICFDKVMTYRV-LDGYVNFPEYTIVKKPVKESPYG--------FPCVI
DDL_RICRS       GLPGLLNIMRIPYTHSGVLSSALAFDKIHSRIWFLTNNINMAESIVVNKSDNIKNDPMKR------PYVI
DDL_RICRO       GLPGLLNIMRIPYTHSGVLSSALAFDKIHSRIWFLTNNINMAESIVVNKSDNIKNDPMKR------PYVI
DDL_OCHA4       AIQGVLEYLQIPYTHSGVLASALAMDKDXXXXXXXXSSLLLNRFEIGTEHPMEP------------PYVV
DDL_RHOPB       TIQGVLETLGIPYSHSGVLASALAMQKDLAKTVMATAGVPVAEGLTLSRAEVAKRHVMAP------PYVI
DDL_RICPR       CLPGLLNIMRIPYTHSGLLSSALAFDKIHFRSCVLKNNI------NIADSIVVSKSDHINTDPMKRPYVI
DDL_RICCN       CLPGLLNIMRIPYTHSGVLSSALAFDKIHSRIWFLTNNINMAEGIVVNKSDNIKNDPMKR------PYVI
DDL_RICAE       CLPGLLNIMRIPYTHSGMLSSALAFDKIHSRIWFLTNNINMAESIVVNKSDNIKNDPMKR------PYVI
DDL_ERYLH       TVQGMLDLMGVPYTHSGLATSVIAIDKELTKQQLVPRGIPMP------GGRIVQSEDLYQQDPLARPYVL
DDL_THEYD       AVQGMLEVMGIPYTGSGVLASALAMDKEASKKIFLYHGIPVPPF--KVLNKKDYIXXXXXXXXXXFPCVV
DDL_RHOP5       SIQGVLETLAIPYSHSGVLASALAMQKDLAKTVMKTAGVPVAEGLTLSRDEIARGHVMEP------PYVI
DDL_NOVAD       SIQGLMDIMGLTYTHSGLVTSVIAIDKELTKQALVPHGIPMP------GGRMVKTADLYKADPLPRPYVL
DDL_AGRT5       TIQGILEYLAIPYTHSGVLASAVAGERVMNRFDFTSEHPLQPPY------------------------VV
DDL_RICM5       CLPGLLNIMRIPYTHSGMLSSALAFNKIHSRSWFLTNNINMAESIVVNKSDNIKNDPMKR------PYVI
DDL_HYPNA       CVQGLLEVMGLPYSHSGVLASALAMDKLKSKAVYRSAGLDVXXXXXXXXXXXXXXXXLPP------PYVV
DDL_CARHZ       AIQGLLEIMDIPYTGSGILASSLAIDKIMTKKILKAEGIPTPNYFSFDENPNFEAISSEILQTLKLPVVI
DDL_RICAH       CLPGLLNIMRIPYTHSGVLSSALAFNKIHSSSWFFANSINTAESIVVSKSYNINTDPMKR------PYVI
DDL_RHOS5       CVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAQSVIATPDEVQAGHVLPP-------------PYVV
DDL_AQUAE       TVQGLLEILDIPYTGSDTIASAVSIDKDFTKRIVKSLGINTPDW-----ETFISEGDVLNTEWNKFPAVV
DDL_ANADF       CVQGLLECMGIPYTGSGVTASAMGMDKTVSKAIFKALGLDVIEYRAFPPARAAEIDLRDLPFGV--PCVV
DDL_SILPO       CVQGLLEWLRIPYTSSGVLASALAMDKERSKEAYRAAGLPVAASQLADRAAIEAAHVMQP------PYVV
DDL_DINSH       CVQGLLEWLRIPYTHSGVLASALAMDKERTKAAYAAAGLPIATSGLFTRAQIAARHVMPP------PYVI
DDL_RHOS4       CVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAQSVLATPEEVRARHILPP-------------PYVV
DDL_RHOS1       CVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAQSVLATPEEVRARHILPP-------------PYVV
DDL_RICPU       CLPGLLNIMRIPYTHSGVLSSALAFNKIHSRIWFLTNNINMAESIVVNKSDNIKNDPMKR------PYVI
DDL_PELPD       CVQGLLELMAIPYTGSGVLASALAMHKLYSKQAFVSAGILTAPF----HHFRRGERVSLSHLSFGLPLVV
DDL_THEP1       TLQAILDFLGIRYTGSDAFSSMICFDKLATYR-FLKDIVEIPDFIEIREFMETSPLG--------YPCVV
DDL_RHIME       TIQGILEYLEIPYTHSGVLASALAMDKDQAKHVAKAAGIPVAEALVMDRRSFGNQHPMKP------PYVV
DDL_GEOLS       CIQGLLELMQIPYTGSGVLASALAMHKLYSKQAFAAAGLTITPY----ATVRQGDRCNAEQLPFGLPVVV
DDL_THESQ       TLQAILDFLGIRYTGSDAFSSMICFDKLVTYR-FLKGTVEIPDFVEIKEFMKTSPLG--------YPCVV
DDL_THEMA       TLQAILDFLGIRYTGSDAFSSMICFDKLVTYR-FLKGTVEIPDFVEIKEFMKTSPLG--------YPCVV
DDL_FERNB       KMQAILDSIGIPYTGSGVETSVIAFDKYLCN-LFVENTIKIPNFLLIXXXXXXXXKIYMIEEKIGLPCVV
DDL_AZOC5       TIQGILEILRIPYSHSGVLASALAMDKARAKVVMAAAGIPVP------GGHLVTRAEAAKGHVLPPPYVL
DDL_GLUOX       AIQGVLEWLGLPYTHSGIRASAVAMDKGATRIL------LAAAGLPVAQGRVVTVEELAEADPLPAPYVI
DDL_BARQU       CIQGVLEYLKIPYTHSGVMASALAMDKGRAKIXXXXXXXXXXPSCIMSRFAVGREHPMEP------PYVI
DDL_SINMW       TIQGILEYLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVAEAVVMDRRSFGNQHPMKP------PYVV
DDLB_BRUME      AIQGVLEYLQIPYTHSGVLASALAMDKDRXXXXXXXXXXXXXPSRLMNRFDIGSQHPMKP------PYVV
DDL_JANSC       CVQGLLEWMRLPYTHSGVLSSALAMDKTRAKTALVVDSIIAPK------------EAVVAAHVMATPYVV
DDLB_BRUSU      AIQGVLEYLQIPYTHSGVLASALAMDKDRXXXXXXXXXXXXXPSRLMNRFDIGSQHPMKP------PYVV
DDL_CAUSK       CVQGVLETLGLAYTHSGVLASALAMDKAKSKAVLAAAGIPVP------GGGLFDRHDVAQGHVMPPPYVV
DDL_ROSDO       CVQGLLEWMGVPYSHSGVLASALAMDKQRSKDAFVAAGLVVPSVIAKAADVRMGHVMQP-------PYVV
DDL_FRATN       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTP-------MAKFLTDKLVAEDEISFPVAV
DDL_ANASK       SIQGLLESMAIPYTGSGVLASAMGMDKTVSKAIFRSLGLAVADY--RVFPRASAGSIGVGDLPFGLPCVV
DDL_ANAD2       SIQGLLESMAIPYTGSGVLASAMGMDKTVSKAIFRSLGLAVADY--RVFPRASAGSIGVGDLPFGLPCVV
DDL_ACICJ       TIQGVLDYMGIPYTHSGVRASSMXXXXXXXXXXXXXXXXXXXQHRIVPLDELAEADPLPR------PYVI
DDL_FRATT       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTP-------MAKFLTDKLVAEDEISFPVAV
DDL_FRATO       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTP-------MAKFLTDKLVAEDEISFPVAV
DDL_FRATF       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTP-------MAKFLTDKLVAEDEISFPVAV
DDL_FRAT1       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTP-------MAKFLTDKLVAEDEISFPVAV
DDL_FRATW       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHYRMPTP-------MAKFLTDKLVAEDEISFPVAV
DDL_GLOVI       KLQGLLDWLGLPYNGSGVTASAIAMDKVVSKRLFVAEGIPTPAYRVAEAVPQVSECQAWLAALGS-PVVV
DDL_FRATH       RVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTP-------MAKFLTDKLVAEDEISFPAAV
DDL_SYNJA       VVQGMLEWLGLPYQGSGPLASALAMDKLVSKQIFRAEGIPTPEWLVWDEAQPLSWAECVARLGS--PLVV
DDL_ANADE       SIQGLLESMAIPYTGSGVLASAMGMDKTVSKAIFRSLGLAVADY--RVFPRAAAGAIGVDDLPFGLPCVV
DDL_CAUCR       CVQGVLETLKLPYTHSGVXXXXXXXXXXXXXXXXXXXGVTVPGGGLFNRHDVARDHVLQP------PYVV
DDL_FRAP2       RVAALLELLGIKHTGSTMKSCVVTMDKMISKEILMHHRMPTP-------MAKFLTDRLVEADEISFPVAV
DDL_SYNWW       TVQGYLELLGIPYTGSGVLASAVCMNKVITKKLLSYEGLPTADFQVIKKRGFNRDLFNPDLLMEDFPLVV
DDL_SYNJB       VVQGMLDWLGLPYQGSGPLASALAMDKLVSKQIFRAAGIPTPDWQVWDDQNPLTWADCAAELGS--PLVI
DDL_DESAP       AVQGLLEVLGIPYTGSGVLASALAMDKIATKKILAHAGLPVPEY--RELEAGDADSARAVVAELGLPVVV
DDL_COLP3       CLQGALEYLDIPYTGSNVLGSSLSMDKVRSKQIFKACGIPTAPFTVVNKAEFSTLSLENILADLGGRVMV
DDL_PECCP       TLQGVLEFLGLPYTGSGVMASALTMDKLRTKQVWQAVGLPVSPYVALDRRQYSEMAANALLATFTLPLIV
DDL_MAGSM       TIQGLLEFMGIPYTGPNVAASAICMDKGLSKRLFHSEGLPTPAWIELAGDHEEADELVDHFLGDFHAAFV
DDL_HAEIN       TMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTRETFSELDPQAVVAKLGLPLMV
DDL_BUCAP       SIQGILEYLNIPYTGSGIMSSAISLDKWRTKLLWLSLRVLPDIYQKKDXXXXXXXXXXXXXXXXXFPVVI
DDL_HAEDU       VLQGALEQMGIPYTGCGVMASAITLDKFRTKLLW--NAVGLPTADMVVVQRGQAIDINQIIAKLSLPVFV
DDL_ALCBS       VIQGVLEHLEIPYTGSGVMASAIGMDKVRTKQLWKGAGLPTPAF----------YVAGREEAELGFPVIV
DDL_HAEI8       TMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTRETFSELDPQAVVAKLGLPLMV
DDLB_CLOPE      TVQAFLDIMDIPYSGCGALSSSLCMDKNLSKKVLKAENIRTAKW---ITVKSXXXXXXXXXXXXGYPVFV
DDL_HAEIG       TMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTRETFSELDPQAVVAKLGLPLMV
DDL_FUSNN       KIQAVLDILGKKYTGSGVLASAITMDKDKTKQIAQSVGIKTPK------------SYRPVEEIERFPVII
DDL_CLOB8       TVQSVLQTLGIPYSGCGPLSSAMCMDKDVSKSVLEANGIRTAPW---INLRKGDNIDFNKINELGYPVVV
DDLB_ECOLI      TLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLSDKQLAEISLPVIV
DDLB_ECO57      TLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRVEFEKGLSDKQLAEISLPVIV
DDL_HAEIE       TMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMKVVTRETFAELDPQAVVAKLGLPLMV
DDL_ACTPJ       VLQGALEQMGIPYTGCGVMASAVTLDKFRTKLMW--QAVGLPTADMVVVRRGEAVDSEQIIAKLGLPVFV
DDL_ACTP7       VLQGALEQMGIPYTGCGVMASAVTLDKFRTKLMW--QAVGLPTADMVVVRRGEAVDSEQIIAKLGLPVFV
DDL_ACTP2       VLQGALEQMGIPYTGCGVMASAVTLDKFRTKLMW--QAVGLPTADMVVVRRGEAVDSEQIIAKLGLPVFV
DDLB_SHIFL      TLQGMLELMGLPYTGSGVMASALSIDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLSDKQLAEISLPVIV
DDL_CLOBA       TVQSVLQTLGIPYSGCGPLSSSMCMDKDISKCILKAANIRTAPW---INLRKNDAINYEEIEKMGYPVVV
DDL_ACTSZ       VIQGVLEQIGLPYTGCGVMTSALTMDKMRTKMLWKGFGLPIADMEIVTKNTALSLEPQAIVARLGLPLMV
DDL_PASMU       TMQGLLEQIGIPYTGCGVMTSALTMDKMRTKMLWKAFGLPVAEMEIVTKANVGELNPSAVVEKLGLPVMV
DDL_SACD2       KMQAVLDWLAIPYTGSDHAASALAMDKLKTKQVWQSVGLVTPEYASLVENSDWQAVLDSLGGQG----FV
DDL_PELTS       TIQGLLEMLDIPYTGSGVLASALAMDKAATKKIIQYEGLPTPPFKKEALKESLQACSERICREMGLPLVV
DDL_MANSM       VIQGVLEQIGLPYTGCGVMTSALTMDKMRTKMLWKGFGLPIADMEIVTRDTVDELNPLEVVERLGLPLMV
DDL_BACAN       TVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDW---IELTKMEDLNFDELDKLGFPLVV
DDL_BACAC       TVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDW---IELTKMEDLNFDELDKLGFPLVV
DDL_BACAA       TVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDW---IELTKMEDLNFDELDKLGFPLVV
DDLA_CLOTE      KVQALLETMGVPYSGSGVLASSLCMDKNMSKKILQGEGIKTPRW---IMLYKNEDIDFESIKNIGYPLVV
DDL_PSEHT       TVQGALEFMNLPYTGSNVLGSALAMDKVRCKHLFKSAGLSTAPYTVVDAKKGFDAAAIMQQFK---KVMV
DDL_DESRM       TIQGLLEMLDIPYTGSGVLASALAINKIATKKIFKMEGIPTPAFKKEVEDKSLQEAALRAIKEVGVPAVV
DDL_CLOBL       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVSSVENIDYEAIEKIGYPVFV
DDL_CLOBB       TVQSVLQTLEIPYSGCGPLSSSMCMDKDISKCILKAANIRTAPW---INLRRNDKINYEKIEGMGYPVVV
DDL_BACHD       KVQALLDLLNIPYVGTGVQGSALAMDKAKAKLFFEKAGI---RVAEEVVLHSFTYDANAFNFTGTYPVVV
DDL_METPP       TVQGALELLRIPYTGSGVMASAIAMDKIMTKRVWLAEGLPTPRYVRLAPDEQTPERVRGVPDDLGLPLIV
DDLB_SALTY      TLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLSEEQKARISLPLIV
DDLB_PSESM      TMQGLLECLEIPYTGSGVLASALAMDKLRTKQVWQSLGPATPLH----AVLENENDCICAATELGFPLIV
DDL_SYNFM       TIQGLLESLGIPYQGSGVLGSAVAMNKILSKQLYIHAGL--PVAPHLVADRREPPDLDTVADRLGLPVVV
DDL_SALPK       TLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLSEEQKARISLPLIV
DDL_SALPA       TLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLSEEQKARISLPLIV
DDL_METFK       TIQGALELMGIPYTGSGVMASSVGMDKWRTKLLWRAAGVVTPDF----ELVTADSNFDAIERKLGLPLFV
DDL_CLOBK       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVSSAENIDYEAIEKIGYPVFV
DDL_CLOBJ       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVSSVENIDYEAIEKIGYPVFV
DDL_CLOBH       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVSSVENIDYEAIEKIGYPVFV
DDL_CLOB1       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVSSVENIDYEAIEKIGYPVFV
DDLB_SALTI      TLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLSEEQKARISLPLIV
DDLB_PSEAE      SMQGLLECAGIPYTGSGVLASALAMDKLRTKRVWLSLGLPTPDY----AVLASEDDCREAAQRLGFPLIV
DDL_METI4       QIQRLLMRRGIPFTGSDASSSEKAFDKAWSKTLFIKGGIPTPPFCVVGDGKKIPFDP---------PYVI
DDL_CLOBM       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVTNAEDIDYEAIEKIGYPVFV
DDL_PHOLL       TLQGVLEFLQLPYTGSGVMASALSMDKLRTKQVWQGIGLTVSPYVSINSQQVERLTDSQLQEYVALPLIV
DDL_MOOTA       SVQGLLEVLGLPYTGSRVLASAITMDKIMTKRVLLQAGIPTPKFTGAEYATGKKEIKAAILKELGLPVVI
DDL_JANMA       SLQGALEQLGIPYTGPGVMASAIAMDKVITKRVCLSHGVPTPKFTALEVEATTAEQLQAIAAEFGMPLML
DDL_CLOK5       IIQSVFQTMDIPYSGCSPLTSGICMDKDISKKLLYSANINTAEW---ICIKSIENIDYDYLEKMGYPVVV
DDL_CLOK1       IIQSVFQTMDIPYSGCSPLTSGICMDKDISKKLLYSANINTAEW---ICIKSIENIDYDYLEKMGYPVVV
DDL_ACIBY       QIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPY----RIITKETDLDSVIAELGLPVII
DDL_ACIBT       QIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPY----RIITKETDLDSVIAELGLPVII
DDL_ACIBC       QIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPY----RIITKETDLDSVIAELGLPVII
DDL_ACIB5       QIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPY----RIITKETDLDSVIAELGLPVII
DDL_ACIB3       QIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPY----RIITKETDLDSVIAELGLPVII
DDL_NITEU       SVQGALELMELPYTGSGILASALAMDKWRTKMIWQAAGINTPDY----VMLDASSRFRDVADRLGLPLII
DDL_MARMS       RVQALLEMFGKPYTGSSPLACGLAMDKVLTKRFWNGIGIPTPAY----LSFVDHANADLIEEQMSYPVIV
DDL_HAES1       TIQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMEVVTRTSFSQLNPQVVVEKLGLPLMV
DDL_XANAC       IVQGLMEAFGVPYTGSDVLGSALSMDKIRTKQVWLSLGLSTPRY-ARLAAGASAEDIHAAARQIGLPIIV
DDL_HAES2       TIQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVADMEVVTRTSFSQLNPQVVVEKLGLPLMV
DDLB_ECOL6      TLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKGLNDKQLAEISLPVIV
DDLA_CLOPE      TVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARW---EMVSSVDEIDYEKIENLGYPVFV
DDL_ACIBS       QIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPY----RIITKETDLDSVIAELGLPVII
DDL_NITEC       SVQGALELMDLPYTGSGILASALAMDKWRTKMIWQAAGISTPDY----VMLDADSNFQEVTDRLGLPLII
DDL_PSEPF       SMQGLLEVAGIPYTGSGILASALAMDKLRTKQVWHTLGIPTPRH----AVLRSEADCISAATELGFPLIV
DDL_CLOPS       TVQSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARW---VMVSSVDEIDYEKIENLGYPVFI
DDLA_BACCR      TVQGTLESLGIPYSGSNMLSSSICMDKNISKKILRYEGVETPDW---IELTKMEDLNLDELDKLGFPLVV
DDLB_XANCP      IVQGLMEAFGVPYTGSNVLGSALSMDKIRTKQVWLSLGLSTPRY-ARLXXXXXXXXXXXXXXXIGLPVIV
DDL_IDILO       SMQGALQILEMPYTGSDVLGCALGMDKVRCKQIWHSVGLPTANWRVVTQAEIEQVNVEAMLQELGGRVIV
DDL_POLSJ       TVQGALELLGIPYTGSGVMASSMAIDKVMTKRVMLAEGLPTPTYVLLRRGSYGSADVSAVPDKLGLPLIV
DDL_HERAR       TLQGALEQLGIPYTGPGVMASAISMDKVMTKRVCLSHGVPTPRFTVLDAETTSAAQLQSVAAEFGLPLML
DDL_DECAR       TIQGALEVMHIPYTGSGVLASALAMDKFRTKLMWRAAGLAIPEY----ALLTADSDFADIEEELGLPLFV
DDL_ANAMM       CVSGLLDILGLACTHSHVAASSVGMDKVLTKHVLKSLGIDFPKF-----DVLTKEELLSAKEVLPYPFVI
DDL_ANAMF       CVSGLLDILGLACTHSHVAASSVGMDKVLTKHVLKSLGIDFPKF-----DVLTKEELLSAKEVLPYPFVI
DDL_ACIAD       QIQGVLEWLDIPYTGTGVQGSAIGMDKIKTKQIWQGSDLPTAPY----RIVSKDSDLNEIVASLGLPVII
DDL_CHRSD       SLQGALELLGIPYTGSGVLASALGMDKERTKQLWRAHGLPTPE----SVMLEGEPDWDAVIEALGLPLIV
DDL_THICR       GVQAVLDSLALPYTGSGMTASALAMDKLRTKWLWKGVGLPTPAF----IVVSPSRPLDVETFDLTFPVIV
DDL_MARAV       TLQAILGQAGIPYTGSEVLASALAMDKLRTKYVFEGCGLPTPAFRAMTSVGEAEGIVAALGT----PLSV
DDL_PSEMY       SMQGLLECAGIPYTGSGILASALAMDKLRTKQVWHSLGLPTPRH----AVLTSQADCEAAAAELGFPLIV
DDL_POLNS       TIQGLLELLGLPYTGSAVLASALAIDKIVTKQVWISNGLATPEY----EELTATSDWNAVVQHLGLPLIV
DDL_NEIMB       AVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEF----AVLHDDTDFDAVEEKLGLPMFV
DDL_HAMD5       HLQAVLEFLKIPYTGSGVMASALAMDKHRSKMIFQGAGLPVSPYVALNREQIWPNVTQNTSNDLLLPLIV
DDL_ERWCT       TLQGVLEFLGLPYTGSGVMASALTMDKLRTKQVWQAVGLPVSPYVALDRRQYLDTEANTLLAQFTLPLIV
DDL_CLOB6       TVQSVLQTLDIPYSGCGPLTSAICMDKDMTKKILKYANINTADW---VNVSSVEDIDYEAIEKIGYPVFV
DDLB_CHRVO      TLQGALEALGMPYTGCGVMASAIAMDKWRTKLLWKGAGLPIPAF----ELLDENSDFDAIERQLGLPIFV
DDL_NEIG2       AVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEF----AVLYDDTDFDAVEEKLGLPMFV
DDL_NEIG1       AVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEF----AVLYDDTDFDAVEEKLGLPMFV
DDL_YERPY       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPS       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPP       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPN       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPG       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPE       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPB       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERPA       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_YERP3       TLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVALPLIV
DDL_NEIMA       AVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEF----AVLHDDTDFDAVEEKLGLPMFV
DDL_BORA1       AIQGALELLNIPYTGSGVTASALAMDKIMTKRVWLQHGLPTPAF----EEIDSDTELRRVPDRLGLPLIL
DDL_RALEJ       TMQGLLEQLGVPYTGSGVLASALAMDKQATKRLWMTHDLSTPRF----AMLYADTDFDAVVADLGLPLIV
DDL_LEPIN       TIQGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSKVAPFFEIDKLEYLNSTDAVITKLETLGFPQFL
DDL_CLOTH       TIQGLFELAGIPYVGCGVLASAVGMDKIYAKIIFEKAGIPQADYTRKEIYGDVEGVVDKIEEKFSYPVFV
DDL_NEIMF       AVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEF----AVLHDDTDFDAVEEKLGLPMFV
DDL_PSEE4       SMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQSLGIPTPRH----AVLASEQDCVAASAELGFPLIV
DDL_POLNA       TVQGALELLGIPYTGSGVMASSMAIDKVMTKRLLLSESLPTPRYVLLRRGGYSPAQVDAIVDTLGLPLIV
DDL_LARHH       TLQGALETMGIPYTGCGVMASAIGMDKWRSKLVWKAAGLPVPDF----RLLADDSDFAAIEAELGLPMFV
DDL_ERWT9       TLQGVLEFLAIPYTGSGVMASAITMDKLRSKYLWQGCGLPVSPFVALNRAQMDAGLDAQLMTSIDLPLFV
DDL_LEPIC       TIQGFLEILGIPYTGSGVLASAIAMDKTRANQIFLQSKVAPFFEIDKLEYLNSTDAVITKLETLGFPQFL
DDL_PEDPA       KVQAVLDLNHIKYTGSGSLASGIAMDKAISKEIMLYNNIKTAQFAVLHAKDGIHPQLAFD-----YPMVV
DDL_PSEU5       SMQGLLECAGIPYTGSGILASALAMDKLRTKQVWQSLGLPTPRH----AVLASEVDCQAAAQMLGFPLIV
DDL_NITOC       VIQGVLETLNLPYTGSGVLGSALTMDKLRSKRLWRGMDLPTADF----SVLTRDTNPALIAADLGLPLIV
DDL_NITMU       TVQGALELLGIPYTGSGVLASALAMDKWRTKLLWQSAGINTPRH----ILLDEQSDFDAVAKELGLPLIV
DDL_HAEPS       VLQGALEQLGIPYTGCGVMASAITLDKFRTKLLW--NAVGLPTAAMEVVRRGQAVNSDEIIAKLGLPLFV
DDL_CUPTR       TIQGLLEQLGVPYTGSGVLASALAMDKQATKRLWMTHGLATPRF----AMLHADTDFDAVVADLGLPLIV
DDLB_PSEPK      SMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQSLGIPTPRH----AVLASESDCLQASTELGFPLIV
DDL_PSEPG       SMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQSLGIPTPRH----AVLASESDCLQASTELGFPLIV
DDL_COPPD       KIQGLLSILHIPYVGSDVRASVITMDKYLTKLVALQSGIPTPSFIYVYDPHLVPDYWDVERKLGS-PFIV
DDL_ALHEH       VIQGALEALGVPYTGSGVLGCAIGMDKWRTKLLWRGAELPVP----PGALLRPETNRQALIGSVGLPLMI
DDL_BURXL       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGIPTPPFEAVLRGDDYEARAKEIVAKLGLPLFV
DDL_RHOFD       TVQGALELLGIPYTGSGVMASSIAIDKVMTKRIWRSEGLPTPEWRQVDSXXXXXXXXXXLGS----PMIV
DDL_SOLUE       TVQGLLELADLPYVGAGVLGSAVSMDKEMMKRVCKERMLPIVDY---VTVTRQTPSIVDACRRLPFPMFV
DDL_NATTJ       TVQGFLDLCGIPYVGSGVLGSSLAMDKVMMKKILRRHGLQVANYKRSEWEQDRDEIIFSIEKQLSYPIFV
DDLA_PSEAE      TLQALLDAGGFAYTGSGHLASAMAMDKDVAKRLFLAAGVETASW------LMAPASEEEVREQLGFPLVV
DDL_DESDG       LVQALLETAGVPYQGSGPAGSFLALNKAAAKEVFVRNGLPTPEW-----VFLPAHPGADWEPPFAFPAFI
DDL_CLOCE       TIQGLFELAGIPYVGCGVLGSAVGMDKAYTKIIFEKEGLPQGDYNRKQVYNRIEDVVAQIEGRLTYPCFV
DDL_AZOSE       TVQGLLELLKIPYTGSGVMASALAMDKWRTKMVWAACGLPTPRY----AILAGDTDWEAVVAELGLPIFV
DDL_LEPBL       SIQGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSKVAPFFEVEKLGYTNSPEETVIKLMSLGFPQFL
DDL_LEPBJ       SIQGFLRVLGVPYTGSGVAASALAMDKTRANQIFLQSKVAPFFEVEKLGYTNSPEETVIKLMSLGFPQFL
DDL_DESMR       LPQALLDAAGVPYQGSGPAGSFLALNKAASKQLFLEACLPTPRWTFVPRDAGTSARPDFP-----LPWFV
DDL_HALHL       TVQGLLDLLGIPYTGSGVLGSALGMDKWRCKRLWQGSGLPTP------AGQLLTGDRPVLDEGVGYPVIV
DDL_HALOH       KLQGFLDCLDIPYIGASVLSSAAGMDKEIMKNLFSYHKIPQARYRVYRQNHLENGLDGIISEIDRFPCFV
DDL_BORPD       TLQGALELLGLPYTGSGPMASSLSMDKIMTKRVWLQHGLRTPAF----EVLDAQAELRTVPDRLGLPLIL
DDL_THIDA       CMQGALELLGIPYTGSGVMASAVGMDKWRTKLLWRAAGLPTADW----AMLDATSDFAATEARLGLPIFV
DDL_RALEH       TIQGLLEQLGVPYTGSGVLASAMAMDKQATKRLWMTYGLATPRF----AMLHADTDFDAVAADLGLPLIV
DDL_PSEA6       SLQGALQQMNMPYTGTGVLGSALCMDKIRSKQVWQSLGLPTANYEIADKRDFNAANCSDIMSRLGDLVMV
DDL_LACSS       KVQAVLDVFEIPYTGSDTLAAGITMSKKVSKEILLFNNIPTARF------VAAYRHQPMPEMPFEYPVVV
DDL_PSYWF       XXXXXXXXXXXPQTGSGVLASAIGMDKVRTKQLWHGCGLSTAPFAVLGADTDWQQIVNTLG----LPLIV
DDL_CHLL2       RVQGLLDTMGIPYTGCGVSASAIAMDKALTKLCAADAGVATPSITLDADSYLADPEPVHELVDSTFPLFV
DDL_XYLFT       VVQGLMQAFGVPYTGSDVLGSALSMDKVRTKQVWLALGLPTPRY-ASLSVCATAVEVRKAVEMLGFPVII
DDL_XYLFA       VVQGLMQAFGVPYTGSDVLGSALSMDKVRTKQVWLALGLPTPRY-ASLSVCATAVEVRQAVEMLGFPVII
DDL_VESOH       YIQKQLENRGICYTGSDSNASHNSMDKARTKIIWEQHSLLAPSIIANIDQPINPINFP-------LPWAV
DDL_RUTMC       YIQKQLENRCIRYTGSDSNASHNGIDKARTKIIWKQHNLLAPSIVASIHKPIEPIDFP-------LPWMV
DDL_RALME       TMQGLLEQLGIPYTGSGVLASALAMDKQATKRLWMTHGLATPRF----AMLYANTDFDAVVADLGLPLIV
DDL_BURVG       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVLRGDDYAARATEIVAKLGLPLFV
DDL_POLSQ       TIQGLLELLELPYTGSGVLASALAIDKIATKQIWISNGLSTPEY----EELTAKSDWNAVVKHLGLPLIV
DDL_DIAST       TVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRADGLPTPDWRLVSSSAETAQAFQELGA----PMIV
DDL_ACISJ       TVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRADGLPTPDWRLVSSSAETAQAFQELGA----PMIV
DDL_DESVH       LVQAMLDTAGCPYQGSGPAGSFLALNKAVSKQLLRRHGILTPDW-----AFLAARPAADWEPGLGYPLFV
DDL_BURCJ       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLAARATDIVAKLGLPLFV
DDL_BORPE       TLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAF----EVLGGSTELRLVPDRLGLPLIL
DDL_BORBR       TLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAF----EVLGGSTELRLVPDRLGLPLIL
DDL_DESVV       LVQAMLDTAGCPYQGSGPAGSFLALNKAVSKQLLRRHGILTPDW-----AFLAARPAADWEPGLGYPLFV
DDL_BURM1       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRDDDYAARATEIVAKLGLPLFV
DDL_BURCM       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDYAARATDIVAKLGLPLFV
DDL_DESAD       LIQAMLNQVNCPYQGAEPESSFLTLNKAATKTVFDHHGILTPKWELVCAADGCKGLQDLEP-----PVFI
DDL_BORPA       TLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAF----EVLGGSTELRLVPDRLGLPLIL
DDL_BURPP       QIQGALDFYGIKYTGSGVLGSALGLDKFRTKLVWQQLGIPTPPFEAVLRGDDYEARSKEIVAKLGLPLFV
DDL_BURCC       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLAARATDIVAKLGLPLFV
DDL_THEPX       TIQGLLELLDMPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVYGKEIEDLEAIKKKIEHLGYPCFV
DDL_THEP3       TIQGLLELLDMPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVYGKEIEDLEAIKKKIEHLGYPCFV
DDL_BURTA       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAKDIVAKLGMPLFV
DDL_BURA4       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDYAARATDIVAKLGLPLFV
DDL_BURCH       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLAARATDIVAKLGLPLFV
DDL_BURCA       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPPFETVMRGDDLAARATDIVAKLGLPLFV
DDL_CALS8       TVQGLLELSGIPYVGCGVLSSALCMDKAFAKKLALLEGIPQGHFLVIYKDEYLSKKEYFIRRIESYPVFV
DDL_DELAS       TVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRFEGLPTPDWRLVASAGETRAALQALGA----PMIV
DDL_BURPS       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_BURP6       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIAAKLGVPLFV
DDL_BURP1       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_BURP0       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_BURMS       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_BURMA       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_BURM9       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_BURM7       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPPFETVMRGDDYAARAQDIVAKLGVPLFV
DDL_METCA       VLQGALACLRVPCTGSGVLASALSMDKLRTKLCWTGAGLPTPPW----LRLDSPDDLERCRQALGFPVIV
DDL_CLOAB       TIQGLCKLVGVPCVGPSVLSSSVCMDKVYTKYVLEHFNIKQADYHAHEYKTSXXXXXXXXXXXLGYAVFI
DDL_BDEBA       TIQGLFKMVQLPFVGCGVWSSAAGMDKEIMKRLLAVAKIPNARYLLLTPHQKNDYNEIVKELGS--PFFI
DDL_ANATD       TVQGLLELSGIPYVGCGVLSSAICMDKAFAKKLALLEGIPQGHFLVVYKNEYSAKKDYFIRRIESYPVFV
DDL_BUCBP       TIQSVLKYLNIPFTGSKTLPSAISINKFKTKLLWQSFNLPVVPYLHINKHEXXXXXXXXXXXXISLPIIV
DDL_LACPL       TLQGLFKLLKKPYVGSGVLASAASFDKDITKQILTHHHIQNTKYVVVTPENRDQMTYAYLQAHVGDHLFI
DDL_DESPS       TIQGFLDLLGIPYQGSGVLGSALAMDKDLAKEFYYNAEL--PVADWHTIAAGDFFYSEELIEDLGLPLVV
DDL_STRTD       SIQGFLETLKLPYVGTNVLSSSVAMDKIMTKRILEVAGVPQVAYTGYIEGEDLEAAVAETLEKLTFPVFV
DDL_STRT2       SIQGFLETLKLPYVGTNVLSSSVAMDKIMTKRILEVAGVPQVAYTVYIEGEDLEAAVAETLEKLTFPVFV
DDL_STRT1       SIQGFLETLKLPYVGTNVLSSSVAMDKIMTKRILEVAGVPQVAYTVYIEGEDLEAAVAETLEKLTFPVFV
DDL_STRMU       SIQGFLEVLKMPYVGTNILSSSVAMDKITTNQV-LESATTIPQYVALIEGEPLESKLAEVEEKLIYPVFV
DDL_BURP8       QIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGIPTPPFEAVLRGDDYAARAQGIVAKLGLPLFV
DDL_OCEIH       SLQGMLRMANIPFVGSSVLGSAISMDKDIAKRLLKDAGLKVAKGYAYRSVDKESIHFDSLKEELGLPMFI
DDL_CHLPD       RIQGLLDTFGIPYTGCGVLASAVAMDKALTKLCVTEAGIATPGITILSSEYFADPKSTQKSIEEQFPVFV
DDL_AZOSB       TVQGALELMGIPYTGSGVMASALAMDKWRTKMVWLSCGLPTPRY----AILDADSDFDAIARDLGLPIFV
DDL_ACIAC       TVQGALELLGIPYTGPGVMASAIAMDKIMTKRIWRFEGLPTPDWRLVSSAAETAQALEDLGS----PMIV
DDL_LACCB       KVQAVFDINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKRDQGPKQTVPFD-----FPVVV
DDL_LACC3       KVQAVFDINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKRDQGPKQTVPFD-----FPVVV
DDLB_CLOTE      TIQGLCKLVGLPCVGPGVLSSALCMDKIYTKYVLENFKFKQANYXXXXXXXXXXXXXXXXXXXLQYDVFI
DDLB_BACCR      TVQGLLELMNIPYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYIRSAWEKNREEAYSKVEDKLGYPCFV
DDL_PETMO       RLPSLLEILGIDYTCSNPETCIATYDKFIFYSLF-KNYIQMPQ---------TTLTNKLILPPFEYPFII
DDL_LEPBP       RIQGFLDTLGIPHTGSGVLASSLAMDKYRANILFEAMGIPVAPFLELEKGKTDPRKTLLNLSFS-YPVFI
DDL_LEPBA       RIQGFLDTLGIPHTGSGVLASSLAMDKYRANILFEAMGIPVAPFLELEKGKTDPRKTLLNLSFS-YPVFI
DDL_LAWIP       ILQALLERVGCPYQGASPAGSXXXXXXXXXXXXFRREGLLTPK-----SVFLPLKPEVTWEPGLNYPIFV
DDL_DICNV       EIQAILQWLGIPYTGSRVLACALAMDKVVCKKVWLADVLVTPESRFETLVEQLHCQDF----------VI
DDL_STRU0       SIQGFLEILKMPYVGTNILSSSVAMDKITTKRVLESAGIPQVNYTVYIEGNDLEDCITETLETLSFPIFV
DDL_STRPZ       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPM       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPG       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPD       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPC       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPB       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRP8       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRP6       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRP3       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRP1       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPF       SIQGFLEVLRMPYIGTNVMSSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFV
DDL_STRPN       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STRZJ       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STRR6       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STRPJ       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STRP2       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STREM       SIQGFLEVLKMPYVGTNILSSSVAMDKITTKRVLESADIPQVAYTVYIEGQDLDRCLAETEAVLSYPVFV
DDL_FLAPJ       HLQSYWELIDIPYTGCNFYQSALTFNKRDTLSVLTKFNI--PKAKSIYLRKGDVIDGNEIKKALGLPFFV
DDL_STRE4       SIQGFLEVLKMPYVGTNILSSSVAMDKITTKRVLESAGIPQVAYTVYIEGQDLDRCLAETEAVLSYPVFV
DDL_WIGBR       AFQGLFNTIYTPFVGSNVLSSSICMDKDISKRILSTFGIVVPSITLYYEXXXXXXXXXXXXXX--FPCCI
DDL_STRZP       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFA
DDL_STRP4       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_CHLPB       KIQGLLEVFAIPYTGCNVQSSSMTMDKEITKLCAVQMTVLRPDYLNNRSAIAETIKKRFAP-----PFFV
DDL_DESDA       LVQAMLDQVGCPYQGAGPAGSFLALNKCAAKQIFRRAGLPTADW-----DFVPAFPGKDWQPRLPYPLFV
DDL_BACSK       SLQGMFRLANLPFVGSNVLGSAVSMDKDIAKRLLQGAGLHVASGLTFTRAAKETIDFESIADQLGLPLFI
DDL_STRPI       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEELTYPVFT
DDL_CHLT3       TVQGLLEMFDVAYVGSGVLASAITMDKAVAKICFEHAGLQVGEYLRREFEENRGSVVARAEKKLRYPMFV
DDL_STRPS       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STRS7       SIQGFLEVLRMPYVGTNILSSSVAMDKITTKRVLESAGIPQVAYTVYIEGQDLDRCLAETEAALSYPVFV
DDL_STRA5       SIQGFLEVLRMPYVGTNILSSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFV
DDL_STRA3       SIQGFLEVLRMPYVGTNILSSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFV
DDL_STRA1       SIQGFLEVLRMPYVGTNILSSSVAMDKITTKQVLATVGVPQVAYQTYFEGDDLEHAIKLSLETLSFPIFV
DDL_RALPJ       TIQGLLEQFGIPYTGSGVLASALAMDKEATKRQWQTHGLPTPDF----VMLHAGADWQAVADRLGLPLIV
DDL_TREDE       TIQGLFEMADLPYVGGDVMSTSISMDKEKTKMIWDYSGLIAIKRQDWDDPEKKKAILARAEKDLEYPLFI
DDL_STRZT       SVQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFT
DDL_STRGG       TLQGLLELSGVPYVGAGVLASAVGQDKEYMKRVFLSFGLPVGPYEVVRPREWDNDPAAARERIVDFPLFI
DDL_RALSO       TIQGLLEQFGIPYTGSGVLASALAMDKEATKRLWQTHSLPTPDF----VMLHAGADWQAVADRLGLPLIV
DDL_CLONN       TIQGLCKLLTIPCVGPGVMSSAVCMDKVYTKYVLENFGVKQADYNAHDYKNNKMDIISTIENKLGYDVFI
DDL_STRSV       SIQGFLEVLKMPYVGCNILSSGLAMDKITTKRVLESAGIAQVPYVALVDGEDLEQKIQEIEEKLTYPVFT
DDL_PROVI       RIQGFLDTVAIPYTGCGVTASALTMDKALSKLCVSEAGIAVAPVLAGDWEKSPEQILSSIPETLIYPVFV
DDL_STRGC       SIQGFLEVLKMPYVGCNILSSSLAMDKITTKRVLESAGIAQVPYVALVDGEDLEQKIQEIEEKLSYPVFT
DDL_LEGPL       CLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYSWHANASERQQFCHEVASEFGWPLFV
DDL_LACBA       TIQGLFRLLKKPFVGSGVLASAVSFDKDMTKQVLTAHGIRNTKYVVLTPDNRADFDYATIQSRLGDNVFI
DDL_THET2       TVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPSMVPFDP-------PFFV
DDL_CHLP8       KIQGCLDTFDIPYAGCGLTSSALSMDKALTKLCAADAGVEVAGFMSVTSADYAADPQAICNAVTEFPVFV
DDL_LEGPC       CLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYSWHANASERQQFCHEVASEFGWPLFV
DDL_LEGPA       CLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYSWHANASERQQFCHEVASEFGWPLFV
DDL_CHLCH       RMQGFLETCGIPYTGCGVLASALTMDKALTKAVAQGTNILSADYLANPNAVEASVEAQVS-----YPLFV
DDL_STRCO       TLQGLLELSGVPYVGAGVLASAVGQDKEYMKAVFTSYGLKVGPYAVIRPREWEQDRSGARKKIVDFPLFV
DDL_STRAW       TLQGLLELSGVPYVGAGVLASAVGQDKEYMKRVFTSFGLKVGPYVVIRPREWERDESAARRKIVDFPLFV
DDL_PROA2       KIQGLLDMFSVPYTGCGVHASAMTMDKETTKICAEHAGLHIAPYTTIRKLRYQQDPQQVVSVILELPFFV
DDL_LEGPH       CLQGLLELAGVAYVGCDVLSSAIGMDKDMARRLACINGLKSARYSWHANASERQQFCHEVASEFGWPLFV
DDLA_PSESM      ALQGLLRMLAVPFVGADVLASAACMDKDVTKRLLRDAGIAVAPF--MVLNRGEXXXXXXXXXXXXXPMFV
DDL_STAS1       TIQGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFAHRQLPYVSFLRSEYHKYEGNILKLVHDKLEYPVFV
DDL_STAES       TIQGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYENNIIKLVNDYPVFV
DDL_STAEQ       TIQGLFEVLDIPYVGNGVLAASSSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYENNIIKLVNDYPVFV
DDL_STAAW       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAT       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAS       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAN       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAM       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAE       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAC       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAAB       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAA9       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAA8       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAA3       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAA2       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_STAA1       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_MACCJ       TIQGLFEVLDIPYVGNGVLAASTSMDKLVMKQLFATRQLPYVSFLKSEYEAHKDNIISLVEGKLTYPVFV
DDL_PELPB       RIQGFLDTCNIPYTGCGVLASALTMDKALTKLCVADAGIVAPSITLLSAEYHADTEKVHSRIEEKFPFFV
DDL_BACCN       TVQGLLELMNIPYVGNGVLASAAGMDKVVMKNIFAEAGLNQAKYVRSVWEKNREEAYEKVEEALGYPCFV
DDL_STAAR       TIQGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDYPVFV
DDL_FINM2       TIQGFIKVLDLPFVGCNVLGSALCMDKGYTNDIFELNKIPQAKYVVLCKNDDYNLKEIFEKTSK--AVYV
DDLA_CHRVO      SLQGLLRMANIPFVGAGVLGSAVCMDKDVAKRLLRDAGLKVAPFVSLTRSKAAGADLSAIVEQLGLPLFV
DDL_ENTHR       TIQGFLETLNLPYVGAGVLTSACAMDKIMTKYILQAAGVPQVPYVPVLKNQWKENPKKIFDQCEGYPMFV
DDL_GEOKA       TVQGLLEILNIPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDWQKRGETVYDRIERYPCFV
DDL_DEIGD       TIQGLLTLAGIPFVGSGVLGSAVSMDKVMTKQVLASVGMVAWRLAVRREWQERPQEVRARAGELGYPLFV
DDL_STACT       TIQGLFEVLDLPYVGNGVLAASSTMDKLVMKQLFAHRQLPYVSFLRSEYEKYQSNILKLVKDKLEFPVFV
DDL_CORA7       TVQGLFELSGIPYVGAGVLASAVGMDKEFTKKLLVAEGLVAPQ----EVLTGEATLDDLQKERLGLPVFV
DDL_LACRD       TIQGLFKLLNKPYVGSNIAASAMSFDKDLTKKIISQAGIRNTPYVVVTPENQADYSWGRIEEKLGNLTFV
DDL_LACF3       TVQGLFRLLKKPYIGSGIASSAMSFDKDLTKRILNQAGIRNTKYLLVTPQNKDQYSWSRIKEELGDLVFV
DDL_FLAJ1       LMQAYFELIGLPQSSCDYYQSALTFNKSVLKPYGIKTAI------SYYLNKGDEINTAEIVKKVGLPCFV
DDL_VEREI       TVQGALELLGIAYTGSGVMASSMALDKTMSKRIWRSEGLPTPDWRLVTSGAEAGQALQTLGA----PMIV
DDL_GEOTN       TVQGLLEMLNLPYVGNGVLASAVGMDKVVMKNLFAQAGLRQAKYVSVTKYEWKKGGEAVYDRIEQYPCFV
DDL_LACLS       SIQGFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVGVPQVPYVAAFADENQAEIAQEVVEKLEFPVFV
DDL_LACLM       SIQGFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVGVPQVPYVAAFADENQVEIAQEVVEKLDFPVFV
DDL_AZOPC       LLQGYLDILNIPYSCCGVLSASITFNKETAKSILLKQRIISPE---------------RIIDKLGLPLIV
DDLA_SALTY      SLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGLPLFV
DDLA_SALTI      SLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGLPLFV
DDL_STAHJ       TIQGLFEVLDLPYVGNGVLAASSSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEGNIIKLVKDYPVFV
DDL_HERA2       TIQGVFEFANLPYVGCGVLAASVGMDKGLMKSAFAAAGLPQVPWQLVLRRDWQTQPEAVYERLEAYPMFV
DDL_CHLTE       KLQGCLDTFGIPYTGCGLTASALAMDKVLTKLCAMNAGIAVAEFTSCAYMANPLETIVEITKRFDWPLFV
DDL_BORAP       AIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFNIIVPGFRQYDYSLDKEEIKRNVKEVLGYPVIV
DDL_BAUCH       NLQGLLRMANLPFVGSTVLGSAVSMDKDIAKRLLRDADLEVTPSITLTRINRENFSYDQIITYLGSSLFV
DDLA_BRAJA      TVQGLLELADVAYVGSGVLASAVSMDKDVAKRLVAPYRVLTRK----AFVQDRVSSLAKAVEGLSLPVFV
DDL_BLOPB       ALQGLLCMMNLPFVGSNVLSSSVGMDKDVSKCLLRDAGLSVVPFRTVLAQDQHNIDFDYFVSIFGLPLFV
DDLA_SHIFL      SLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGLPLFV
DDLA_ECOLI      SLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGLPLFV
DDLA_ECOL6      SLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGLPLFV
DDLA_ECO57      SLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGLPLFV
DDL_BORBZ       AIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFDILVPGFRQHDYFLDKEEIKKNVKEVLGYPVIV
DDL_THET8       TVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEXXXXXXXXXXXXXX-----
DDL_LACLA       SIQGFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVGVPQVPYVAAFADENQGEIAQEVVEKLEFPVFV
DDL_PELLD       RVQGLLETLQVPCTGCGVLASXXXXXXXXXXXXXXXXXXXSVTVMSHAYRRDPEATHRLAVASLSFPMFV
DDL_GRAFK       LLQAYLELIGIPQTSCDYYQSALTFNKR--DLISVLRPYGIKAATNYFLNKDQEINTKEIVDKVGLPCFV
DDL_THEAB       SIQGMLEFLNVPYTGCGMYSSMYTMDKVITKLILKEKNIPVVDFLYTNKKNYTNDFLNHCKEVLEYPMIV
DDL_DEIRA       TIQGLLTLAGIPFVGSGVLGSAVSMDKVMTKQVLDSAGIVAWRLAVRREWQQTPDAVRARAAELGYPLFV
DDL_ARTAT       TIQGLLELSDTRYVGAGVLASAVGMDKHFMKVVFESAGLSVGPYVTDREWSTDAEAVRKRVDKLGFPVFV
DDL_BACLD       TIQGMLELLNVPYVGNGVLASSAGMDKVVMKHLFAQAGLDQAKYVSFLKKTWSQSKEECYAQVEGYPCFV
DDL_BORT9       AIQGFLKIMDIPCVGSGILGSAISINKYFCKLLLKSFNILVPGFKKYDYLLDKEGIKKDIKQSLDYPVIV
DDL_BACSU       TIQGMLELLNIPYVGNGVLASSAGMDKVVMKHLFAQVGLAQAKYLKKDWTRSPKESCEEVEQELGYPCFV
DDL_TREPS       TVQGLLEMLQVPYVGCGVCASALAMDKVKAKMLWQAAGLPVLPFVFFRKDAWRMHMQEFVAQLETYPLFV
DDL_TREPA       TVQGLLEMLQVPYVGCGVCASALAMDKVKAKMLWQAAGLPVLPFVFFRKDAWRMHMQEFVAQLETYPLFV
DDL_LISIN       TVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAQVPAVAVRLIDWKNYQXXXXXXXXXXXXYPVFV
DDL_BACA2       TIQGLLELLNVPYVGNGVLASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEKYPCFV
DDL_MICAN       TLQGLLTLMRVAFVGSGVLGSCLGMDKIAMKTAFVKYKAIT-RSQVWSNPCVFPQLCDQIAEEIGYPCFI
DDL_PROMT       VIQGLFKSTGKPFVGSGVLGSALGMDKIAMKSVFKSYNLPQVPYPDIQNNLYMKSIYEQINKIISYPCFI
DDL_PROMH       TLQGLLHMIDMPYVGPNIMSSAACMDKDITKRLLDDAGLAVAPFITLMAHQLNDISYNEVVEQLGLPLFI
DDL_PROM1       VIQGLFKSTGKPFVGSGVLGSALGMDKIAMKSVFKSYNLPQVPYADIQNNLYMKSIYEQINKIINYPCFI
DDL_BORBU       AIQGVLKVMDIPCVGAGIIGSAISSNKYFCKLLLKSFDILVPGFRQHDYFLDKEEIKRNVKEVLGYPVIV
DDL_BLOFL       SLQGLLRLMNLPYVGSDVLGSAICMDKDITKRLLRDSGLSITPFRTFLAHEKKKLKFLNFADMFGLPFFV
DDL_BACP2       TMQGLLELLNIPYVGNGVLASAAGMDKVMMKDVFAQAGLAQAKFNKKDYEKATPDSLEQVEQVLGYPCFV
DDLA_BRUSU      AVQGLAQVARVPLAGCGIPGSANALDKDIAKRLVNEAGLSTAK--SVTITREEVPAFSALEQALGLPIFI
DDL_CYAP7       TLQGLLTLMQVPYVGSGVLGSAVGMDKITMKTVFAKAGLPQVKYQIWSNPCIFPKLCDEIEETLNYPCFV
DDL_SYNY3       TVQGLFSLMQVPYVGSGVLGSCVGMDKLAMKMVFERAGLPQVNYMGVERGEIWSNPCVFPALCEKYPCFV
DDL_BORDL       AIQGFVKMMDIPCVGAGILGSAISINKYFCKVLLKSFNIPVVSFIGFKKDDYILNKEGIKEDINNYPVIV
DDL_TRIEI       TIQGLLKLMQVPFVGSGVLGSAMGMDKIAMKIAFVKYQVVT-RSQIWSNSCVFPKLCDDIETTLEYPCFV
DDL_BORRA       AIQGFVKMMDIPCVGAGILGSAISINKYFCKVLLKSFNIPVVSFIGFKKDDYILNKEGIKEDINNYPVIV
DDLA_XANCP      SLQGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDAGLEVAPFACFTRHTAAQADVQTLIAQFGLPLFV
DDL_PROM9       SIHGLLKFTNKPLVGCGILGSALGMDKILMKTIFSNLKIPQVNYEDLNNLEVXXXXXXXXXXXXXFPVFV
DDL_FRASC       TVQGLLEMAGLPYVGSGVFASAAAMDKQHMKALLRAAGLPVGSY---AVLRAGDTLTGADQERLGLPVFV
DDLA_BRUME      AVQGLAQVARVPLAGCGIPGSANALDKDIAKRLVNEAGLSTAK--SVTITREEVPAFSALEQALGLPIFI
VANA_ENTFC      SIQGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAF------WVINKDDRPVAATFTYPVFV
DDL_OENOB       TLAGLFRLMNIPYVGSGLRAHAISFDKVITKELMTVNGIRNTKYIVIFQNDKNKPDWDSVSKQLGEVVFV
DDLA_RHILO      SVQGYAEVADVAYVGCGILASAAAMDKDVAKRLLREAGLAVAR--SVTVLKGDVGSFQEIAGALGLPFFA
VANC_ENTGA      CIQGLLELMNLPYVGCHVAASALCMNKWLLHQLADTMGIASAPTLLLSRYENDPATIDRFIQDHGFPIFI
DDL_ANACE       CASGLLDILGLAYTHSRVAASSVGMDKVLTKHVLKSLGIDFPEF-----SVLTKEEVLSAKEVMPYPFVI
DDL_BORHD       AIQGFLKMMDIPCVGAGILGSAISINKYFCKLLLKSFNILVPGFRKYDYFLDKEGIKKDIKQSLNYPVIV
VANL_STRCO      ATQGLLELSGIPYVGCDVQSSALCMDKSLAYVVARSAGIATPDF------WTVTGDETIDPGRLTYPVFV
DDL_LISW6       TVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADPQVPAVAVRLIDWKNYQEEMVSEMEEVLTYPVFV
DDL_LISMO       TVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADPQVPAVAVRLIDWKNYQEEMVAEMEEVLTYPVFV
DDL_CYAP8       XXXXXXXXXXXPFVGSGVLGSAVGMDKIAMKMAFAQAGLPQVKYQIWSNPCVFPKLCDEIEQRLGYPCFV
DDL_BIFLI       TVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLGAAGIPTAPTVDARNFTAADVLAKIEDAGLTYPLFI
DDL_SYNP2       TLQGLLTLMEKPFVGSKVLGSAAGMDKLAMKMVFAQAGLAQVDYEVWSGPCVFPKVCDKIEAQLDYPMFV
DDL_LISMF       TVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADPQVPAVAVRLIDWKNYQAEMVAEMEEVLTYPVFV
DDL_SODGM       SVQGLLRVLNIPYAGPDVLGSAVCMDKDMTKRVLRDAGVPVTPSVTLLRTGDAAPDVDAIIGQLGLPLFI
DDL_RHOE4       TIQGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGL--PVGVQVVLRPGIATLTEEQKAELGLPVFV
MUDD_CHLMU      AMQGFLETIGKPYTGPSLVFAAIGMNKVLTKRFMSDLGIPVVPYTLKGWKQDQEKCLAQIKAAFSFPMFV
DDL_BORGA       AIQGVLKVMDIPCXXXXXXXXXXXXNKYFCKLLLKSFNILVPGFRQYDYFLDKEEVKRNVREALGYPVIV
DDL_BACFR       RLQGYFDMMRIPYSCCGVLAAAITYDKFVCNQVRISESLLLRQ--------GQAVSDEDVVEKIGLPCFI
DDL_NOCFA       TLQGMLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGL--PVGTQVVLRPGTATLTEEQRERLGLPVFV
DDL_CORU7       TIQGLFDLLGARYVGNGVLASAAGMDKEFTKKIAREAGIPT---GPEVVLHGRTELTDHERELLGLPVFV
DDL_ANAVT       TIQGLLTLMQTPFVGSGVLGSALGMDKIAMKMAFVKYKAVT-RAQIWSNPCVFPKLCDEIEASLGYPCFV
DDL_BIFLO       TVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLDAAGIPTAPTVDARNFTAADVLAEIEDAGLTYPLFV
DDL_LACS1       TVQGLFRLLNKPWIGSGVASSGVSFXXXXXXXXXXXNGIRNTKYVLVTPENKADYPYAKVAEELGETLFV
DDL_BIFLD       TVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLDAAGIPTAPTVDARNFTAADVLAEIEDAGLTYPLFV
DDL_PROMS       SIHGLLRFTKKPLVGCGIIGSALGMDKILMKIIFSNLKIPQVNYQDLNDEEVKNKLIHEILKKLNFPVFV
DDL_BACFN       RLQGYFDMIRIPYSCCGVLAAAITYDKFVCNQVRISESLLLRQ--------GQAVSDEDVVEKIGLPCFI
DDL_SYNP6       TIQGLLTLMQRPFVGSGVLGSALGMDKIAMKQAFAQASLPQVAYQVFSDPCRYTSLLEQIETELGYPCFV
DDL_SYNE7       TIQGLLTLMQRPFVGSGVLGSALGMDKIAMKQAFAQASLPQVAYQVFSDPCRYTSLLEQIETELGYPCFV
DDL_PROMP       AIHGLLKFTQKPIVGGGILGSALGMDKILMKKIFSHLEIPQVNYQDLSDDKVKNNLSVEIIEKLKLPVFV
DDL_PROM0       SIHGLIRFTKKPLVGCGIIGSALGMDKILMKTIFSNHKLPQVNYEDLNDKQVXXXXXXXXXXXXXFPVFV
DDL_CORJK       TVQGVLDLAGVRYVGNGVLASAAGMDKDFTKRLAREAGIPVGE---ELILFQPRELTAEEKERLGLPVFV
DDL_ARTS2       TIQGLLELSDTRYVGAGVLASAVGMDKHYMKVVFEAAGLQVGPYVTDRQWLTDPEAIRKRVDRLGYPVFV
DDLA_PSEPK      TIQGLAAMCGLPCVGSGVLGSAMAMDKDVTKRMVQSAGLVVVPWLAMNSMRPWEELVECLGSSTLF---V
DDL_ENTFA       TIQGFMETINMPYVGAGVLASANAMDKIMTK--YLLQTVGIPQVPFVPVLRSDWKGNPKEVFEKCYPVFV
DDL_THETN       TMQGLFQLANIPYVGSGVVGSATGMDKVIMKDIFKANNLPIVNYLRKEYEKNKEAMLDLIESKLKYPMFV
DDL_MYCGI       TIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLASAGL--PVGDHVVLRARDSTLSLQDRERLGLPVFV
DDL_HELMI       TIQGLFEAANVPYVGCGVLASACGMDKAIMKALFAQSDLPQLPYLRNRWESAREQVIDEVEDRLGYPCFV
DDL_TROWT       TIQGMLDLLDIPYVGSGVFASAAAMDKHYTKILCSHAGIVLPWYKGHAWHKNRDSFLKQISDRFTFPLFV
DDL_TROW8       TIQGMLDLLDIPYVGSGVFASAAAMDKHYTKILCSHAGIVLPWYKGHAWHKNRDSFLKQISDRFTFPLFV
DDL_SYNR3       TIQGLFSLMQRPFVGSGVLGSAVGMDKLAMKAAFSAAGLPQGPYRPVLASELVSNSQLLEELETQYPCFI
DDL_RHOOB       TIQGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGL--PIGFQVVLRPGTATLTDEQRSRLHLPVFV
DDL_COREF       TIQGMFALSDIPVVGPGVLSSAAGMDKEFTKKLMAAEGL---PIGREVILRDRAELTDAEKKLLGLPVFV
DDL_CORDI       TIQGLFELSGVPYVGTGVLSSACGMDKEFTKKLMAAEGLPVGK---EVILRGSETLTEEHKRELGLPVFV
DDL_ANASP       TIQGLLTLMQTPFVGSGVLGSALGMDKIAMKMAFVKYKAVT-RAQIWSNPCVFPKLCDEIEASLGYPCFV
DDL_MYCSM       TIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGL--PIGDQVVLRPGVETLDLEQRERLGLPVFV
DDL_MYCS2       TIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGL--PIGDQVVLRPGVETLDLEQRERLGLPVFV
DDL_ENTGA       TIQGFLETIGMPYVGAGVLTSACGMDKIMTKYILQAAGIPQVPYVPVLKNYWKENPKKVFEQCEGYPMFI
DDL_ARTCA       TIQGLLELSDTRYVGAGVLASAVGMDKHFMKVVFESAGLHVGPYVTDRQWQKDPEAVRKQVDRLGFPVFV
DDL_RHOSR       TIQGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGL--PIGFQVVLRPGTATLTDEQKSRLHLPVFV
DDL_KOCRD       TLQGMLELADLPYVGCGVAASAIGMDKHFMKLAFQAAGLEVGPYTVVHDRTWRTDPLGVREAVAEFPVFV
VANB_ENTFA      AIQGLFELSGIPYVGCDIQSSAACMDKSLAYILTKNAGIAVPEF------QMIEKGDKPEARTLTYPVFV
DDL_MYCBP       TIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAY--AVLRPPRSTLHRQECERLGLPVFV
DDL_MYCBO       TIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAY--AVLRPPRSTLHRQECERLGLPVFV
DDL_COXBU       AXXXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIVVDWHTLSPRDATEGVYQRLLDRWGTSELFV
DDL_COXBR       AXXXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIVVDWHTLSPRDATEGVYQRLLDRWGTSELFV
DDL_COXBN       AXXXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIVVDWHTLSPRDATEGVYQRLLDRWGTSELFV
DDL_COXB1       AXXXXXXXXXXPYVGANVQSSAVCMEKDLTKTVLRAGGIVVDWHTLSPRDATEGVYQRLLDRWGTSELFV
DDL_BACTN       RLQGYFDMMHIPYSCCGVLAAAITYDKFTCNQYLKAFGVRIAE--SLLLRQGQSVSDEDVMEKIGLPCFI
DDL_VIBHB       DIQSMFEIAGIPYLGCGPEASSNSFNKITSKLWYDAIGIPNTPYLFLTRNDEQAHEQALQAFDKWGKVFV
DDL_MYCTU       TIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAY--AVLRPPRSTLHRQECERLGLPVFV
DDL_MYCTA       TIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAY--AVLRPPRSTLHRQECERLGLPVFV
DDL_AERS4       DLQSFLELAGLPYLGCDAEASKICFNK-ISTKLWLSAGIPNTPYLFLTEQNDXXXXXXXXXXXXWGKVFI
DDL_PARD8       RLQGYFDMIGMPYSSCGMLVSALTFNKYVCNH-YLKDKIAASIHLFKGETITDEEVVTRLG----LPIFV
Y4SG_RHISN      FVPAMLEMAGVPYTGSSPLGHGLTDDKVISKTLMRDSGVPTPNF-------SIMRRGTESTDDLRFPVVV
MUDD_CHLTR      AMQGFLETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYTLAGWKQEQDKWLAHIVEAFSFPIFV
DDL_VIBCM       DIQSMLELAGIPYLGCGPEASANSFNKITSKLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFV
DDL_VIBCH       DIQSMLELAGIPYLGCGPEASANSFNKITSKLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFV
DDL_KINRD       TLQGLLELSDTRYVGSGVLASAAGMDKQVMKLLLAGQGLPVGPWTSFRARRWDTDRDGVVAEVEAYPVFV
DDLB_BRAJA      TVQGALELADVSFVGSSVTGSAVAMDKEVSKRLMRDAGLPVVPFLTTTASSRIEYAAAVAALGTP-DLFV
DDL_THEEB       TIQGLLELMQRPYVGSGVAASAIGMDKILMKTVFGAIGLPQVPYVALQRSDLWSDPCRYNHLCDRYPCFV
DDL_MYCVP       TIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLTAAGL--PVGDHVVLRPREATVSLEDRERLGLPVFV
DDL_BACV8       ILQGYFDLLGIPYSSCNVLVSAMTFNKFTCNQIRVAESLILRK--------GFEITDEEVINKIGLPCFI
DDL_MYCPA       TIQGLLELAGVPYVGAGVFASAAGMDKEFTKKLFAAEGLPIGDY--AVLRPSQSTLSLQDRERLGLPVFV
DDL_MYCA1       TIQGLLELAGVPYVGAGVFASAAGMDKEFTKKLFAAEGLPIGDY--AVLRPSQSTLSLQDRERLGLPVFV
DDL_VIBSL       DIQSLFEMAKIPYLGCGSEASNNSFNKITSKLWYDALGIPNTPYLFLSDNTEQAHAQATQAFESWGKVFV
DDL_VIBC3       DIQSMLELAGIPYLGCGPEASANSFNKITSKLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFV
DDL_BIFAA       TIQGLFEMMGVPYVGCGVLASAACMDKHYTKVLLAAAGIVAPGITLDARSFDKASEFKTDADAIMYPLFV
DDL_AERHH       DLQSFLELAGLPYLGCDAEASKICFNK-ISTKLWLSAGIPNTPYLFLTEQNDXXXXXXXXXXXXWGKVFI
DDL_LEUMM       TLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFV
DDL_LEUME       TLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNIVFV
DDL_BRASO       TVQGALELADVAYVGGRVLGSAAAMDKDVAKRL-LRDAGLPIVPFVTMTAASPVSYDDAARAVGSSELFV
DDL_BRASB       TMQGALELADVAYVGARVMGSAAAMDKDVAKRL-LRDAGLPIVPFVTMTAAAPVSYEDAVHAVGCSELFI
DDL_PROMA       SIQGFFQLTGKPYVGSGVLGSALGMDKIAMKAAFSAAGLPQVNYCEIHSIDLLDKKRLSYLIQKIYPCFI
DDL_MYCUA       TIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLWSAAGL--PIGPHAVLRPSRQSLDREELQRLGLPAYV
DDL_SYNS3       TVQGLFTLMGQPYVGSGVLGSAVGMDKLXXXXXXXXXGLPQVPYVGLNVADLNHPERQNKLVARIYPCFV
DDL_TOLAT       DIQSMLELIGLPYLGCGSEGSKLCFNKVSTKLWLSALDIPNTPFLFLSDNNEAAHAQAHTAFRNWGAVFV
DDL_SYNSC       TIQGLFQLTGKPFVGAGVLGSAVSMDKQAMKSAFSSAGLSQVPYVALHASELEDAKSRSALLDRIYPCFV
DDL_LACAC       VLQGLFRLMNKPFVGDDVLAAAATMDKEFTKILAQRVGVISIKRFEYDDKNNDKLNYEKVAEKLGHDMFV
DDL_LEUCK       TLQGLFKLLNKPYVGAPLRGHAVSFDKVLTKELLTVNNIRNTKYIVVDEKTAKTLTWAQVVKDLGDVVFV
DDL_CORGL       TVQGLFALSDIPVVGPGVLASAAGMDKEYTKKLMAAEGLPVGR---EVILRDRTELTEAEKNLLGLPVFV
DDL_LACDB       VLQGLFRLIDKPFVGVDVLAAAVTMDKEFTKGVPVAKWVSIKRYEYEDAKNQKLSYDWVSGQLGTSNLFV
DDL_LACDA       VLQGLFRLIDKPFVGVDVLAAAVTMDKEFTKGVPVAKWVSIKRYEYEDAKNQKLSYDWVSGQLGTSNLFV
DDL_CORGB       TVQGLFALSDIPVVGPGVLASAAGMDKEYTKKLMAAEGLPIGR---EVILRDRTELTEAEKNLLGLPVFV
DDL_SYNPX       TIQGLFELMQQPYVGAGVLGSAVSMDXXXXXXXXXXXXXXXVPYVCAQADELSDAARQEALLKRIYPCFI
DDL_PROM2       SIHGLLQYTRKPIVGCGILGSAIGMDKIMMKTIFSNLKIPQVNYEDLDDREVKKKVINEILKKLNFPFFV
DDL_NOSP7       TIQGLLTLMQVPFVGSGVLGSAMGMDKIAMKMTFEQAGLAQVKYKAITRAQVWSNPCVFPKLCDEYPAFV
DDL_BIFA0       TIQGLFEMMGVPYVGCGVLASAACMDKHYTKVLLRAAGIPTRHYDASDEFATDGEEFLRQVNEAGYPLFV
DDL_LACH4       VLQGLFRLMNKPFVGDDVLAAAVTMDKEFTKILAQRVGVITIKRFEYDDKNNDKLDYEKVAEKLGRDMFV
MUDD_CHLPN      TIQGFFEILGKPYAGPSLSLAATAMDKLLTKRIASAVGVPVVPYQPLNLCFWKRNPELCIQNLIEFPMIV
DDL_PROM5       AIHGLLKFTQKPLIGCGISGSAIGMDKILMKQIFSNLSILAIQNYDLSDDNVKDNLSVEIIEKLNLPVFV
DDL_PROMM       TVQGLFTLMGQPFVGSGVLGSALSMDKLXXXXXXXXXGLPQVPYAAVDAADLLETESRQGVAKHLYPCFV
DDL_PROM3       TVQGLFTLMGQPFVGSGVLGSALSMDKLXXXXXXXXXGLPQVPYFAVDAADLLDTESRQGVAKNLYPCFV
DDL_MYCSS       TIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEGL--PVGDHVVLRPGRANVTLDERERLGLPVFV
DDL_MYCSK       TIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEGL--PVGDHVVLRPGRANVTLDERERLGLPVFV
DDL_MYCSJ       TIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLVAEGL--PVGDHVVLRPGRANVTLDERERLGLPVFV
DDL_MYCLE       TIQGLLELARVPYVGAGVLASAAGMDKEFTKKLFAAEGL--PLSAYTVLRPLRPTLHRQECERLSLPVFV
DDL_SYNS9       TVQGLFQLMRQPFVGAGVLGSAVSMDKLAMKAAFAGAGLSQVPYVGLNASDLGDSARREHVLDRIYPCFV
DDL_VIBVU       DIQSLFELAGIPYLGCGPEASSNSFNKITSKLWYDAIGIPNTPYLFLTENNEESHQLSREAFDKWGKLFV
DDL_VIBF1       DIQSMLDMLSIPYLGCDAESSTNSFNKITSKLWYDALGIPNTPYLFLTENNEETHQSALAAFKQWGGLFV
DDL_VIBFM       DIQSMLDMLSIPYLGCDAESSTNSFNKITSKLWYDALGIPNTPYLFLTENNEETHQSALAAFKQWGGLFV
DDL_THEM4       TFQGMCEIFGIPYSGCNHFSSAFTMDKVVTXXXXXXXXISVVDF--EYTTEINEEFFKRCEKNLGYPMIV
MUDD_CHLCV      TLQGFLEIANKPYGGPSLLFSAISMDKIMTKRLAASVGVPVVPYQPLTLPTWKRTPELCMRRILEFPMFV
DDL_VIBVY       DIQSLFELAGIPYLGCGPEASSNSFNKITSKLWYDAIGIPNTPYLFLTENNEESHQLSREAFDKWGKLFV
DDL_ACAM1       TIQGLLQLMQVPYVGSGVLGSAAGMDKIAMKTVFAAAGLPQVKYQVWSDPCVFKQVCDRIDETIGYPNFV
DDL_PORGI       LLQGYLDMIGIPYNTGDTLVESLTFNKYVCNR-FLSGFGIRIADSMRLTGRDTQPDVADLIARMGLPLFV
DDL_VIBPA       DIQSLFEIAGIPYLGCGPEASSNSFNKITSKLWYDALDIPNTPYLFLTRNDEHAHRQAEQAFEKWGKVFV
DDL_SYNPW       TVQGLFTLMNKPFVGSGVLGSAVGMDKLXXXXXXXXXGLSQVPYMGLTAADLEDPERLEQLLTRVYPCFV
DDL_SHEPW       DIQSYFELINLPYFGCKAEASRNCFNKITAKMWFSALNIPNTPYLFLNEMSDVSIEQATNALVNWGSIFV
DDL_PORG3       LLQGYLDMIGIPYNTGDTLVESLTFNKYVCNR-FLSGFGIRIADSMRLTGRDTQPDVADLTARMGLPLFV
DDL_SULNB       KVASMMEFFNIPYISPRLEASAMSYNKLYTKFLAESLGVKTVPY-------EHLSKNGDRKISMEYPVII
DDL_CAMJE       KIAALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVGVKTLDYTILRKNQNSKEKLS-------FPCII
DDL_CAMJ8       KIAALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVGVKTLDYTMLRKNQNSKEKLS-------FPCII
DDL_SHEAM       DIQSWFNLIRLPYFGCGSEASSNCFNKITAKMWFSALGIPNTPYLYLDEPSNDAIARVEAAFDEWGSVFI
DDL_CAMJD       KIAALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVGVKTLDYTMLRKGQNSKEKLR-------FPCII
DDL_LACGA       CLQGLFRVLDKPFVGDDVLAAAVTMDKEMTKILAQRAKWIAVKRFEYNDPDNNKLDYEYVASQLGSDLFV
DDL_CAMJR       KIAALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVGVKTLDYTMVRKGQNSKEKLS-------FPCII
DDL_CAMJJ       KIAALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVGVKTLDYTMVRKGQNSKEKLS-------FPCII
DDL_SHESW       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLHQYDDEAISQAQTALANWGSIFI
DDL_SHEDO       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGVPNTPYIFLHQFDQEAIAQTQAAFDTWGSVFI
DDL_SHEPC       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLHQYDDEAISQAQTALANWGSIFI
DDL_CAMC1       KIAALFEFYGVKYIGPRLEASALSYNKELTKFLAQKAGVKALDY---------EMLTRQSEPKFHYPIIL
DDL_LACJO       CLQGLFRVLDKPFVGDDVLAAAVTMDKEMTKILAQRAKWIAVKRFEYNDPDNEKLDYEYVASQLGSDLFV
DDL_SHEHH       DIQSYFELINLPYFGCDSEASSNCFNKVTAKMWFSALGIRNTPYIFLNEFNQQAIEETERALEKWGSIFI
DDL_SHEFN       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGVPNTPYIFLHQLDDDAIKQTETAFDNWGSVFV
DDL_SHEB9       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFV
DDL_SHEB8       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFV
DDL_SHEB2       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQTALAQWGSIFV
DDL_METS4       TVQGALDLAGVPYVGSGVIGSAAAMDKDVAKRLMRDAGLPIVPYLVAGPRRGVAYTEAVEALESR-TLFV
DDL_WOLSU       KLASLLEFFRIPFIGPRIEASVMSFNKHLTKLYAKERGVKTLPY-------LLARKNEKREFGNEFPLIV
DDL_SHESR       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALENWGSIFV
DDL_SHEWM       DIQSYFDLIKLPFFGCDSESSSNCFNKVTAKMWFSALGVPNTPYIFLNELNQESIAQTKQALENWGSIFI
DDL_SHESA       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQYDDDAIAQTQAALENWGSIFV
DDL_SHESM       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALENWGSIFV
DDL_SHEON       DIQSYFNLIQLPYFGCESEASSNCFNKITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALEKWGSIFV
DDL_SHESH       DIQSYFELINLPYFGCDSEASRNCFNKVTAKMWFSALGIPNTPYIFLNEFNDDAISQTEQALETWGSVFI
DDL_SHEPA       DIQSYFELINLPYFGCDSESSSNCFNKVTAKMWFSALGIPNTPYIFLSEFNXXXXXXXXXXXXKWGSIFI
DDL_NITSB       KLASLLEFFEIDYIGPRIEGSVISYSKLLTKLYAKECGIEVLPYQLLRKQDKKIIDFE-------YPVII
DDL_SULDN       TIAAILDFFSIKYIGPRVDASVFSYDKRYTKWLCHARGVKCVE-------SQELSSSEHSNIKIAYPIIV
DDL_SHELP       DIQSYFELINLPYFGCDAEGSRNCFNKITAKMWFSALGIPNTPYLFLNQLDEQAIAQTTDALAKWGSVFV
DDL_HELHP       SVSALLDFYHLPFIGPRIESSVMSFNKVFTKIFAAQRGVKVLDY-------EILTRANPHLKHIAYPIIL
DDL_HELPS       KLASLLEFYRIAFIGPGIEASVLSYNKYLTK---LYAKDLGVKALDHVLLNEKNRANALNLIGFNFPFII
DDL_HELPJ       KLASLLEFYRIAFIGPRVEASVLSYNKYLTK---LYAKDLGVKALDYVLLNEKNRANALDLIGFNFPFIV
DDL_HELP2       KLASLLEFYRIAFIGPRIEASVLSYNKYLTK---LYAKDLGVKTLDYVLLNEKNRANALDLIKFNFPFIV
DDL_HELAH       KLASLLEFYRIAFIGSRVEASVLSYNKHLT-KLYAKNLGVKTLDCILLNEKNRANALDLIKPSFNFPFIV
DDL_HELPH       KLASLLEFYRIAFIGPRIEASVLSYNKYLTK---LYAKDLGIKTLDHVLLNEKNRANAMDLINFNFPFII
DDL_CAMLR       KIAALLDFYGIKYIGPRIEASVLSFNKALTKLYAQSVGVKTLDY-------KVLNLHKEQNVSLSFPCIL
CARB_CLOB8      -----------------------------------------------------------------FPVLV
CARB_CLOBL      -LANFLKEKNIPTLGTTADQIDMAEDREKFDELLEKLKIARPK----GKGIWSVEDGLEEAKKLGFPVLV
CARB_CLOBA      -----------------------------------------------------------------FPVLV
CARB_CLOBM      AIKLFLKEKNIPILGTTAGQIDMAEDREKFDELLEKLQISRPK----GKGIWSVEDGLEETKKLGFPVLV
CARB_CLOPS      -----------------------------------------------------------------FPILV
CARB_CLOPE      -----------------------------------------------------------------FPILV
CARB_CLOP1      -----------------------------------------------------------------FPILV
CARB_CLOBJ      AIKLANFLKEKNISTLGTTADQIDMDREKFDELLEKLKIARPK----GKGIWSVEDGLEEAKKLGFPVLV
CARB_NATTJ      -----------------------------------------------------------------YPLVV
CARB_CLOBB      -----------------------------------------------------------------FPVLV
CARB_HALOH      -----------------------------------------------------------------YPVLV
CARB_THEPX      -----------------------------------------------------------------FPLLV
CARB_THEP3      -----------------------------------------------------------------FPLLI
CARB_LACH4      -----------------------------------------------------------------YPVLV
CARB_LACDB      -----------------------------------------------------------------YPVLV
CARB_PYRFU      -----------------------------------------------------------------YPVIV
CARB_CLAM3      ----------------------------------------------------------------------
Y012_MYCGE      -----------------------------------------------------------------FPVIV
CARB_BACSU      -----------------------------------------------------------------YPVLV
CARB_THETN      -----------------------------------------------------------------FPLLV
CARB_LACJO      -----------------------------------------------------------------YPVLV
CARB_PELTS      -----------------------------------------------------------------YPVLV
CARB_CLOAB      -----------------------------------------------------------------YPVIV
CARY_BACSU      -----------------------------------------------------------------YPVLI
CARY_BACST      ----------------------------------------------------------------------
CARB_METAC      -----------------------------------------------------------------FPVLV
CARB_STRP3      -----------------------------------------------------------------FPVLV
CARB_STRU0      -----------------------------------------------------------------FPVLV
CARB_STRE4      -----------------------------------------------------------------FPVLV
CARB_FUSNN      -----------------------------------------------------------------YPVLV


                         +         .         .         .         .         *         .:210
query           KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
DDL_PELUB       KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
DDL_RHORT       KPLDQGSSVGVTIVSETNDLPFSRDDWPYGQVMVERFIPGRELTVGVMGDKALGVTEIVTDHRFYDYDAK
DDL_ZYMMO       KPVNEGSSVGVAIIDESPIRKDIDPWKNFKTLLAEPFIKGRELTVAVMGDKALAVTELCPNNGFYDYKAK
DDL_MAGSA       KPLNEGSSVGVFIVRDNQPSPLPDWPFDADEVLVESFIPGRELTAAVMGDRALGVLEITSDHGFYDYEAK
DDL_BARHE       KPVCEGSSLGVIIVKENESVPSLNVVGSEDTVIVEKYIPGRELTCAVMGNKALDVCEILPEKQFYDYDSK
DDL_MARMM       KPNAQGSSVGVHIANRPPAELGSTAWALGDEILIERYVPGRELTVAVMEDRALCVTEIKPNTTFYDYEAK
DDLB_RHILO      KPVNEGSSFGVVIVSEGQSVVGSSEWKYGDTVMVERYIHGRELTCAVMGDVALGVCEIIPTHSFYDYDSK
DDL_WOLWR       KPINEGSSIGVYIIFSHEDYLELKDNSSMEKMIVEEYIPGIELHTAVLLDEAIGTIEVRPKNKFYDYEAK
DDL_WOLPM       KPINEGSSIGVYIIFSHEDYLELKNNSSMEKMIVEEYIPGIELHTAVLLDEAIGTIEVRPKNKFYDYEAK
DDL_METRJ       KPIAEGSSVGVIIVDGRSHPPQILASEEWEQVLAEPYIAGRELTCGVMGDKALGVIEVKAATDWYDYDAK
DDL_METPB       KPIAEGSSMGVIIVREPQILASDEWVYG-EEVLAETYIAGRELTCAVLGDRALGVTEIKPSGEWYDFDAK
DDL_PARL1       KPVSEGSSVGVFIAELTSAEWNLG-----DEVMAERYIAGRELTCAVMGEEIFGVTEIIANTTFYDYEAK
DDL_RHISN       KPVREGSSFGVVIVKEDQSHPPQVITSSEDRVMVERYIAGRELTCGVMGDVALGVTEIIPQHAFYDYDSK
DDL_WOLPP       KPINEGSSIGVHMIFSHEDYLELKNNSSMEKMIIEEYIPGIELHTAVLLNEAIGTMEIRPKNKFYDYEAK
DDL_RICB8       KPFTQGSSIGVEVIFEEDDFNFANYDFPYDEVIIEKYIKGRELQVAILNGKALGALEIKLKNRFYDYETK
DDL_BEII9       KPLGEGSSFGVFIVREDQAYPPQELTRSDNRVLVESYIGGRELTCAVIGEKAHDVIEIKAGGGWYDYDAK
DDL_METEP       KPIAEGSSMGVIIVDERSHPPQILASDEWEEVLAETYVAGRELTCAVLGDRALGVTEIKPSGEWYDFDAK
DDL_METC4       KPIAEGSSMGVIIVDERSHPPQILASDEWEEVLAETYVAGRELTCAVLGDRALGVTEIKPSGEWYDFDAK
DDL_RICTY       KPLKQGSSIGVEVIFEEDDFHFIDYDFPYGEIIIEQYIQGQELQVALLNGKALGVLEIKLKNRFYDYETK
DDL_RICBR       KPFTQGSSIGVEVIFEEDDFNFANYDFPYDEVIIEKYIKGRELQVAILNGKALGALEIKLKNRFYDYETK
DDL_GEOSM       KPSREGSSVGVGIVDPSRMQAALDEAFRYSEILIEGFIDGREVQVGILDGKALGAIEIVPKGEFYDYEAK
DDL_BART1       KPVCEGSSFGVVIVQENEAVPPHNIGGSEDEVMVEKYIPGRELTCAVLGNEVLDVCEILPDQHFYDYDSK
DDL_METSB       KPLGEGSSFGVIIADQTHPPQELRDDWAYGDVLVERFVAGRELTCAVIGDKAYGVTEIRAADGWYDYDAK
DDL_SPHWW       KPVNEGSSVGVAIIKERDHRDSHGPWQTFATLLAEPFIRGRELTVAVLGNRALGVTELVPSSGFYDYEAK
DDL_RICFE       KPLTQGSSIGVEVIFEEDDFNFADYNFPYGQVIIEQYIKGRELQVAVLNGKALGALEIKLKNRFYDYETK
DDL_WOLTR       KPINEGSSIGVHITFSHEDYLKLKNMFSVDLMIIEEYIPGIELHTAVLLDEAAGTMEIRPKNKFYDYKAK
DDL_GEOUR       KPSQEGSSVGVSIVKKSEFAAAMKEAFRYDEILVEQFIKGSEVQVGILEDKALGAIEIVPKNEFYDFDAK
DDL_BARBK       KPIREGSSFGVVIVGSDETMPLHDIMNNEDEIMVEKYVPGRELTCAVLGDEVLDVCEIVPKEQFYDYDSK
DDL_SPHAL       KPVNEGSSVGVAIVRDDSNYGNLGPWQQFDRLLAEPFIKGRELTVAVLGDTALAVTELRVKSGFYDYDAK
DDL_XANP2       KPNAGGSSVGVFIVREDQAHPPQELTREDENLLAEEFIPGLELTCAVMGDKVLDVIEIESTQKFYDYESK
DDL_RICCK       KPITQGSSIGIEVIFEEDDFNFANYDFPYDQVIIEKYIKGRELQVAVLNGKALGVLEIKLKNRFYDYETK
DDL_GEOSL       KPSQEGSSVGVSIVKSPEELPSLELAFRYDDILVERFIKGREIQIGILDDRAMGAIEIVPVNEFYDFEAK
DDL_MESSB       KPVAEGSSFGVVIV-REGQSHPPQVLGSYGEVMVERYIPGRELTCAVMGDRVLGVCEIVPGHSFYDYDSK
DDL_SILST       KPNNEGSSVGIYIVEATNSPPQLSE-EMPAQVMVEAYAPGREMTVTVMGDRALCVTDILTDG-WYDYEAK
DDL_OLICO       KPVADGSSVGVFIVTEDQAHPPQELFRDDEELLVEKYIAGRELTCAVIKGEASDVIEIVPLLKFYDYEAK
DDL_GRABC       KPANEGSAVGVHILHEGDN-RRTEIARSWSQALVEEYIPGRELTVGVLNDRALTVTDIRPRSAFYDYESK
DDL_GEOBB       KPSREGSSVGVGIVDPSRMQAALDEAFRYSEILIEGFIDGREVQVGILNGKALGAIEIIPKGEFYDYEAK
DDL_PELCD       KPAREGSTIGISIVDEQELAAGLEEAFRHDDVLVEQFIAGAEVTVGVLDGQPLPIIQVVPKGGFYDYQSK
DDL_THELT       KPRKEGSSIGVHICDNSNQLYNSEELKKYNEMMIQRYIEGRELTVSILEPQILPVLELKPKRRFYDYTAK
DDL_RICRS       KPLTQGSSIGVEVIFAEDDFNFADYDFPYDQVIIEQYIKGRELQVAVLNGKALGALEIKLKNRFYDYETK
DDL_RICRO       KPLTQGSSIGVEVIFAEDDFNFADYDFPYDQVIIEQYIKGRELQVAVLNGKALGALEIKLKNRFYDYETK
DDL_OCHA4       KPVREGSSFGVVIVDQTHPPQIISSAENYGEVLVEKYIPGRELTCAVMGDRVMDVCEIIPGHQFYDYDSK
DDL_RHOPB       KPVADGSSVGVFMVTEAHEHPPQELFRDDEQLLVEKYVAGKELTCAVVKGEPTGVIEIVQTNKFYDYEAK
DDL_RICPR       KPLKQGSSIGVEVIFEEDDFNFTDYDFPYGEIIIEQYIQGQELQVALLNGKALGVLEIKLKNRFYDYETK
DDL_RICCN       KPLTQGSSIGVEVIFAEDDFNFADYDFPYDQVIIEQYIKGRELQVAVLNGKALGALEIKLKNRFYDYETK
DDL_RICAE       KPLTQGSSIGVEVIFAEDDFNFADYDFPYDQVIIEQYIKGRELQVAVLNGKALGALEIKLKNRFYDYETK
DDL_ERYLH       KPVNEGSSVGVIVTDESNYGNPIRPWQEFRELLAEPFIRGRELTTAVVGGQALAVTELKPKSGFYDFDAK
DDL_THEYD       KPAEEGSSIGVNIVKNEREFKNAEAFQFGKRVIIEKFIEGREIHIGVLGDKALGGVEVRPKKGFYSYEAK
DDL_RHOP5       KPVADGSSVGVYIITEQHQHPPQELFRDDDKLLVEKYVAGKELTCAVVKGEPTDVIEIVPMVRFYDYEAK
DDL_NOVAD       KPVNEGSSVGVAIVTEGNYGSPISAAQEFDQLLAEPFIRGRELTTAVIGDRALLVTELRPKSGFYDFDAK
DDL_AGRT5       KPVREGSSFGVVIV-KEDQSHPPQILTSSNQVMVERYIHGRELTCGVLDGEALGVTEVVPLHNFYDYDAK
DDL_RICM5       KPLTQGSSIGVEVIFAEDNFNFADYDFPYDQVIIEQYIKGRELQVAVLNGKALGVLEIKLKNRFYDYETK
DDL_HYPNA       KPVNEGSSFGVLIVEGANGPPHELTGPNWDYLMAEEYIPGRELTVAVLGDRALAVTEITTLRDYYDFDAK
DDL_CARHZ       KAPREGSTIGIFVFSKQELPKAIKVLEIDKQLLVEEFIEGVEVTASVLGNSNLPLIEIVSKTRFYDYEAK
DDL_RICAH       KPLTQGSSIGVEVIFEEDDFNFADYDFPYDQVVIERYIKGREFQVAVLNSKALGALEIKIKNRFYDYETK
DDL_RHOS5       KPNCEGSSVGVYIVQADANGPPRLAPDMPRDLMVETYIPGRELTVTVMGDRALAVTDIVTDG-WYDYDAK
DDL_AQUAE       KPVREGSSVGLKIVESLEELKELDLLKKTERVMVEEFVEGRDMTVGILKGEALPVVEIIPKKGVYDYECK
DDL_ANADF       KPAGEGSSVGVQIVDXXXXXXXXXXXXXYKDVVVERYVKGTEVNVAVLEGKALGAIEIAPANEFYDYAAK
DDL_SILPO       KPYNEGSSVGVYIVTEAANGPPVLAPDLPATLMVEEYVPGRELSTTVLGDRALNVTDIITDG-WYDYHAK
DDL_DINSH       KPYNEGSSVGVYLVPEGAEAAPELADDLPDTLMVEAFVPGRELTVTVQGDRALCVTDIVTEG-WYDYDAK
DDL_RHOS4       KPNAEGSSVGVYIVHEDANGPPQLAADMPQDLMVETYVPGRELTVTVMGDRVLAVTDILSDG-WYDYDAK
DDL_RHOS1       KPNAEGSSVGVYIVHEDANGPPQLAADMPQDLMVETYVPGRELTVTVMGDRVLAVTDILSDG-WYDYDAK
DDL_RICPU       KPLAQGSSIGVEVIFAEDDFNFADYDFPYDQVIIEQYIKGRELQVAVLNGKALGALEIKLKNRFYDYETK
DDL_PELPD       KPVQEGSSVGISIVEESQLAAAVKLFRHDDEILVEQFIKGQEVQVGILDDRPMGAIEIVSRNEFYDFEAK
DDL_THEP1       KPRREGSSIGVFICESDEEFQHAEDLPRYGSVIVQKYIPGREMTVSILETEKLPILELRPKRRFYDYVAK
DDL_RHIME       KPVREGSSFGVVIVKEDQSHPPQVITSSEDRVMVERYIAGREFTCGVMGDVALGVTEIIPQHAFYDYDSK
DDL_GEOLS       KPVQEGSSVGVTIVKKPEDLQAAEAFRYDTLVLVEKYIKGQEVQVGILANQPIGAIEIVPKNEFYDFEAK
DDL_THESQ       KPRREGSSIGVFVCESDEEFQHAEDLPRYGSVIVQKYIPGREMTVSILETEKLPVLELRPKRRFYDYVAK
DDL_THEMA       KPRREGSSIGVFVCESDEEFQHAEDLPRYGSVIVQKYIPGREMTVSILETEKLPVLELRPKRRFYDYVAK
DDL_FERNB       KPRKEGSSIGTHICSKEELLDALKEFKNYDEMIVQEYIKGKEITVSVIDINGLPILELRPKKLFYDYEAK
DDL_AZOC5       KPNTGGSSVGVFIVKEDQPHPPQELFRAGESLMAEPFIKGLELTCGVMGDRALDVIEVEAVHGFYDYESK
DDL_GLUOX       KPVAEGSSVGVEIV-RTGDNRRAEIARTWREALVESFIPGRELTAGVMGDRALAVTDILPSETFYDFEAK
DDL_BARQU       KPLCEGSSFGVVIVKENESAPPRNVVGAEDEVIVEKYIPGREFTCAVLGNEALDVCEIFPDKQFYNYDSK
DDL_SINMW       KPVREGSSFGVVIVKEDQSHPPQVITSSDDRIMVERYVAGREFTCGVMGDVALGVTEIIPQHAFYDYDSK
DDLB_BRUME      KPVREGSSFGVVIVKEDQPHPPQVIWKYGDEVMVEGYIAGRELTCAVMGDRAMDVCEIMPGYQFYDYDSK
DDL_JANSC       KPNNEGSSVGVYLVNEAANGPPHLSDDMPDEVMVETYAPGRELTVSVLGDADPGALTVTDTDGWYDYDAK
DDLB_BRUSU      KPVREGSSFGVVIVKEDQPHPPQVIWKYGDEVMVEGYIAGRELTCAVMGDRAMDVCEIIPGYQFYDYDSK
DDL_CAUSK       KPNAEGSSVGVLVFEGANGPPRQLAAPDWEQVMVEPYIPGLELAVAVVGERALAVTEIRSSTGFYDYDAK
DDL_ROSDO       KPNNEGSSVGVYLVHEAANGPPQLSEDMPQEVMVEAFAPGRELTTTVVGDRALTVTDIVTDG-WYDYDAK
DDL_FRATN       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_ANASK       KPAGEGSSVGVHLVNEAAELGPADAASHAGDVIVERYVKGTEVDVAVLDGKALGAIEIVPANAFYDYAAK
DDL_ANAD2       KPAGEGSSVGVHLVNEAAELGPADAASHAGDVIVERYVKGTEVDVAVLDGKALGAIEIVPANAFYDYAAK
DDL_ACICJ       KPVNEGSSVGVFILREGDNRRAARAWRHGSVAMTEEYVPGRELTVSVLEDRALAVTEIRAEG-FYDYTAK
DDL_FRATT       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_FRATO       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_FRATF       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_FRAT1       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_FRATW       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_GLOVI       KPADGGSTVGVTIAREAGHLEAVRLALQYSQVLIEQYIPGQEITVALLDGLVLPAIEIVPQRDFYDYEAK
DDL_FRATH       KPSSGGSSIATFKVKSIQELKHYEEASKYGEVMIEQWVTGKEITVAIVNDEVYSSVWIEPQNEFYDYESK
DDL_SYNJA       KPSNSGSTVGISLADEVSLAQGLALASSVSRVFLERYIPGKEITLSILSGQVLPAIEIIPAQDFYDYEAK
DDL_ANADE       KPAGEGSSVGVHLVNAAAELPACRDAAGYGDVIVERYVKGTEVDVAVLEGKALGAIEIVPANAFYDYAAK
DDL_CAUCR       KPNAEGSSVGVFIIKEANRPPEEVGAPSWTEVMVEPYIQGMELAVAVLGERALAVTDIRASTGFYDYEAK
DDL_FRAP2       KPSSGGSSIATFKVKSLEELENYQQASKHGEVMIEQWVTGKEITVAIVNNDVYSSVWIEPLNEFYDYESK
DDL_SYNWW       KPATQGSSVGTSIVRKKNIVPALELALSLDEILVEKFIAGTELTVTVLNLKTLPVIEIVPKNEYYDYESK
DDL_SYNJB       KPSNNGSTVGISIVDERSFAQGLELARSVSRIFLERYVPGKEITLSILSGQVLPAIEIIPAQDFYDYEAK
DDL_DESAP       KAPTQGSSIGVYIVEREEDLETDAVAYGGTRVLVEKFIAGPELTAAVLGNRELPLIEIVSATGKYDYESK
DDL_COLP3       KPANEGSSIGMAQAKTIAQLRNIEAFGFDTQVLLEAWIDGPEYTVTILGDKALPAIHMETPREFYDYEAK
DDL_PECCP       KPSREGSSVGM---SKVNTLSELEAFRHDDDILVEKWLSGPEYTVAILGDEVLPSIRIQPAGTFYDYEAK
DDL_MAGSM       KPLDSGSSVGIRAVGKDELIRGVKALSVSHRCMVERAIEGRELTLSILDGEAFPLIEIVPIDGFYDYDHK
DDL_HAEIN       KPSLEGSSVGL---TKVKAVEELKALKFDNTILIEEWLAGDELTVPVLDNQVLPAIRIVPEGEFYDYEAK
DDL_BUCAP       KPNNAGSSIGITIVNHPDLLDSINLAFNYNNIIIEKFLKGTEYTVSILNKKVLPPIKIITKNNFYDYSSK
DDL_HAEDU       KPSSEGSSVGVFVKTKEELLPAITAALEFDTILVEEFLTGAEYSVPVLDGEVLPAVQIIPDGEFYDYHAK
DDL_ALCBS       KPAHEGSSIGMAKADNTEELGEALVAKFDQDVLVEAWVNGPEYTVAVLGDEALPAIRLQTPHVFYDFEAK
DDL_HAEI8       KPSLEGSSVGL---TKVKAVEELKALKFDNTILIEEWLAGDELTVPVLDNQVLPAIRIVPEGEFYDYEAK
DDLB_CLOPE      KPNNGGSSVATFKVYKKEDIKNMEGLKYDEEVIIESFIKGREITCPIFNGELFPILEIKSKADFYDYKQK
DDL_HAEIG       KPSLEGSSVGL---TKVKAVEELKALKFDNTILIEEWLAGDELTVPVLDNQVLPAIRIVPEGEFYDYEAK
DDL_FUSNN       KPVDEGSSKGLFLCN--NXXXXXXXXXXXXXPIIEDYIIGEELTVGVLNGEALGVLKIIPQADLYDYDSK
DDL_CLOB8       KPTHGGSSVATFIVKEEKEIENCEAFKWDSEVMIEKFIKGDEITCPVYNNKMLPVIAIKPKAEFFDFTSK
DDLB_ECOLI      KPSREGSSVGMSKVVAENALQDALRLAFQHEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAK
DDLB_ECO57      KPSREGSSVGMSKVVAENALQDALRLAFQHEVLIEKWLSGPEFTVAILGEEILPSVRIQPSGTFYDYEAK
DDL_HAEIE       KPSLEGSSVGL---TKVKAVEELKALKFDNTILIEEWLAGDELTVSVLDNQVLPAIRIVPEGEFYDYEAK
DDL_ACTPJ       KPSSEGSSVGV---TKVKTVEQLEALKFDSIVLVEAFLAGKEYSVPVLDGQVLPAVQIIPEGEFYDYHAK
DDL_ACTP7       KPSSEGSSVGV---TKVKTVEQLEALKFDSIVLVEAFLAGKEYSVPVLDGQVLPAVQIIPEGEFYDYHAK
DDL_ACTP2       KPSSEGSSVGV---TKVKTVEQLEALKFDSIVLVEAFLAGKEYSVPVLDGQVLPAVQIIPEGEFYDYHAK
DDLB_SHIFL      KPSREGSSVGMSKVVAENALQDALRLAFQHEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAK
DDL_CLOBA       KPTHGGSSVATFIIKEEKDIKDIEGFKWDSEVIIEKFIKGDEITCPVFGDKMLPVVAIKPKAEFFDFTAK
DDL_ACTSZ       KPSREGSSVGLTKVDSADKLKSALALKFDDIVLIEEWLSGDELTVPVLGDEVLPAVQIVPEGEFYDYNAK
DDL_PASMU       KPSLEGSSVGLTKVKRVEDLKSAVALKYDDTVLIEEWLSGAEFTVPVLDNEVLPSIRIVPEGEFYDYEAK
DDL_SACD2       KPAHEGSSIGMSVVSTAQELKAAKAAHYDAKVLVERRIVGREFTVAVLNGVALPAIGLKTDHVFYDYDAK
DDL_PELTS       KAPTQGSTIGMFVHKEEDMAGALELAYDYDPVLVEQFIRGTEVTASILGNEALPLIEIVSATGVYDYKAK
DDL_MANSM       KPSREGSSVGLTKVNAVEELKNALALTHDDTVLIEEWLSGIEMTVPVLDDQVLPAVQIIPEGEFYDYDAK
DDL_BACAN       KPNSGGSSVGVKIVDKDELISMLETVFEWSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAK
DDL_BACAC       KPNSGGSSVGVKIVDKDELISMLETVFEWSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAK
DDL_BACAA       KPNSGGSSVGVKIVDKDELISMLETVFEWSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAK
DDLA_CLOTE      KPNSGGSSIGITIVKKQELIKAIEAFKFDEEILIEEYIKGEEITCCMLDGKPLPILSIKTKEEFFNYKAK
DDL_PSEHT       KPSHEGSSIGMAQASTPQELEDANAFKFDSQVLVEQWISGREFTITVLGDEVLPVIEMTTPNGFYDYQAK
DDL_DESRM       KANTQGSTIGIFVHVKEKMAEAIEALKYDQDVLVEQFVAGTEVTASVLGNNSLPLIEITSVTGVYDYQSK
DDL_CLOBL       KPNSGGSSVATLVKDKEGIKEAVELALKYDEVMIENYTKGEEITCCMLNGKMLPVLAIRPHAEFFDYTAK
DDL_CLOBB       KPTHGGSSVATFIIKEEKDIKNTEAFKWDSEVIIEKFIKGDEITCPVFGDKMLPVVAIKPKAEFFDFTAK
DDL_BACHD       KPNQEGSTIGLTVAXXXXXXXXXXAFRHDDTILIEEFIAGTEVTVAVLGNKSLPVVEIVPKNKLYDYESK
DDL_METPP       KPPREG