[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ20908.1

[Show Plain Result]


## Summary of Sequence Search
    1::611
    1::611       0.0 100%  611 aa  UVRC_PELUB RecName: Full=UvrABC system protein C;       
   26::651     e-163  49%  653 aa  UVRC_MESSB RecName: Full=UvrABC system protein C;       
   34::660     e-160  49%  661 aa  UVRC_BARHE RecName: Full=UvrABC system protein C;       
   57::687     e-157  48%  688 aa  UVRC_RHILO RecName: Full=UvrABC system protein C;       
   54::677     e-157  49%  681 aa  UVRC_AGRT5 RecName: Full=UvrABC system protein C;       
   74::691     e-157  48%  695 aa  UVRC_RHOPS RecName: Full=UvrABC system protein C;       
   52::676     e-156  49%  680 aa  UVRC_RHIL3 RecName: Full=UvrABC system protein C;       
   27::632     e-156  49%  635 aa  UVRC_SILST RecName: Full=UvrABC system protein C;       
   14::621     e-156  47%  623 aa  UVRC_RHOS4 RecName: Full=UvrABC system protein C;       
   27::631     e-156  45%  645 aa  UVRC_GLUOX RecName: Full=UvrABC system protein C;       
   74::691     e-155  48%  695 aa  UVRC_RHOP2 RecName: Full=UvrABC system protein C;       
   21::629     e-155  48%  631 aa  UVRC_JANSC RecName: Full=UvrABC system protein C;       
    9::626     e-155  47%  627 aa  UVRC_BRUAB RecName: Full=UvrABC system protein C;       
   51::675     e-154  49%  679 aa  UVRC_RHIEC RecName: Full=UvrABC system protein C;       
   35::633     e-154  47%  633 aa  UVRC_MARMM RecName: Full=UvrABC system protein C;       
    4::610     e-154  47%  611 aa  UVRC_BRUME RecName: Full=UvrABC system protein C;       
    4::610     e-154  47%  611 aa  UVRC_BRUA2 RecName: Full=UvrABC system protein C;       
    4::610     e-153  47%  611 aa  UVRC_BRUSU RecName: Full=UvrABC system protein C;       
   14::621     e-153  45%  624 aa  UVRC_MAGSA RecName: Full=UvrABC system protein C;       
   29::636     e-152  48%  639 aa  UVRC_RHORT RecName: Full=UvrABC system protein C;       
   48::660     e-152  46%  664 aa  UVRC_ZYMMO RecName: Full=UvrABC system protein C;       
   29::638     e-150  46%  644 aa  UVRC_GRABC RecName: Full=UvrABC system protein C;       
   78::695     e-150  46%  699 aa  UVRC_RHOPB RecName: Full=UvrABC system protein C;       
   51::670     e-150  47%  674 aa  UVRC_RHIME RecName: Full=UvrABC system protein C;       
   78::700     e-150  47%  704 aa  UVRC_RHOPA RecName: Full=UvrABC system protein C;       
   51::677     e-150  47%  678 aa  UVRC_BARQU RecName: Full=UvrABC system protein C;       
   15::622     e-149  48%  623 aa  UVRC_SILPO RecName: Full=UvrABC system protein C;       
   34::641     e-147  46%  644 aa  UVRC_SPHAL RecName: Full=UvrABC system protein C;       
   68::682     e-147  47%  686 aa  UVRC_BRAJA RecName: Full=UvrABC system protein C;       
   68::686     e-144  46%  690 aa  UVRC_NITHX RecName: Full=UvrABC system protein C;       
    3::612     e-144  46%  614 aa  UVRC_HYPNA RecName: Full=UvrABC system protein C;       
   47::655     e-141  45%  658 aa  UVRC_NOVAD RecName: Full=UvrABC system protein C;       
   22::639     e-137  42%  640 aa  UVRC_CAUCR RecName: Full=UvrABC system protein C;       
   69::685     e-136  44%  689 aa  UVRC_NITWN RecName: Full=UvrABC system protein C;       
    7::615     e-125  43%  626 aa  UVRC_RICTY RecName: Full=UvrABC system protein C;       
    7::618     e-123  42%  626 aa  UVRC_RICPR RecName: Full=UvrABC system protein C;       
    7::634     e-123  41%  635 aa  UVRC_RICBR RecName: Full=UvrABC system protein C;       
   18::610     e-122  39%  613 aa  UVRC_THICR RecName: Full=UvrABC system protein C;       
    6::593     e-121  44%  605 aa  UVRC_WOLWR RecName: Full=UvrABC system protein C;       
    6::596     e-120  43%  605 aa  UVRC_WOLPM RecName: Full=UvrABC system protein C;       
   18::605     e-119  39%  607 aa  UVRC_PSE14 RecName: Full=UvrABC system protein C;       
   17::598     e-119  39%  599 aa  UVRC_NITOC RecName: Full=UvrABC system protein C;       
   18::605     e-118  39%  607 aa  UVRC_PSEU2 RecName: Full=UvrABC system protein C;       
   18::605     e-118  39%  607 aa  UVRC_PSEFS RecName: Full=UvrABC system protein C;       
    6::593     e-118  43%  605 aa  UVRC_WOLPP RecName: Full=UvrABC system protein C;       
   16::599     e-118  39%  599 aa  UVRC_METFK RecName: Full=UvrABC system protein C;       
   18::605     e-118  39%  607 aa  UVRC_PSEPW RecName: Full=UvrABC system protein C;       
   10::598     e-117  41%  606 aa  UVRC_WOLTR RecName: Full=UvrABC system protein C;       
    7::636     e-117  41%  639 aa  UVRC_RICPU RecName: Full=UvrABC system protein C;       
    7::636     e-117  41%  639 aa  UVRC_RICAE RecName: Full=UvrABC system protein C;       
   18::605     e-117  39%  607 aa  UVRC_PSEPK RecName: Full=UvrABC system protein C;       
    7::636     e-117  41%  639 aa  UVRC_RICCN RecName: Full=UvrABC system protein C;       
    7::636     e-117  41%  639 aa  UVRC_RICRS RecName: Full=UvrABC system protein C;       
    7::636     e-117  41%  639 aa  UVRC_RICRO RecName: Full=UvrABC system protein C;       
   18::605     e-117  41%  607 aa  UVRC_PSESM RecName: Full=UvrABC system protein C;       
   18::605     e-117  39%  607 aa  UVRC_PSEE4 RecName: Full=UvrABC system protein C;       
   18::605     e-116  39%  607 aa  UVRC_PSEP1 RecName: Full=UvrABC system protein C;       
   11::605     e-116  38%  607 aa  UVRC_PSEPF RecName: Full=UvrABC system protein C;       
   19::610     e-115  39%  612 aa  UVRC_SACD2 RecName: Full=UvrABC system protein C;       
    1::637     e-115  40%  638 aa  UVRC_RICCK RecName: Full=UvrABC system protein C;       
   18::605     e-115  41%  607 aa  UVRC_PSEF5 RecName: Full=UvrABC system protein C;       
   14::617     e-115  39%  618 aa  UVRC_LEGPL RecName: Full=UvrABC system protein C;       
   17::607     e-115  36%  611 aa  UVRC_ALHEH RecName: Full=UvrABC system protein C;       
   14::617     e-115  38%  618 aa  UVRC_LEGPC RecName: Full=UvrABC system protein C;       
   14::617     e-114  38%  618 aa  UVRC_LEGPH RecName: Full=UvrABC system protein C;       
   15::600     e-114  39%  604 aa  UVRC_NITEC RecName: Full=UvrABC system protein C;       
   18::605     e-114  41%  607 aa  UVRC_PSEFL RecName: Full=UvrABC system protein C;       
   20::617     e-114  38%  617 aa  UVRC_NEIMA RecName: Full=UvrABC system protein C;       
   11::605     e-114  37%  609 aa  UVRC_SHEPA RecName: Full=UvrABC system protein C;       
   14::617     e-114  38%  618 aa  UVRC_LEGPA RecName: Full=UvrABC system protein C;       
   20::617     e-113  37%  617 aa  UVRC_NEIG1 RecName: Full=UvrABC system protein C;       
   14::608     e-113  39%  613 aa  UVRC_ANAMM RecName: Full=UvrABC system protein C;       
    9::599     e-112  39%  599 aa  UVRC_ACIBY RecName: Full=UvrABC system protein C;       
    9::599     e-112  39%  599 aa  UVRC_ACIBS RecName: Full=UvrABC system protein C;       
   18::605     e-112  38%  607 aa  UVRC_PSEMY RecName: Full=UvrABC system protein C;       
   16::606     e-112  38%  606 aa  UVRC_NITMU RecName: Full=UvrABC system protein C;       
   20::617     e-111  37%  617 aa  UVRC_NEIMB RecName: Full=UvrABC system protein C;       
   18::606     e-110  36%  608 aa  UVRC_PSEAE RecName: Full=UvrABC system protein C;       
   18::606     e-110  36%  608 aa  UVRC_PSEAB RecName: Full=UvrABC system protein C;       
   18::606     e-110  36%  608 aa  UVRC_PSEA8 RecName: Full=UvrABC system protein C;       
   16::611     e-110  38%  616 aa  UVRC_PHOPR RecName: Full=UvrABC system protein C;       
    9::650     e-110  40%  651 aa  UVRC_RICAH RecName: Full=UvrABC system protein C;       
   11::605     e-109  36%  609 aa  UVRC_SHEHH RecName: Full=UvrABC system protein C;       
   11::603     e-109  38%  608 aa  UVRC_ACTSZ RecName: Full=UvrABC system protein C;       
    7::640     e-109  39%  642 aa  UVRC_RICFE RecName: Full=UvrABC system protein C;       
   18::606     e-109  36%  608 aa  UVRC_PSEA7 RecName: Full=UvrABC system protein C;       
    9::599     e-109  39%  599 aa  UVRC_ACIAD RecName: Full=UvrABC system protein C;       
    5::603     e-109  38%  609 aa  UVRC_HAEI8 RecName: Full=UvrABC system protein C;       
   20::612     e-109  37%  612 aa  UVRC_HAHCH RecName: Full=UvrABC system protein C;       
   10::607     e-109  34%  610 aa  UVRC_METCA RecName: Full=UvrABC system protein C;       
    4::612     e-109  37%  612 aa  UVRC_EUBE2 RecName: Full=UvrABC system protein C;       
    5::603     e-108  38%  609 aa  UVRC_HAEIE RecName: Full=UvrABC system protein C;       
   23::611     e-108  35%  612 aa  UVRC_IDILO RecName: Full=UvrABC system protein C;       
   18::605     e-108  37%  607 aa  UVRC_AZOVD RecName: Full=UvrABC system protein C;       
   11::605     e-108  36%  609 aa  UVRC_SHEPW RecName: Full=UvrABC system protein C;       
    4::621     e-107  36%  621 aa  UVRC_ALKOO RecName: Full=UvrABC system protein C;       
   16::607     e-107  36%  608 aa  UVRC_PSEA6 RecName: Full=UvrABC system protein C;       
   11::605     e-106  36%  610 aa  UVRC_VIBPA RecName: Full=UvrABC system protein C;       
   11::603     e-106  38%  609 aa  UVRC_HAES1 RecName: Full=UvrABC system protein C;       
    5::603     e-106  38%  609 aa  UVRC_HAEIN RecName: Full=UvrABC system protein C;       
   11::605     e-106  37%  610 aa  UVRC_ACTPJ RecName: Full=UvrABC system protein C;       
   11::603     e-106  38%  609 aa  UVRC_HAES2 RecName: Full=UvrABC system protein C;       
   11::605     e-105  37%  610 aa  UVRC_ACTP7 RecName: Full=UvrABC system protein C;       
   26::638     e-105  36%  639 aa  UVRC_COLP3 RecName: Full=UvrABC system protein C;       
   10::605     e-105  38%  607 aa  UVRC_PSEHT RecName: Full=UvrABC system protein C;       
   15::600     e-105  38%  604 aa  UVRC_NITEU RecName: Full=UvrABC system protein C;       
   11::605     e-105  37%  610 aa  UVRC_ACTP2 RecName: Full=UvrABC system protein C;       
    9::603     e-105  39%  603 aa  UVRC_DECAR RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOK1 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOUT RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO45 RecName: Full=UvrABC system protein C;       
   27::607     e-104  41%  614 aa  UVRC_ANAPZ RecName: Full=UvrABC system protein C;       
   11::606     e-104  36%  610 aa  UVRC_YERPS RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_SHISS RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOSM RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOSE RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOLU RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOLI RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOL6 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOHS RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECODH RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOBW RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO8A RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO81 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO7I RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO5E RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO57 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO55 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO27 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECO24 RecName: Full=UvrABC system protein C;       
   14::607     e-104  35%  607 aa  UVRC_BORA1 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ECOLC RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_VIBVY RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_VIBVU RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_SHIB3 RecName: Full=UvrABC system protein C;       
   11::606     e-104  36%  610 aa  UVRC_YERPN RecName: Full=UvrABC system protein C;       
   11::606     e-104  36%  610 aa  UVRC_YERPE RecName: Full=UvrABC system protein C;       
   11::606     e-104  36%  610 aa  UVRC_YERPA RecName: Full=UvrABC system protein C;       
   11::606     e-104  36%  610 aa  UVRC_YERP3 RecName: Full=UvrABC system protein C;       
   11::605     e-104  36%  610 aa  UVRC_ESCF3 RecName: Full=UvrABC system protein C;       
   11::605     e-104  35%  610 aa  UVRC_CITK8 RecName: Full=UvrABC system protein C;       
   11::605     e-103  35%  609 aa  UVRC_SHESH RecName: Full=UvrABC system protein C;       
   11::606     e-103  35%  610 aa  UVRC_SODGM RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALTY RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALPB RecName: Full=UvrABC system protein C;       
    4::603     e-103  36%  607 aa  UVRC_DEHSB RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALTI RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALNS RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALA4 RecName: Full=UvrABC system protein C;       
   22::605     e-103  37%  607 aa  UVRC_DICNV RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALSV RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALPK RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALPC RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALPA RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALHS RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALCH RecName: Full=UvrABC system protein C;       
   11::606     e-103  36%  610 aa  UVRC_YERE8 RecName: Full=UvrABC system protein C;       
   11::605     e-103  35%  609 aa  UVRC_SHELP RecName: Full=UvrABC system protein C;       
   11::605     e-103  36%  610 aa  UVRC_SALDC RecName: Full=UvrABC system protein C;       
   11::605     e-102  36%  610 aa  UVRC_SALG2 RecName: Full=UvrABC system protein C;       
    4::603     e-102  36%  607 aa  UVRC_DEHSC RecName: Full=UvrABC system protein C;       
   11::605     e-102  36%  610 aa  UVRC_SALEP RecName: Full=UvrABC system protein C;       
   11::606     e-102  35%  610 aa  UVRC_PHOLL RecName: Full=UvrABC system protein C;       
    4::603     e-102  37%  607 aa  UVRC_DEHE1 RecName: Full=UvrABC system protein C;       
    6::605     e-102  35%  610 aa  UVRC_PARUW RecName: Full=UvrABC system protein C;       
    7::617     e-101  35%  623 aa  UVRC_CLOAB RecName: Full=UvrABC system protein C;       
   21::607     e-101  36%  621 aa  UVRC_XYLF2 RecName: Full=UvrABC system protein C;       
   21::607     e-101  36%  621 aa  UVRC_XYLFT RecName: Full=UvrABC system protein C;       
   15::606     e-101  34%  607 aa  UVRC_ALCBS RecName: Full=UvrABC system protein C;       
    4::623     e-101  37%  625 aa  UVRC_CLOTH RecName: Full=UvrABC system protein C;       
   21::605     e-100  34%  618 aa  UVRC_XANOR RecName: Full=UvrABC system protein C;       
   21::605     e-100  34%  618 aa  UVRC_XANOP RecName: Full=UvrABC system protein C;       
   21::605     e-100  34%  618 aa  UVRC_XANOM RecName: Full=UvrABC system protein C;       
   11::605     e-100  35%  610 aa  UVRC_ERWT9 RecName: Full=UvrABC system protein C;       
   21::607     e-100  36%  621 aa  UVRC_XYLFA RecName: Full=UvrABC system protein C;       
   11::605     e-100  34%  610 aa  UVRC_KLEP3 RecName: Full=UvrABC system protein C;       
   12::618     e-100  38%  618 aa  UVRC_JANMA RecName: Full=UvrABC system protein C;       
    3::598     e-100  36%  598 aa  UVRC_THIDA RecName: Full=UvrABC system protein C;       
   24::614     e-100  36%  614 aa  UVRC_PSYCK RecName: Full=UvrABC system protein C;       
   20::618     e-100  38%  618 aa  UVRC_HERAR RecName: Full=UvrABC system protein C;       
   13::610     e-100  35%  612 aa  UVRC_HAEDU RecName: Full=UvrABC system protein C;       
   14::605      e-99  33%  610 aa  UVRC_SHEFN RecName: Full=UvrABC system protein C;       
   14::608      e-99  35%  609 aa  UVRC_BORPA RecName: Full=UvrABC system protein C;       
   14::608      e-99  35%  609 aa  UVRC_BORBR RecName: Full=UvrABC system protein C;       
   10::606     1e-99  35%  609 aa  UVRC_COXB1 RecName: Full=UvrABC system protein C;       
   14::608     1e-99  35%  609 aa  UVRC_BORPE RecName: Full=UvrABC system protein C;       
    7::617     2e-99  36%  622 aa  UVRC_CLOTE RecName: Full=UvrABC system protein C;       
   11::605     2e-99  34%  609 aa  UVRC_SHEPC RecName: Full=UvrABC system protein C;       
   11::606     2e-99  35%  610 aa  UVRC_PROMH RecName: Full=UvrABC system protein C;       
   11::605     4e-99  34%  609 aa  UVRC_SHEB9 RecName: Full=UvrABC system protein C;       
   10::606     4e-99  35%  609 aa  UVRC_COXBR RecName: Full=UvrABC system protein C;       
   10::606     4e-99  34%  609 aa  UVRC_COXBN RecName: Full=UvrABC system protein C;       
   10::606     5e-99  35%  609 aa  UVRC_COXB2 RecName: Full=UvrABC system protein C;       
   11::605     8e-99  34%  609 aa  UVRC_SHEB8 RecName: Full=UvrABC system protein C;       
   11::606     8e-99  34%  610 aa  UVRC_ERWCT RecName: Full=UvrABC system protein C;       
   11::605     1e-98  34%  609 aa  UVRC_SHESW RecName: Full=UvrABC system protein C;       
   10::606     1e-98  34%  609 aa  UVRC_COXBU RecName: Full=UvrABC system protein C;       
   16::604     2e-98  33%  608 aa  UVRC_PASMU RecName: Full=UvrABC system protein C;       
    4::597     3e-98  36%  603 aa  UVRC_DESAA RecName: Full=UvrABC system protein C;       
    7::617     3e-98  37%  618 aa  UVRC_CLOBH RecName: Full=UvrABC system protein C;       
    7::617     3e-98  37%  618 aa  UVRC_CLOB1 RecName: Full=UvrABC system protein C;       
   11::605     4e-98  34%  609 aa  UVRC_SHESA RecName: Full=UvrABC system protein C;       
    7::617     4e-98  37%  618 aa  UVRC_CLOBM RecName: Full=UvrABC system protein C;       
   13::601     4e-98  35%  608 aa  UVRC_ALISL RecName: Full=UvrABC system protein C;       
   11::605     5e-98  34%  609 aa  UVRC_SHEB5 RecName: Full=UvrABC system protein C;       
    7::617     5e-98  37%  618 aa  UVRC_CLOBK RecName: Full=UvrABC system protein C;       
    7::617     5e-98  37%  618 aa  UVRC_CLOBJ RecName: Full=UvrABC system protein C;       
   11::605     7e-98  34%  609 aa  UVRC_SHESM RecName: Full=UvrABC system protein C;       
    5::590     7e-98  40%  598 aa  UVRC_ENTFA RecName: Full=UvrABC system protein C;       
    4::613     7e-98  33%  613 aa  UVRC_CLOCE RecName: Full=UvrABC system protein C;       
    7::617     7e-98  37%  618 aa  UVRC_CLOBL RecName: Full=UvrABC system protein C;       
    5::607     1e-97  37%  608 aa  UVRC_MANSM RecName: Full=UvrABC system protein C;       
    4::602     1e-97  35%  605 aa  UVRC_CLOD6 RecName: Full=UvrABC system protein C;       
    5::586     1e-97  37%  590 aa  UVRC_BACSU RecName: Full=UvrABC system protein C;       
   11::605     2e-97  34%  609 aa  UVRC_SHESR RecName: Full=UvrABC system protein C;       
    4::608     2e-97  36%  608 aa  UVRC_FINM2 RecName: Full=UvrABC system protein C;       
    6::618     2e-97  34%  628 aa  UVRC_CLOPH RecName: Full=UvrABC system protein C;       
   11::605     2e-97  35%  610 aa  UVRC_EDWI9 RecName: Full=UvrABC system protein C;       
   11::575     6e-97  35%  575 aa  UVRC_SHIDS RecName: Full=UvrABC system protein C;       
    1::587     6e-97  37%  603 aa  UVRC_LISMH RecName: Full=UvrABC system protein C;       
    1::587     6e-97  37%  603 aa  UVRC_LISMF RecName: Full=UvrABC system protein C;       
    1::587     6e-97  37%  603 aa  UVRC_LISMC RecName: Full=UvrABC system protein C;       
    9::603     6e-97  36%  604 aa  UVRC_CHRSD RecName: Full=UvrABC system protein C;       
    1::587     8e-97  37%  603 aa  UVRC_LISIN RecName: Full=UvrABC system protein C;       
    5::587     8e-97  40%  594 aa  UVRC_BACAN RecName: Full=UvrABC system protein C;       
    5::587     8e-97  40%  594 aa  UVRC_BACAC RecName: Full=UvrABC system protein C;       
    5::587     8e-97  40%  594 aa  UVRC_BACAA RecName: Full=UvrABC system protein C;       
    7::617     1e-96  37%  618 aa  UVRC_CLOB6 RecName: Full=UvrABC system protein C;       
    5::587     1e-96  40%  594 aa  UVRC_BACHK RecName: Full=UvrABC system protein C;       
    5::587     1e-96  40%  594 aa  UVRC_BACCZ RecName: Full=UvrABC system protein C;       
    5::587     1e-96  40%  594 aa  UVRC_BACC3 RecName: Full=UvrABC system protein C;       
    5::587     1e-96  40%  594 aa  UVRC_BACC0 RecName: Full=UvrABC system protein C;       
    5::587     1e-96  40%  594 aa  UVRC_BACAH RecName: Full=UvrABC system protein C;       
   11::605     1e-96  33%  609 aa  UVRC_SHEON RecName: Full=UvrABC system protein C;       
    1::587     1e-96  37%  603 aa  UVRC_LISW6 RecName: Full=UvrABC system protein C;       
    5::587     2e-96  39%  594 aa  UVRC_BACC1 RecName: Full=UvrABC system protein C;       
   11::602     2e-96  35%  602 aa  UVRC_AZOSE RecName: Full=UvrABC system protein C;       
    4::621     2e-96  33%  622 aa  UVRC_ALKMQ RecName: Full=UvrABC system protein C;       
   21::605     2e-96  33%  619 aa  UVRC_XANC5 RecName: Full=UvrABC system protein C;       
    1::587     2e-96  37%  603 aa  UVRC_LISMO RecName: Full=UvrABC system protein C;       
    5::587     2e-96  40%  594 aa  UVRC_BACC7 RecName: Full=UvrABC system protein C;       
   11::605     3e-96  34%  610 aa  UVRC_ENTS8 RecName: Full=UvrABC system protein C;       
   21::605     4e-96  33%  619 aa  UVRC_XANAC RecName: Full=UvrABC system protein C;       
    9::614     4e-96  35%  630 aa  UVRC_BDEBA RecName: Full=UvrABC system protein C;       
   11::606     5e-96  34%  610 aa  UVRC_SERP5 RecName: Full=UvrABC system protein C;       
   24::614     7e-96  35%  614 aa  UVRC_PSYA2 RecName: Full=UvrABC system protein C;       
    5::587     7e-96  39%  594 aa  UVRC_BACCQ RecName: Full=UvrABC system protein C;       
   13::604     1e-95  34%  609 aa  UVRC_SHEDO RecName: Full=UvrABC system protein C;       
    9::601     1e-95  34%  601 aa  UVRC_CHRVO RecName: Full=UvrABC system protein C;       
    6::617     3e-95  35%  622 aa  UVRC_CLOK5 RecName: Full=UvrABC system protein C;       
    5::587     3e-95  39%  594 aa  UVRC_BACC2 RecName: Full=UvrABC system protein C;       
   21::605     4e-95  33%  614 aa  UVRC_STRMK RecName: Full=UvrABC system protein C;       
    5::587     4e-95  39%  594 aa  UVRC_BACC4 RecName: Full=UvrABC system protein C;       
   21::605     7e-95  33%  614 aa  UVRC_STRM5 RecName: Full=UvrABC system protein C;       
   10::603     1e-94  35%  608 aa  UVRC_VIBF1 RecName: Full=UvrABC system protein C;       
   30::654     1e-94  36%  654 aa  UVRC_RALSO RecName: Full=UvrABC system protein C;       
   21::605     2e-94  33%  618 aa  UVRC_XANCP RecName: Full=UvrABC system protein C;       
   21::605     2e-94  33%  618 aa  UVRC_XANC8 RecName: Full=UvrABC system protein C;       
    5::587     2e-94  39%  594 aa  UVRC_BACWK RecName: Full=UvrABC system protein C;       
    5::587     2e-94  39%  594 aa  UVRC_BACCR RecName: Full=UvrABC system protein C;       
    5::590     6e-94  36%  590 aa  UVRC_GEOKA RecName: Full=UvrABC system protein C;       
   21::605     8e-94  33%  618 aa  UVRC_XANCB RecName: Full=UvrABC system protein C;       
    5::593     2e-93  40%  593 aa  UVRC_STAAB RecName: Full=UvrABC system protein C;       
    5::593     2e-93  40%  593 aa  UVRC_STAAU RecName: Full=UvrABC system protein C;       
    5::593     2e-93  40%  593 aa  UVRC_STAAR RecName: Full=UvrABC system protein C;       
    5::617     3e-93  34%  621 aa  UVRC_CLOB8 RecName: Full=UvrABC system protein C;       
   11::605     4e-93  33%  610 aa  UVRC_VIBCM RecName: Full=UvrABC system protein C;       
   11::605     4e-93  33%  610 aa  UVRC_VIBCH RecName: Full=UvrABC system protein C;       
   11::605     4e-93  33%  610 aa  UVRC_VIBC3 RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAAT RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAAN RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAAM RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAAE RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAAC RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAA9 RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAA8 RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAA3 RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAA2 RecName: Full=UvrABC system protein C;       
    5::593     4e-93  39%  593 aa  UVRC_STAA1 RecName: Full=UvrABC system protein C;       
    5::593     5e-93  39%  593 aa  UVRC_STAAW RecName: Full=UvrABC system protein C;       
    5::593     5e-93  39%  593 aa  UVRC_STAAS RecName: Full=UvrABC system protein C;       
   24::614     1e-92  34%  614 aa  UVRC_PSYWF RecName: Full=UvrABC system protein C;       
    7::618     2e-92  34%  621 aa  UVRC_CLONN RecName: Full=UvrABC system protein C;       
    3::620     6e-92  33%  629 aa  UVRC_SYMTH RecName: Full=UvrABC system protein C;       
    2::587     6e-92  39%  595 aa  UVRC_STACT RecName: Full=UvrABC system protein C;       
    8::589     1e-91  39%  594 aa  UVRC_STAEQ RecName: Full=UvrABC system protein C;       
   29::655     1e-91  35%  656 aa  UVRC_PROMP RecName: Full=UvrABC system protein C;       
   15::614     2e-91  36%  617 aa  UVRC_THETN RecName: Full=UvrABC system protein C;       
   23::612     2e-91  35%  612 aa  UVRC_FRAP2 RecName: Full=UvrABC system protein C;       
    5::586     3e-91  35%  596 aa  UVRC_OCEIH RecName: Full=UvrABC system protein C;       
    8::589     4e-91  39%  594 aa  UVRC_STAES RecName: Full=UvrABC system protein C;       
   10::623     4e-91  37%  627 aa  UVRC_ANASP RecName: Full=UvrABC system protein C;       
   30::663     5e-91  35%  663 aa  UVRC_RALEJ RecName: Full=UvrABC system protein C;       
    3::596     5e-91  33%  613 aa  UVRC_MOOTA RecName: Full=UvrABC system protein C;       
   10::600     8e-91  36%  607 aa  UVRC_CARHZ RecName: Full=UvrABC system protein C;       
    6::586     2e-90  39%  596 aa  UVRC_STAHJ RecName: Full=UvrABC system protein C;       
   14::642     4e-90  35%  672 aa  UVRC_PROAC RecName: Full=UvrABC system protein C;       
   14::674     4e-90  35%  674 aa  UVRC_BURM1 RecName: Full=UvrABC system protein C;       
    2::589     5e-90  39%  595 aa  UVRC_STAS1 RecName: Full=UvrABC system protein C;       
    5::584     5e-90  36%  590 aa  UVRC_BACLD RecName: Full=UvrABC system protein C;       
   19::611     7e-90  34%  628 aa  UVRC_GLOVI RecName: Full=UvrABC system protein C;       
   15::622     2e-89  35%  622 aa  UVRC_TRIEI RecName: Full=UvrABC system protein C;       
    3::590     2e-89  36%  591 aa  UVRC_STRU0 RecName: Full=UvrABC system protein C;       
   17::623     4e-89  36%  625 aa  UVRC_NOSP7 RecName: Full=UvrABC system protein C;       
    7::597     4e-89  33%  607 aa  UVRC_DESPS RecName: Full=UvrABC system protein C;       
    5::660     4e-89  34%  716 aa  UVRC_ANADF RecName: Full=UvrABC system protein C;       
   23::612     5e-89  34%  612 aa  UVRC_FRATM RecName: Full=UvrABC system protein C;       
   15::623     8e-89  33%  625 aa  UVRC_MICAN RecName: Full=UvrABC system protein C;       
    7::618     8e-89  33%  620 aa  UVRC_CLOPS RecName: Full=UvrABC system protein C;       
    1::607     1e-88  32%  618 aa  UVRC_SYNAS RecName: Full=UvrABC system protein C;       
   14::677     1e-88  36%  677 aa  UVRC_BURS3 RecName: Full=UvrABC system protein C;       
   31::673     2e-88  35%  673 aa  UVRC_RALME RecName: Full=UvrABC system protein C;       
   23::612     2e-88  34%  612 aa  UVRC_FRATN RecName: Full=UvrABC system protein C;       
   23::612     3e-88  34%  612 aa  UVRC_FRATO RecName: Full=UvrABC system protein C;       
   23::612     3e-88  34%  612 aa  UVRC_FRATF RecName: Full=UvrABC system protein C;       
   23::612     4e-88  34%  612 aa  UVRC_FRATH RecName: Full=UvrABC system protein C;       
   23::612     5e-88  34%  612 aa  UVRC_FRATW RecName: Full=UvrABC system protein C;       
    5::652     5e-88  35%  707 aa  UVRC_ANASK RecName: Full=UvrABC system protein C;       
   14::681     9e-88  35%  681 aa  UVRC_BURCH RecName: Full=UvrABC system protein C;       
   14::681     9e-88  35%  681 aa  UVRC_BURCA RecName: Full=UvrABC system protein C;       
   10::623     1e-87  36%  627 aa  UVRC_ANAVT RecName: Full=UvrABC system protein C;       
   14::682     2e-87  35%  682 aa  UVRC_BURCC RecName: Full=UvrABC system protein C;       
    3::590     3e-87  37%  596 aa  UVRC_LYSSC RecName: Full=UvrABC system protein C;       
    1::598     3e-87  33%  601 aa  UVRC_SYNWW RecName: Full=UvrABC system protein C;       
    8::587     3e-87  36%  603 aa  UVRC_CHLPN RecName: Full=UvrABC system protein C;       
   14::683     4e-87  35%  683 aa  UVRC_BURVG RecName: Full=UvrABC system protein C;       
   28::622     7e-87  35%  626 aa  UVRC_SYNY3 RecName: Full=UvrABC system protein C;       
    7::610     7e-87  33%  646 aa  UVRC_MYXXD RecName: Full=UvrABC system protein C;       
    7::618     7e-87  33%  620 aa  UVRC_CLOP1 RecName: Full=UvrABC system protein C;       
    2::586     1e-86  34%  591 aa  UVRC_BACHD RecName: Full=UvrABC system protein C;       
    5::652     1e-86  34%  707 aa  UVRC_ANADE RecName: Full=UvrABC system protein C;       
    3::584     2e-86  38%  614 aa  UVRC_STRP7 RecName: Full=UvrABC system protein C;       
   24::666     2e-86  36%  666 aa  UVRC_POLSJ RecName: Full=UvrABC system protein C;       
   23::612     2e-86  34%  612 aa  UVRC_FRATT RecName: Full=UvrABC system protein C;       
   23::612     2e-86  34%  612 aa  UVRC_FRAT1 RecName: Full=UvrABC system protein C;       
    3::584     3e-86  38%  614 aa  UVRC_STRZP RecName: Full=UvrABC system protein C;       
    3::584     3e-86  38%  614 aa  UVRC_STRPN RecName: Full=UvrABC system protein C;       
    3::584     3e-86  38%  615 aa  UVRC_STRP4 RecName: Full=UvrABC system protein C;       
    4::587     3e-86  34%  593 aa  UVRC_CALS8 RecName: Full=UvrABC system protein C;       
    3::584     4e-86  38%  614 aa  UVRC_STRZT RecName: Full=UvrABC system protein C;       
    4::584     4e-86  37%  611 aa  UVRC_STRSV RecName: Full=UvrABC system protein C;       
    5::584     4e-86  35%  593 aa  UVRC_BREBN RecName: Full=UvrABC system protein C;       
    3::584     5e-86  38%  615 aa  UVRC_STRPS RecName: Full=UvrABC system protein C;       
    3::584     5e-86  38%  615 aa  UVRC_STRPJ RecName: Full=UvrABC system protein C;       
    3::584     6e-86  38%  615 aa  UVRC_STRZJ RecName: Full=UvrABC system protein C;       
    1::598     1e-85  33%  604 aa  UVRC_METBU RecName: Full=UvrABC system protein C;       
    5::652     1e-85  35%  707 aa  UVRC_ANAD2 RecName: Full=UvrABC system protein C;       
    3::584     1e-85  38%  614 aa  UVRC_STRR6 RecName: Full=UvrABC system protein C;       
    3::584     1e-85  38%  614 aa  UVRC_STRP2 RecName: Full=UvrABC system protein C;       
    4::584     1e-85  37%  611 aa  UVRC_STRGC RecName: Full=UvrABC system protein C;       
    3::584     2e-85  38%  615 aa  UVRC_STRPI RecName: Full=UvrABC system protein C;       
    3::584     2e-85  35%  598 aa  UVRC_STRPG RecName: Full=UvrABC system protein C;       
    3::584     3e-85  35%  598 aa  UVRC_STRP8 RecName: Full=UvrABC system protein C;       
   10::597     3e-85  33%  599 aa  UVRC_DICT6 RecName: Full=UvrABC system protein C;       
    5::585     3e-85  35%  590 aa  UVRC_BACA2 RecName: Full=UvrABC system protein C;       
    3::589     3e-85  34%  610 aa  UVRC_ACIBL RecName: Full=UvrABC system protein C;       
    9::594     4e-85  34%  598 aa  UVRC_METST RecName: Full=UvrABC system protein C;       
    1::586     4e-85  33%  603 aa  UVRC_LACRJ RecName: Full=UvrABC system protein C;       
    1::586     4e-85  33%  603 aa  UVRC_LACRD RecName: Full=UvrABC system protein C;       
   13::597     4e-85  33%  606 aa  UVRC_DESAH RecName: Full=UvrABC system protein C;       
    7::618     4e-85  33%  620 aa  UVRC_CLOPE RecName: Full=UvrABC system protein C;       
   35::671     5e-85  35%  671 aa  UVRC_RHOFD RecName: Full=UvrABC system protein C;       
    3::615     7e-85  34%  615 aa  UVRC_THEP3 RecName: Full=UvrABC system protein C;       
    3::591     7e-85  33%  616 aa  UVRC_GEMAT RecName: Full=UvrABC system protein C;       
    3::584     9e-85  35%  598 aa  UVRC_STRPM RecName: Full=UvrABC system protein C;       
    3::584     9e-85  35%  598 aa  UVRC_STRP6 RecName: Full=UvrABC system protein C;       
   20::635     9e-85  35%  640 aa  UVRC_PROM1 RecName: Full=UvrABC system protein C;       
    3::615     1e-84  34%  615 aa  UVRC_THEPX RecName: Full=UvrABC system protein C;       
    3::584     1e-84  35%  598 aa  UVRC_STRPZ RecName: Full=UvrABC system protein C;       
    3::584     1e-84  35%  598 aa  UVRC_STRPF RecName: Full=UvrABC system protein C;       
    3::584     1e-84  35%  598 aa  UVRC_STRPD RecName: Full=UvrABC system protein C;       
    3::584     1e-84  35%  598 aa  UVRC_STRPC RecName: Full=UvrABC system protein C;       
    3::584     1e-84  35%  598 aa  UVRC_STRPB RecName: Full=UvrABC system protein C;       
    3::584     1e-84  35%  598 aa  UVRC_STRP3 RecName: Full=UvrABC system protein C;       
   20::635     2e-84  36%  640 aa  UVRC_PROMT RecName: Full=UvrABC system protein C;       
    9::609     3e-84  32%  623 aa  UVRC_SYNJB RecName: Full=UvrABC system protein C;       
    3::586     3e-84  35%  594 aa  UVRC_STREM RecName: Full=UvrABC system protein C;       
   10::592     3e-84  36%  604 aa  UVRC_CHLFF RecName: Full=UvrABC system protein C;       
   10::609     4e-84  32%  621 aa  UVRC_SYNJA RecName: Full=UvrABC system protein C;       
    3::584     6e-84  35%  598 aa  UVRC_STRP1 RecName: Full=UvrABC system protein C;       
    1::585     6e-84  34%  594 aa  UVRC_PEDPA RecName: Full=UvrABC system protein C;       
    3::590     8e-84  34%  595 aa  UVRC_STRMU RecName: Full=UvrABC system protein C;       
   11::590     8e-84  35%  598 aa  UVRC_CHLTR RecName: Full=UvrABC system protein C;       
   11::590     8e-84  35%  598 aa  UVRC_CHLTA RecName: Full=UvrABC system protein C;       
    3::586     2e-83  35%  594 aa  UVRC_STRE4 RecName: Full=UvrABC system protein C;       
    6::584     5e-83  35%  590 aa  UVRC_LACS1 RecName: Full=UvrABC system protein C;       
    4::582     5e-83  35%  590 aa  UVRC_BACP2 RecName: Full=UvrABC system protein C;       
    3::584     6e-83  35%  594 aa  UVRC_STRS7 RecName: Full=UvrABC system protein C;       
    3::584     1e-82  34%  593 aa  UVRC_STRA5 RecName: Full=UvrABC system protein C;       
   10::587     1e-82  34%  604 aa  UVRC_CHLAB RecName: Full=UvrABC system protein C;       
   14::630     2e-82  33%  681 aa  UVRC_STRAW RecName: Full=UvrABC system protein C;       
    3::602     2e-82  31%  604 aa  UVRC_GEOLS RecName: Full=UvrABC system protein C;       
    8::586     2e-82  36%  589 aa  UVRC_FUSNN RecName: Full=UvrABC system protein C;       
    3::586     4e-82  36%  595 aa  UVRC_STRT1 RecName: Full=UvrABC system protein C;       
    3::584     5e-82  34%  593 aa  UVRC_STRA3 RecName: Full=UvrABC system protein C;       
    5::642     5e-82  36%  669 aa  UVRC_LACLM RecName: Full=UvrABC system protein C;       
    3::586     9e-82  36%  595 aa  UVRC_STRT2 RecName: Full=UvrABC system protein C;       
    5::601     9e-82  32%  609 aa  UVRC_LEPIC RecName: Full=UvrABC system protein C;       
    3::584     1e-81  34%  593 aa  UVRC_STRA1 RecName: Full=UvrABC system protein C;       
    5::601     1e-81  32%  609 aa  UVRC_LEPIN RecName: Full=UvrABC system protein C;       
    1::586     3e-81  34%  605 aa  UVRC_LACBA RecName: Full=UvrABC system protein C;       
    4::607     3e-81  32%  614 aa  UVRC_GEOMG RecName: Full=UvrABC system protein C;       
    7::685     4e-81  34%  690 aa  UVRC_CORJK RecName: Full=UvrABC system protein C;       
   10::587     4e-81  35%  605 aa  UVRC_CHLCV RecName: Full=UvrABC system protein C;       
   25::651     5e-81  33%  652 aa  UVRC_PROM9 RecName: Full=UvrABC system protein C;       
    6::585     5e-81  33%  604 aa  UVRC_LACPL RecName: Full=UvrABC system protein C;       
   14::678     5e-81  32%  681 aa  UVRC_COREF RecName: Full=UvrABC system protein C;       
   14::623     6e-81  33%  624 aa  UVRC_CYAP4 RecName: Full=UvrABC system protein C;       
    4::635     8e-81  31%  656 aa  UVRC_THEFY RecName: Full=UvrABC system protein C;       
    4::586     1e-80  35%  595 aa  UVRC_STRTD RecName: Full=UvrABC system protein C;       
   14::632     2e-80  32%  655 aa  UVRC_RENSM RecName: Full=UvrABC system protein C;       
    5::640     2e-80  35%  668 aa  UVRC_LACLA RecName: Full=UvrABC system protein C;       
   20::601     3e-80  32%  609 aa  UVRC_LEPBL RecName: Full=UvrABC system protein C;       
   20::601     3e-80  32%  609 aa  UVRC_LEPBJ RecName: Full=UvrABC system protein C;       
   14::624     5e-80  35%  626 aa  UVRC_ACAM1 RecName: Full=UvrABC system protein C;       
    7::527     7e-80  37%  527 aa  UVRC_METMP RecName: Full=UvrABC system protein C;       
   24::640     1e-79  34%  647 aa  UVRC_PROM4 RecName: Full=UvrABC system protein C;       
   14::626     2e-79  34%  647 aa  UVRC_MYCLE RecName: Full=UvrABC system protein C;       
   14::626     2e-79  34%  647 aa  UVRC_MYCLB RecName: Full=UvrABC system protein C;       
   18::598     2e-79  35%  607 aa  UVRC_DESHY RecName: Full=UvrABC system protein C;       
   14::651     2e-79  33%  674 aa  UVRC_ARTCA RecName: Full=UvrABC system protein C;       
    1::588     3e-79  32%  592 aa  UVRC_LACSS RecName: Full=UvrABC system protein C;       
   10::608     4e-79  30%  612 aa  UVRC_PELCD RecName: Full=UvrABC system protein C;       
   14::655     1e-78  34%  730 aa  UVRC_RHOE4 RecName: Full=UvrABC system protein C;       
    3::585     1e-78  33%  594 aa  UVRC_BACSK RecName: Full=UvrABC system protein C;       
   14::635     1e-78  31%  646 aa  UVRC_MYCTU RecName: Full=UvrABC system protein C;       
   14::635     1e-78  31%  646 aa  UVRC_MYCTA RecName: Full=UvrABC system protein C;       
   14::635     1e-78  31%  646 aa  UVRC_MYCBT RecName: Full=UvrABC system protein C;       
   14::635     1e-78  31%  646 aa  UVRC_MYCBP RecName: Full=UvrABC system protein C;       
   14::635     1e-78  31%  646 aa  UVRC_MYCBO RecName: Full=UvrABC system protein C;       
   11::590     2e-78  36%  598 aa  UVRC_CHLMU RecName: Full=UvrABC system protein C;       
   14::626     3e-78  33%  647 aa  UVRC_MYCMM RecName: Full=UvrABC system protein C;       
    1::580     5e-78  33%  607 aa  UVRC_OENOB RecName: Full=UvrABC system protein C;       
    5::606     5e-78  32%  613 aa  UVRC_GEOSL RecName: Full=UvrABC system protein C;       
   14::625     1e-77  32%  629 aa  UVRC_CHLCH RecName: Full=UvrABC system protein C;       
   14::645     1e-77  32%  669 aa  UVRC_ARTS2 RecName: Full=UvrABC system protein C;       
   14::663     2e-77  32%  689 aa  UVRC_KOCRD RecName: Full=UvrABC system protein C;       
   14::672     4e-77  34%  673 aa  UVRC_NOCFA RecName: Full=UvrABC system protein C;       
    5::607     9e-77  35%  611 aa  UVRC_NAUPA RecName: Full=UvrABC system protein C;       
    1::586     2e-76  32%  603 aa  UVRC_LACF3 RecName: Full=UvrABC system protein C;       
    1::584     2e-76  33%  600 aa  UVRC_LACDB RecName: Full=UvrABC system protein C;       
    1::584     2e-76  33%  600 aa  UVRC_LACDA RecName: Full=UvrABC system protein C;       
   13::621     2e-76  33%  626 aa  UVRC_CHLTE RecName: Full=UvrABC system protein C;       
   24::626     2e-76  32%  631 aa  UVRC_CHLPD RecName: Full=UvrABC system protein C;       
    3::595     2e-76  34%  597 aa  UVRC_GRAFK RecName: Full=UvrABC system protein C;       
    5::573     4e-76  32%  579 aa  UVRC_METTH RecName: Full=UvrABC system protein C;       
   14::642     8e-76  31%  678 aa  UVRC_MYCGI RecName: Full=UvrABC system protein C;       
   14::669     1e-75  34%  727 aa  UVRC_RHOSR RecName: Full=UvrABC system protein C;       
    6::584     1e-75  32%  600 aa  UVRC_LACGA RecName: Full=UvrABC system protein C;       
    1::602     1e-75  34%  614 aa  UVRC_LEPBP RecName: Full=UvrABC system protein C;       
    1::602     1e-75  34%  614 aa  UVRC_LEPBA RecName: Full=UvrABC system protein C;       
    3::597     3e-75  35%  600 aa  UVRC_CAMJD RecName: Full=UvrABC system protein C;       
   14::628     4e-75  32%  671 aa  UVRC_MYCA9 RecName: Full=UvrABC system protein C;       
   17::640     6e-75  33%  640 aa  UVRC_PROMA RecName: Full=UvrABC system protein C;       
   14::626     8e-75  31%  647 aa  UVRC_MYCPA RecName: Full=UvrABC system protein C;       
   14::644     8e-75  31%  671 aa  UVRC_ARTAT RecName: Full=UvrABC system protein C;       
    5::586     1e-74  35%  589 aa  UVRC_MYCPE RecName: Full=UvrABC system protein C;       
    3::597     1e-74  35%  600 aa  UVRC_CAMJE RecName: Full=UvrABC system protein C;       
   34::656     1e-74  31%  667 aa  UVRC_PROMM RecName: Full=UvrABC system protein C;       
   11::605     2e-74  30%  649 aa  UVRC_GEOSM RecName: Full=UvrABC system protein C;       
   11::607     2e-74  31%  622 aa  UVRC_GEOSF RecName: Full=UvrABC system protein C;       
   11::605     2e-74  30%  623 aa  UVRC_GEOBB RecName: Full=UvrABC system protein C;       
   19::634     3e-74  30%  651 aa  UVRC_SYNS3 RecName: Full=UvrABC system protein C;       
    6::584     3e-74  33%  600 aa  UVRC_LACJO RecName: Full=UvrABC system protein C;       
    3::584     5e-74  31%  623 aa  UVRC_SOLUE RecName: Full=UvrABC system protein C;       
    3::597     7e-74  35%  600 aa  UVRC_CAMJR RecName: Full=UvrABC system protein C;       
    5::604     1e-73  32%  617 aa  UVRC_DEIRA RecName: Full=UvrABC system protein C;       
    3::597     1e-73  35%  600 aa  UVRC_CAMJ8 RecName: Full=UvrABC system protein C;       
   18::681     2e-73  35%  685 aa  UVRC_VEREI RecName: Full=UvrABC system protein C;       
   14::651     2e-73  30%  693 aa  UVRC_BEUC1 RecName: Full=UvrABC system protein C;       
    3::597     5e-73  34%  600 aa  UVRC_CAMJJ RecName: Full=UvrABC system protein C;       
   14::638     6e-73  32%  643 aa  UVRC_SYNP6 RecName: Full=UvrABC system protein C;       
   14::638     6e-73  32%  643 aa  UVRC_SYNE7 RecName: Full=UvrABC system protein C;       
   12::610     6e-73  30%  611 aa  UVRC_RUBXD RecName: Full=UvrABC system protein C;       
   14::646     1e-72  31%  676 aa  UVRC_MYCSS RecName: Full=UvrABC system protein C;       
   14::646     1e-72  31%  676 aa  UVRC_MYCSK RecName: Full=UvrABC system protein C;       
   14::646     1e-72  31%  676 aa  UVRC_MYCSJ RecName: Full=UvrABC system protein C;       
    3::610     1e-72  30%  645 aa  UVRC_ACIC5 RecName: Full=UvrABC system protein C;       
   14::613     1e-72  32%  616 aa  UVRC_PROA2 RecName: Full=UvrABC system protein C;       
    9::633     4e-72  30%  652 aa  UVRC_SYNPX RecName: Full=UvrABC system protein C;       
   14::693     2e-71  33%  696 aa  UVRC_CORGL RecName: Full=UvrABC system protein C;       
   14::693     2e-71  33%  696 aa  UVRC_CORGB RecName: Full=UvrABC system protein C;       
    2::583     3e-71  35%  596 aa  UVRC_CYTH3 RecName: Full=UvrABC system protein C;       
   16::638     3e-71  30%  661 aa  UVRC_SYNSC RecName: Full=UvrABC system protein C;       
    6::588     4e-71  31%  602 aa  UVRC_LACCB RecName: Full=UvrABC system protein C;       
   16::589     1e-70  35%  594 aa  UVRC_HELP2 RecName: Full=UvrABC system protein C;       
    6::588     1e-70  31%  602 aa  UVRC_LACC3 RecName: Full=UvrABC system protein C;       
   10::610     2e-70  30%  633 aa  UVRC_SALRD RecName: Full=UvrABC system protein C;       
   14::637     2e-70  29%  641 aa  UVRC_ACIC1 RecName: Full=UvrABC system protein C;       
   11::610     4e-70  28%  614 aa  UVRC_DESAP RecName: Full=UvrABC system protein C;       
   14::650     5e-70  32%  656 aa  UVRC_LEIXX RecName: Full=UvrABC system protein C;       
   14::654     6e-70  32%  678 aa  UVRC_MYCVP RecName: Full=UvrABC system protein C;       
   16::589     6e-70  35%  594 aa  UVRC_HELPY RecName: Full=UvrABC system protein C;       
    3::567     1e-69  35%  588 aa  UVRC_MESFL RecName: Full=UvrABC system protein C;       
   16::589     1e-69  35%  594 aa  UVRC_HELPG RecName: Full=UvrABC system protein C;       
    2::553     4e-69  33%  557 aa  UVRC_THEP1 RecName: Full=UvrABC system protein C;       
    3::611     5e-69  34%  616 aa  UVRC_ARCB4 RecName: Full=UvrABC system protein C;       
    9::611     1e-68  32%  621 aa  UVRC_LAWIP RecName: Full=UvrABC system protein C;       
   16::589     1e-68  35%  594 aa  UVRC_HELPJ RecName: Full=UvrABC system protein C;       
   12::627     3e-68  29%  628 aa  UVRC_PELLD RecName: Full=UvrABC system protein C;       
    4::594     3e-68  31%  600 aa  UVRC_PORG3 RecName: Full=UvrABC system protein C;       
    4::567     6e-68  33%  574 aa  UVRC_PETMO RecName: Full=UvrABC system protein C;       
   16::589     1e-67  34%  594 aa  UVRC_HELPS RecName: Full=UvrABC system protein C;       
    2::553     1e-67  32%  557 aa  UVRC_THESQ RecName: Full=UvrABC system protein C;       
    2::553     1e-67  32%  557 aa  UVRC_THEMA RecName: Full=UvrABC system protein C;       
    9::622     2e-67  32%  626 aa  UVRC_THEEB RecName: Full=UvrABC system protein C;       
   10::593     2e-67  31%  599 aa  UVRC_PORGI RecName: Full=UvrABC system protein C;       
   16::589     2e-67  34%  594 aa  UVRC_HELPH RecName: Full=UvrABC system protein C;       
   17::589     2e-67  34%  594 aa  UVRC_HELAH RecName: Full=UvrABC system protein C;       
   17::639     4e-67  29%  661 aa  UVRC_SYNS9 RecName: Full=UvrABC system protein C;       
    1::585     4e-67  30%  600 aa  UVRC_LACAC RecName: Full=UvrABC system protein C;       
   20::604     5e-67  28%  609 aa  UVRC_BACTN RecName: Full=UvrABC system protein C;       
    5::585     1e-66  32%  592 aa  UVRC_MYCGA RecName: Full=UvrABC system protein C;       
   14::597     2e-66  30%  627 aa  UVRC_PELPB RecName: Full=UvrABC system protein C;       
    1::585     2e-66  29%  600 aa  UVRC_LACH4 RecName: Full=UvrABC system protein C;       
    9::520     3e-66  31%  523 aa  UVRC_METMA RecName: Full=UvrABC system protein C;       
    3::568     1e-65  32%  584 aa  UVRC_MYCMS RecName: Full=UvrABC system protein C;       
   14::678     3e-65  30%  687 aa  UVRC_CORDI RecName: Full=UvrABC system protein C;       
   14::658     4e-65  31%  692 aa  UVRC_FRASN RecName: Full=UvrABC system protein C;       
    7::594     1e-64  27%  608 aa  UVRC_BACFR RecName: Full=UvrABC system protein C;       
    7::594     1e-64  27%  608 aa  UVRC_BACFN RecName: Full=UvrABC system protein C;       
   18::612     2e-64  32%  621 aa  UVRC_HELHP RecName: Full=UvrABC system protein C;       
    1::594     2e-64  32%  597 aa  UVRC_FLAJ1 RecName: Full=UvrABC system protein C;       
    3::514     5e-64  31%  519 aa  UVRC_METBF RecName: Full=UvrABC system protein C;       
    9::594     5e-64  32%  599 aa  UVRC_FLAPJ RecName: Full=UvrABC system protein C;       
   18::583     7e-64  35%  585 aa  UVRC_HALWD RecName: Full=UvrABC system protein C;       
    5::518     4e-63  31%  520 aa  UVRC_METHJ RecName: Full=UvrABC system protein C;       
   18::641     7e-63  31%  652 aa  UVRC_TREDE RecName: Full=UvrABC system protein C;       
   15::589     7e-63  32%  603 aa  UVRC_BORGA RecName: Full=UvrABC system protein C;       
    3::591     2e-62  30%  600 aa  UVRC_SULDN RecName: Full=UvrABC system protein C;       
    9::597     1e-61  30%  607 aa  UVRC_TROW8 RecName: Full=UvrABC system protein C;       
   14::682     2e-61  27%  684 aa  UVRC_CORA7 RecName: Full=UvrABC system protein C;       
    9::597     5e-61  30%  607 aa  UVRC_TROWT RecName: Full=UvrABC system protein C;       
    3::581     2e-60  30%  589 aa  UVRC_AYWBP RecName: Full=UvrABC system protein C;       
    3::516     1e-59  30%  516 aa  UVRC_METAC RecName: Full=UvrABC system protein C;       
    3::565     2e-59  31%  584 aa  UVRC_MYCCT RecName: Full=UvrABC system protein C;       
    4::576     6e-59  29%  581 aa  UVRC_HALMA RecName: Full=UvrABC system protein C;       
    3::565     1e-58  29%  584 aa  UVRC_UREU1 RecName: Full=UvrABC system protein C;       
   14::672     2e-58  28%  705 aa  UVRC_FRASC RecName: Full=UvrABC system protein C;       
    3::565     4e-58  30%  584 aa  UVRC_UREPA RecName: Full=UvrABC system protein C;       
    3::565     4e-58  30%  584 aa  UVRC_UREP2 RecName: Full=UvrABC system protein C;       
   11::533     5e-58  33%  565 aa  UVRC_HYDS0 RecName: Full=UvrABC system protein C;       
   15::589     2e-57  30%  598 aa  UVRC_BORAP RecName: Full=UvrABC system protein C;       
   15::589     3e-56  30%  603 aa  UVRC_BORBZ RecName: Full=UvrABC system protein C;       
   15::589     3e-56  30%  603 aa  UVRC_BORBU RecName: Full=UvrABC system protein C;       
    5::555     5e-56  30%  563 aa  UVRC_FERNB RecName: Full=UvrABC system protein C;       
    6::571     4e-55  30%  575 aa  UVRC_NATPD RecName: Full=UvrABC system protein C;       
    8::570     3e-54  29%  602 aa  UVRC_BORHD RecName: Full=UvrABC system protein C;       
   14::650     6e-54  32%  665 aa  UVRC_SALTO RecName: Full=UvrABC system protein C;       
   17::740     2e-53  37%  740 aa  UVRC_BURTA RecName: Full=UvrABC system protein C;       
   14::645     4e-53  31%  660 aa  UVRC_SALAI RecName: Full=UvrABC system protein C;       
   14::684     2e-52  35%  684 aa  UVRC_BURCM RecName: Full=UvrABC system protein C;       
   14::684     2e-52  35%  684 aa  UVRC_BURA4 RecName: Full=UvrABC system protein C;       
   13::731     3e-52  35%  731 aa  UVRC_BURPP RecName: Full=UvrABC system protein C;       
   10::591     3e-52  29%  602 aa  UVRC_BORRA RecName: Full=UvrABC system protein C;       
   10::550     4e-52  30%  551 aa  UVRC_THEAB RecName: Full=UvrABC system protein C;       
   10::591     6e-52  28%  602 aa  UVRC_BORDL RecName: Full=UvrABC system protein C;       
   13::734     8e-52  35%  734 aa  UVRC_BURXL RecName: Full=UvrABC system protein C;       
   17::743     1e-50  36%  743 aa  UVRC_BURPS RecName: Full=UvrABC system protein C;       
   17::747     1e-50  36%  747 aa  UVRC_BURP6 RecName: Full=UvrABC system protein C;       
   17::747     1e-50  36%  747 aa  UVRC_BURP1 RecName: Full=UvrABC system protein C;       
   17::747     1e-50  36%  747 aa  UVRC_BURP0 RecName: Full=UvrABC system protein C;       
   14::685     2e-50  34%  743 aa  UVRC_RHOOB RecName: Full=UvrABC system protein C;       
   17::747     2e-50  36%  747 aa  UVRC_BURMS RecName: Full=UvrABC system protein C;       
   17::747     2e-50  36%  747 aa  UVRC_BURMA RecName: Full=UvrABC system protein C;       
   17::747     2e-50  36%  747 aa  UVRC_BURM9 RecName: Full=UvrABC system protein C;       
   17::747     2e-50  36%  747 aa  UVRC_BURM7 RecName: Full=UvrABC system protein C;       
    8::570     4e-50  29%  602 aa  UVRC_BORT9 RecName: Full=UvrABC system protein C;       
   15::553     5e-49  31%  558 aa  UVRC_THELT RecName: Full=UvrABC system protein C;       
   14::673     4e-48  31%  728 aa  UVRC_STRCO RecName: Full=UvrABC system protein C;       
    4::597     1e-47  27%  602 aa  UVRC_WOLSU RecName: Full=UvrABC system protein C;       
   15::516     1e-47  28%  566 aa  UVRC_AQUAE RecName: Full=UvrABC system protein C;       
    5::608     1e-47  23%  616 aa  UVRC_DEIGD RecName: Full=UvrABC system protein C;       
   14::696     1e-45  30%  717 aa  UVRC_SACEN RecName: Full=UvrABC system protein C;       
   14::685     1e-45  31%  717 aa  UVRC_STRGG RecName: Full=UvrABC system protein C;       
    5::592     3e-43  28%  597 aa  UVRC_MYCGE RecName: Full=UvrABC system protein C;       
    4::586     3e-42  26%  590 aa  UVRC_HALSA RecName: Full=UvrABC system protein C;       
    4::586     3e-42  26%  590 aa  UVRC_HALS3 RecName: Full=UvrABC system protein C;       
    1::571     2e-41  28%  571 aa  UVRC_MYCBV RecName: Full=UvrABC system protein C;       
    5::323     4e-41  30%  700 aa  UVRC_DESDG RecName: Full=UvrABC system protein C;       
    4::541     3e-40  25%  590 aa  UVRC_THET8 RecName: Full=UvrABC system protein C;       
   16::583     5e-40  26%  586 aa  UVRC_MYCPN RecName: Full=UvrABC system protein C;       
    3::647     1e-39  30%  688 aa  UVRC_DESVH RecName: Full=UvrABC system protein C;       
   14::644     7e-37  35%  706 aa  UVRC_MYCS2 RecName: Full=UvrABC system protein C;       
  116::581     1e-36  26%  630 aa  UVRC_THET2 RecName: Full=UvrABC system protein C;       
    1::571     1e-36  28%  571 aa  UVRC_MYCAP RecName: Full=UvrABC system protein C;       
    4::570     4e-35  30%  592 aa  UVRC_HALLT RecName: Full=UvrABC system protein C;       
    1::337     3e-34  30%  691 aa  UVRC_TREPS RecName: Full=UvrABC system protein C;       
    1::337     3e-34  30%  691 aa  UVRC_TREPA RecName: Full=UvrABC system protein C;       
    6::745     9e-34  36%  746 aa  UVRC_BIFLO RecName: Full=UvrABC system protein C;       
    6::745     9e-34  36%  746 aa  UVRC_BIFLD RecName: Full=UvrABC system protein C;       
  454::556     2e-06  41%  660 aa  DNLJ_CHLMU RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  485::566     5e-06  30%  672 aa  DNLJ_THICR RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  468::558     5e-06  27%  659 aa  DNLJ_MYCGE RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  516::561     5e-06  46%  660 aa  DNLJ_CHLAB RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  536::582     6e-06  45%  689 aa  DNLJ_COLP3 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
   24::193     6e-06  28%  293 aa  CHO_SALTY RecName: Full=Excinuclease cho;       
   24::193     6e-06  28%  293 aa  CHO_SALTI RecName: Full=Excinuclease cho;       
  523::567     8e-06  38%  673 aa  DNLJ_SYMTH RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  516::561     8e-06  48%  662 aa  DNLJ_CHLFF RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  478::569     1e-05  30%  675 aa  DNLJ_HAEPS RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  488::579     1e-05  29%  683 aa  DNLJ_ACTP2 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  38%  678 aa  DNLJ_FRATO RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  615::659     2e-05  40%  772 aa  DNLJ_PROAC RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  36%  678 aa  DNLJ_FRATW RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  36%  678 aa  DNLJ_FRATT RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  36%  678 aa  DNLJ_FRATM RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  36%  678 aa  DNLJ_FRATH RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  36%  678 aa  DNLJ_FRATF RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     2e-05  36%  678 aa  DNLJ_FRAT1 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
   24::211     2e-05  25%  295 aa  CHO_ECO57 RecName: Full=Excinuclease cho;       
  600::654     3e-05  42%  657 aa  UVRB_CAMHC RecName: Full=UvrABC system protein B;       
  512::556     3e-05  47%  663 aa  DNLJ_CHLTR RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::556     3e-05  47%  663 aa  DNLJ_CHLTB RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::556     3e-05  47%  663 aa  DNLJ_CHLT2 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
   24::211     3e-05  25%  295 aa  CHO_ECOLI RecName: Full=Excinuclease cho;       
   24::211     3e-05  25%  295 aa  CHO_ECOL6 RecName: Full=Excinuclease cho;       
  118::290     4e-05  22%  627 aa  Y017_RICPR RecName: Full=Uncharacterized protein RP017;
 4348::4511    4e-05  23% 5251 aa  DYHC2_PLAF7 RecName: Full=Dynein heavy chain-like protein PF11_0240;
   31::211     4e-05  25%  295 aa  CHO_SHIFL RecName: Full=Excinuclease cho;       
  527::576     5e-05  32%  678 aa  DNLJ_FRAP2 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  522::561     5e-05  45%  662 aa  DNLJ_CHLCV RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::609     7e-05  28%  628 aa  DNLJ_TROWT RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::609     7e-05  28%  628 aa  DNLJ_TROW8 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  516::565     7e-05  36%  668 aa  DNLJ_PETMO RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  527::576     7e-05  34%  678 aa  DNLJ_FRATN RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  487::578     7e-05  26%  682 aa  DNLJ_ACTPJ RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  487::578     7e-05  26%  682 aa  DNLJ_ACTP7 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  536::580     7e-05  42%  695 aa  DNLJ_ACIC1 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  588::658     9e-05  35%  666 aa  UVRB_SYNP6 RecName: Full=UvrABC system protein B;       
  588::658     9e-05  35%  666 aa  UVRB_SYNE7 RecName: Full=UvrABC system protein B;       
  489::579     9e-05  28%  686 aa  DNLJ_HAEDU RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  517::561     1e-04  38%  665 aa  DNLJ_THEAB RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  625::669     2e-04  47%  683 aa  UVRB_LACAC RecName: Full=UvrABC system protein B;       
  488::556     2e-04  29%  658 aa  DNLJ_MYCPN RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  525::569     3e-04  42%  675 aa  DNLJ_SYNFM RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  506::550     3e-04  38%  652 aa  DNLJ_STRA5 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  506::550     3e-04  38%  652 aa  DNLJ_STRA3 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  506::550     3e-04  38%  652 aa  DNLJ_STRA1 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  606::662     3e-04  39%  671 aa  UVRB_LACJO RecName: Full=UvrABC system protein B;       
  479::566     3e-04  32%  695 aa  DNLJ_CORJK RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  520::566     3e-04  38%  671 aa  DNLJ_CITK8 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::556     3e-04  44%  663 aa  DNLJ_CHLTA RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  593::659     6e-04  38%  666 aa  UVRB_LEPBL RecName: Full=UvrABC system protein B;       
  593::659     6e-04  38%  666 aa  UVRB_LEPBJ RecName: Full=UvrABC system protein B;       
  260::528     6e-04  29%  909 aa  MUTS_CLONN RecName: Full=DNA mismatch repair protein mutS;
  529::573     6e-04  36%  681 aa  DNLJ_MYCA9 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  519::565     6e-04  36%  667 aa  DNLJ_HAES2 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  525::571     6e-04  36%  673 aa  DNLJ_HAES1 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  624::663     8e-04  38%  668 aa  UVRB_DEHE1 RecName: Full=UvrABC system protein B;       
  605::661     8e-04  43%  670 aa  UVRB_CHRVO RecName: Full=UvrABC system protein B;       
   98::145     8e-04  29%  301 aa  RNH3_CHLMU RecName: Full=Ribonuclease HIII;         Short=RNase
  520::566     8e-04  36%  671 aa  DNLJ_SALAR RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  538::582     8e-04  36%  700 aa  DNLJ_RHOE4 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::581     8e-04  31%  691 aa  DNLJ_MYCTU RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::581     8e-04  31%  691 aa  DNLJ_MYCTA RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::581     8e-04  31%  691 aa  DNLJ_MYCBT RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::581     8e-04  31%  691 aa  DNLJ_MYCBP RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  512::581     8e-04  31%  691 aa  DNLJ_MYCBO RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  484::569     8e-04  31%  675 aa  DNLJ_MANSM RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  520::566     8e-04  38%  671 aa  DNLJ_KLEP7 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  520::566     8e-04  36%  672 aa  DNLJ_ENTS8 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  523::567     8e-04  31%  678 aa  DNLJ_CYAP7 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    1::611

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSSELGKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
UVRC_PELUB      MKSSELGKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
UVRC_MESSB      -ETAATGVEVIQAVVKRLPNAPGVYRMVNTEGDVLYVGKARSLKKRVTNYAQGRGHSNRIERMIRETATM
UVRC_BARHE      -KNQFKGAKLIQEFVKHLPHKPGVYRMVDENGKVLYVGKARNLKKRVSNYTREQGHNNRITRMIRATSHM
UVRC_RHILO      -----VGAEVIQTLVKRLPNAPGVYRMMNAAGDVLYVGKARSLKKRVTNYAQGRFHTNRIGRMVRETSTM
UVRC_AGRT5      ------GMDLIGEFVKHLPNSPGVYRMFNEAGDVLYVGKARSLKKRVGNYAQGRVHSNRIAQMVRFTTHM
UVRC_RHOPS      -----VGRAAIEQAVRLAPTSPGVYRMLNAADDVLYVGKAKNVKKRLSSYARPTGHVVRIARMIAATVTV
UVRC_RHIL3      -----LGAELIGEFVKRLPNSPGVYRMFNAEGDVLYVGKARSLKKRVNNYAVGRVHSNRIAQMVRQTANM
UVRC_SILST      ------GYGVIQAYLKTLDSSPGVYRMLDHESRVLYVGKARNLRARVSNYT-RPGHTQRIETMISQTSRM
UVRC_RHOS4      ------GHAVIQGYLKTLDGSPGVYRMLDAQSQVLYVGKARNLRARVSNYARPSGHSGRIARMIRETASM
UVRC_GLUOX      ------GVEAIREALKTIPYSPGVYRMLSEKGEVLYVGKALSLKKRVSSYIRINQLPERLRRMVSMTVSM
UVRC_RHOP2      -----VGRAAIEQAVRLAPTSPGVYRMLNAAHDVLYVGKAKNVKKRLSSYARPTGHVMRIARMIAAXXXX
UVRC_JANSC      ------GHEVIADYVRTLDMSPGVYRMLDSQSRVLYVGKARALKRRVASYAKPSGHSPRIARMIRDTASM
UVRC_BRUAB      ------GPDIINAFVKRLPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTM
UVRC_RHIEC      -----VGAELIGEFVKRLPNSPGVYRMLNAEGDVLYVGKARSLKKRVGNYAVGRVHSNRIAQMVRQTANM
UVRC_MARMM      -----------------LPPKPGVYRMFGEDGAVLYVGKARNLKNRVSNYANGRGHSNRIALMIGLTRKM
UVRC_BRUME      -----------------LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTM
UVRC_BRUA2      -----------------LPNNPGVYRMFNSDGGVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTM
UVRC_BRUSU      -----------------LPNNPGVYRMFNSDGDVLYVGKARNLKKRVSNYARGIGHSNRITRMIRETVTM
UVRC_MAGSA      ------GVEVIAQVVATLPLSPGVYRMLSGKGDVLYVGKAKSLKKRVVAYTRPDRMPLRIQRMIAETASM
UVRC_RHORT      ------GVEAIRAALRTMPSSPGVYRMIDGKGDVLYVGKARNLKRRVINYTQPHRLPVRIQRMIAATLTM
UVRC_ZYMMO      ----EKGVAAIGNVLKTLPLRPGVYRMYDSKGNILYVGKARALRNRVANYTQISGLSRRIQRMVSQTRSM
UVRC_GRABC      ------GVTVIEAMLKLLPDRPGVYRMLDGQGEALYVGKARSLKKRVASYTQIHRLPERLRRMVSETVSM
UVRC_RHOPB      -----IGRSAIAQAVRLAPTSPGVYRMLNAASDVLYVGKAKNVKKRLASYARPTGHVVRISRMIAATVSV
UVRC_RHIME      ------GAELIQAFVKRLPNGPGVYRMLNEAGDVLYVGKARSLKKRVSNYAQGRGHSNRIARMVRETAHM
UVRC_RHOPA      -----VGRSAIARAVRLAPTSPGVYRMLNAERDVLYVGKAKNVKKRLASYARPTGQVLRIARMIALXXXX
UVRC_BARQU      -KNQLKGAKLIQEFVKHLPHKPGVYRMFDENGNVLYIGKARNLKKRVSNYTCEQRHNNRITRMIRATYHM
UVRC_SILPO      ------GYACIQDYLRNLSGAPGVYRMLDAQARVLYVGKARNLKARVSNY-ARPGHSPRIERMIRETASM
UVRC_SPHAL      ------GAEVIRSVVRKLPARPGVYRMLDARGDVLYVGKARALRNRVTSYTQVARLPQRLQRMVAQTRAM
UVRC_BRAJA      ------GHEAIERAVRLAPTSPGVYRMLNANADVLYVGKAKNVKKRLSNYARQSAQPARILRMIAATVTV
UVRC_NITHX      -----VGRAAIEHAVRHAPTSPGVYRMMNAARDVLYVGKAKNVRKRLSSYARPTGQVMRIARMIAAXXXX
UVRC_HYPNA      ------GVDVIKENLKHLPSRPGVYRMFGEAGEVLYVGKARDLKARVSNYTRMGGHTQRIARMISLTRAM
UVRC_NOVAD      ----ELGAGVIRETVQTLKPKPGVYRMLDARGDVLYVGKARALKNRVANYTQVERLPNRLRRMVSQTRSM
UVRC_CAUCR      ------GAALIKDEVTRLPDAPGVYRMIGEADEVLYVGKAKSLKKRVVQYAQGRFHTNRIANMVDATRAM
UVRC_NITWN      -----IGRAAIEHAVRHAPTSPGVYRMMNAARDVLYVGKAKNVRKRLSSYARPTGQXXXXXXXXXXXXXX
UVRC_RICTY      ------GRELIKSKIIDAPECSGVYKMLDVSKQVIYVGKAKILKKRLTNYI-KSDLDNKTLRMIANTYFL
UVRC_RICPR      ------GSKLIKAQIIDAPECSGVYKMLDVNKQVIYIGKAKILKKRLTNYI-KSDLDNKTLRMISNTYFL
UVRC_RICBR      ------GNELIKSKLIDIPERSGVYRMFDANKQVIYVGKAKNLKKRLTNYI-KTDLDTKTLRMVANTCSL
UVRC_THICR      -----------------LTERPGVYLMYDASGQIIYVGKAKNLKRRVSSYFKKRHEEIKTETLVSQVASI
UVRC_WOLWR      -----------KEQIKSSPQSCGVYKMVGDKNKVLYVGKAKNLKSRLSDYLQFENLSERIRVMLSQVIKV
UVRC_WOLPM      -----------KEQIKSSPQSCGVYKMVGDKNKVLYVGKAKNLKSRLSDYLQFENLSERIRVMLLQVIKV
UVRC_PSE14      ---------------------PGVYRMFDAEATLLYVGKAKNLKKRLASYFRKTGHAPKTGALVSRIAQI
UVRC_NITOC      ---------------------PGVYRMLDAKGKVLYVGKAKNLKRRIKSYFRNSKLAPKIHVLVKQICDI
UVRC_PSEU2      ---------------------PGVYRMFDAEATLLYVGKAKNLKKRLASYFRKTGHAPKTGALVSRIAQI
UVRC_PSEFS      ---------------------PGVYRMFDSEARLLYVGKAKNLKNRLASYFRKSGLAPKTAALVARIAQV
UVRC_WOLPP      -----------KEQIKSSPQSCGVYKMIGDKSKVLYIGKAKNLKSRLSDYLQFENLSERIRVMISQVIKV
UVRC_METFK      ----------------------GVYRMINAQDEVIYVGKARDLKKRVSSYFQKNLPSARTRLMVSNIARI
UVRC_PSEPW      ---------------------PGVYRMFDSETRLLYVGKAKNLKKRLASYFRKTGLAPKTAALVGRIAQV
UVRC_WOLTR      ----------IKKQIELSPQSCGVYQMIGDKDKVLYVGKAKNLKSRLSNYLRYENLSERTKFMLSQVIKV
UVRC_RICPU      ------GSELIKSKLIDAPERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYI-KSNLDNKTLRMIANTCFL
UVRC_RICAE      ------GSELIKSKLIDAPERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYI-KSNLDNKTLRMIANTCFL
UVRC_PSEPK      ---------------------PGVYRMFDGEARLLYVGKAKNLKKRLASYFRKTGLAPKTAALVARIAQV
UVRC_RICCN      ------GSELIKSKLIDAPERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYI-KSNLDNKTLRMIANTCFL
UVRC_RICRS      ------GSELIKSKLIDAPERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYI-KSNLDNKTLRMIANTCFL
UVRC_RICRO      ------GSELIKSKLIDAPERSGVYRMFDVNKQVLYVGKAKNLKKRLTNYI-KSNLDNKTLRMIANTCFL
UVRC_PSESM      ---------------------PGVYRMFDADATLLYVGKAKNLKKRLASYFRKTGHAPKTGALVARXXXX
UVRC_PSEE4      ---------------------PGVYRMFDAEARLLYVGKAKNLKKRLASYFRKTGLAPKTAALVGRIAQV
UVRC_PSEP1      ---------------------PGVYRMFDGEARLLYVGKAKNLKKRLASYFRKAGLAPKTAALVARIAQV
UVRC_PSEPF      --------------LSTVSGRPGVYRMFDSDARLLYVGKAKSLKKRLASYFRKTGLAPKTAALVGRIAQV
UVRC_SACD2      -----------------VTKLPGVYQMYDADGAILYVGKAKNLKNRLSSYFRATGLTPKTHALVKRIQAI
UVRC_RICCK      MTSDATGSELIKSKLVDAPECAGVYQMFDVNKQVIYVGKAKNLKKRLTNYI-KLDLDNKTLRMIANTCFL
UVRC_PSEF5      ---------------------PGVYRMFDSDARLLYVGKAKNLKNRLSSYFRKTGQAPKTAALVARXXXX
UVRC_LEGPL      --------------LTKLPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNTGVKTRALVSQIKSI
UVRC_ALHEH      -----------------LTQRPGVYRMVDGRGEVLYVGKARNLKKRVASYFTRSRKSARIELMLTQVQDI
UVRC_LEGPC      --------------LTKLPGEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNTGVKTRALVSQIKSI
UVRC_LEGPH      --------------LTKLPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNTGVKTRALVSQIKSI
UVRC_NITEC      -----------------LPSQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQKSNLSPRIQLMVSQITGI
UVRC_PSEFL      ---------------------PGVYRMFDSDTRLLYVGKAKNLKSRLASYFRKTGLAPKTAALVGRXXXX
UVRC_NEIMA      -----------------LPKLPGVYRFFDEGGKVLYVGKAVNLKRRVSGYFQKNDHSPRIALMVKQVHHI
UVRC_SHEPA      --------------LKTVTSSPGVYRMYDAKDAVIYVGKAKDLKKRLSSYFRKNLANVKTQALVSHIANI
UVRC_LEGPA      --------------LTKLPSEPGIYRMLDEEGTVLYVGKAANLKKRVNSYFSKQNTGVKTRALVSQIKSI
UVRC_NEIG1      -----------------LPKLPGVYRFFDEGGNVLYVGKAVNLKRRVSGYFQKNDHSPRIALMVKQVRHI
UVRC_ANAMM      -----IARDAVKKALNSIPCDAGVYKMLGANGLVLYVGKAKDLKKRLRSYYNFNQMSDRILAMVGHITEL
UVRC_ACIBY      ----------IEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVKTIEHPKTQALVARIYDI
UVRC_ACIBS      ----------IEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVKTIEHPKTQALVARIYDI
UVRC_PSEMY      ---------------------PGVYRMFDADARLLYVGKAKNLKKRLSSYFRKTGQAPKTAALVARIAQV
UVRC_NITMU      -----------------LPSQPGVYRMMNSAGQVIYVGKAIDLKKRVSSYFQKNGLAPRTQLMVSQIAGI
UVRC_NEIMB      -----------------LPNLPGVYRFFNESGNVLYVGKAVNLKRRVSGYFQKNDHSPRIALMVKQVHHI
UVRC_PSEAE      ---------------------PGVYRMFDAEAKLLYVGKAKSLKKRLASYFRKSGLAPKTAALVARIAQV
UVRC_PSEAB      ---------------------PGVYRMFDADAKLLYVGKAKSLKKRLASYFRKSGLAPKTAALVARIAQV
UVRC_PSEA8      ---------------------PGVYRMFDADAKLLYVGKAKSLKKRLASYFRKSGLAPKTAALVARIAQV
UVRC_PHOPR      --------------LKTVTHQPGVYRMYDAVGDVIYVGKAKDLKKRLSSYFRINVAGEKTRALVKNICKV
UVRC_RICAH      --------ELIKSKLIDAPERCGVYRMFDVNKQVIYVGKAKNLKKRLTHYI-KSDLDNKTLRMIANTCFL
UVRC_SHEHH      --------------LKTVTSSPGVYRMYDAKAVVIYVGKAKDLKKRLSSYFRKNLTNVKTQALVSHIANI
UVRC_ACTSZ      -----------------VPHDPGVYRMFDKTDTVIYVGKAKDLKKRLSSYFRPNLSSKKTEALVAXXXXX
UVRC_RICFE      ------GSELIKSKLIDAPERCGVYRMFDVNKQVIYVGKAKNLKKRLTNYI-KSDLDNKTLRMIANTCFL
UVRC_PSEA7      ---------------------PGVYRMFDADAKLLYVGKAKSLKKRLASYFRKSGLAPKTAALVVRIAQV
UVRC_ACIAD      ----------IEKILANMTQLPGVYRMLGKDGELLYVGKAKNLKNRVSSYFVKTIEHPKTQALVARIHDI
UVRC_HAEI8      -----------KKFLADVSHEPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRKNLSSKKTEALVASIHHI
UVRC_HAHCH      ---------------------PGVYRMMDARGEVLYVGKARNLKNRVSSYFRNTGVSIKTRALVEKIADI
UVRC_METCA      ----------IKTFLATLTGAPGVYKMLDRNGEVIYVGKAKNLKKRVASHFAQRGSSPKQNAMVARVQAI
UVRC_EUBE2      ----------LEEELKKLPAKPGVYIMHDKWDNIIYIGKAKVLKNRVRQYFSNRNKSAKIVQMVSHIQYF
UVRC_HAEIE      -----------KKFLADVSHEPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRKNLSSKKTEALVASIHHI
UVRC_IDILO      ---------------------PGVYRMYDESGDVIYVGKAKDLRKRVSSYFREKVDRMKTQVLVKQIASM
UVRC_AZOVD      ---------------------PGVYRMLDAKGELLYVGKAKNLRKRLSSYFRTSGLAPKTAALVARIAQV
UVRC_SHEPW      --------------LKTVTSSPGVYRMYDVDNIVIYVGKAKDLKKRLSSYFRKNLTNVKTQALVARIANI
UVRC_ALKOO      ----------LKEKLRTLPEKPGVYMMRNDKNEIIYVGKAISLKNRVRQYFSSKNHPPKVKAMVSHIVTF
UVRC_PSEA6      -----------------LTNQPGVYRMYNHKQDVIYVGKAKNLKNRVSSYFRSQVDSIKTQSLVKQIAHM
UVRC_VIBPA      --------------LKTVTHQPGVYRMYNADAVVIYVGKAKDLQKRLSSYFRKKVDSEKTRALVSNIAKI
UVRC_HAES1      -----------------VTHQPGVYRMFDEKGQVIYVGKAKDLKKRLSSYFRTNLNSKKTSALVXXXXXX
UVRC_HAEIN      -----------KKFLTDVSHEPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFRKNLSSKKTEALVASIHHI
UVRC_ACTPJ      -----------------VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLASKKTEALVANXXXX
UVRC_HAES2      -----------------VTHQPGVYRMFDEKGQVIYVGKAKDLKKRLSSYFRTNLNSKKTSALVXXXXXX
UVRC_ACTP7      -----------------VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLASKKTEALVANXXXX
UVRC_COLP3      --------------LRVVTEQAGVYRMYDSKQVVIYVGKAKQLKKRLASYFRKDVGSVKTQVLVKQIAAI
UVRC_PSEHT      --------------LKTLSSEPGVYCMLDSDNQVIYVGKAKHLKKRVSSYFRSNITDSKTRVLVSNICXX
UVRC_NITEU      -----------------LPAQPGVYRMLNAAGDVIYVGKAIDLRKRVSSYFQKSGLSPRIQLMVSQIAGI
UVRC_ACTP2      -----------------VPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFRSQLASKKTEALVANXXXX
UVRC_DECAR      --------------LATLTELPGVYRMLDIGGNVLYVGKAKNLKKRVASYFRENLSSPRIAHMVSQIASI
UVRC_ECOK1      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOUT      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO45      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ANAPZ      ---------------------PGVYKMFGTEDRLLYVGKAKDLKKRLSSYLSINRMSVNVYTMVKQIVRL
UVRC_YERPS      --------------LKTVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVANRKTETLVKNIAQI
UVRC_SHISS      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOSM      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOSE      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOLU      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOLI      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOL6      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOHS      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECODH      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECOBW      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO8A      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO81      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO7I      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO5E      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO57      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO55      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO27      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_ECO24      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_BORA1      -----------------LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKTLASPRIAQMVSKVVRL
UVRC_ECOLC      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_VIBVY      --------------LKTVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRKKVDSEKTKALVSNIAKI
UVRC_VIBVU      --------------LKTVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRKKVDSEKTKALVSNIAKI
UVRC_SHIB3      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_YERPN      --------------LKTVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVANRKTETLVKNIAQI
UVRC_YERPE      --------------LKTVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVANRKTETLVKNIAQI
UVRC_YERPA      --------------LKTVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVANRKTETLVKNIAQI
UVRC_YERP3      --------------LKTVTSQPGVYRMYDTAGTVIYVGKAKDLKKRLTSYFRAQVANRKTETLVKNIAQI
UVRC_ESCF3      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_CITK8      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_SHESH      --------------LKTVSSSPGVYRMYDEEGTVIYVGKAKDLKKRLSSYFRVNLPNVKTQALVSHIANI
UVRC_SODGM      --------------LSTVTSQPGVYSMYDLSGTVIYVGKAKDLKKRLASYFRAQVASRKTEALVKSIHHI
UVRC_SALTY      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALPB      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_DEHSB      --------ETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTKTCQLVSQINEL
UVRC_SALTI      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALNS      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALA4      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_DICNV      ----------------------GVYQMRDQNGTVLYVGKAKNLRQRLSHYFQKTGLSVKTRALMRAVYDI
UVRC_SALSV      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALPK      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALPC      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALPA      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALHS      --------------LKTVTSQPGVYRMYDAGGAVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALCH      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_YERE8      --------------LKTVTSQPGVYRMYDKAGTVIYVGKAKDLKKRLTSYFRAHVASRKTETLVKNIAQI
UVRC_SHELP      --------------LKTVSSSAGVYRMYDAQGVVIYVGKAKDLKKRLSSYFRRNLPNVKTQALVSHIANI
UVRC_SALDC      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_SALG2      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_DEHSC      --------ETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLTKTCQLVSQINEL
UVRC_SALEP      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQHI
UVRC_PHOLL      --------------LKTVTSQPGVYRMYDTSGTVIYVGKAKDLKKRLASYFRAQVTSRKTESLVKNIVQI
UVRC_DEHE1      --------ETLQNQIASLPENPGVYLMKNAQGEIIYVGKAAVLKDRVKSYFVPPSRLEKTRQLVSQINEL
UVRC_PARUW      ------------KKIDLFPTLPGVYLMKNEEGEVLYVGKAKNLRQRVKQYVPGRDGRLMIPYLVAKINYI
UVRC_CLOAB      -------------QLKNLPDKPGVYIMKNSLGEVIYVGKAKILKNRVRQYFRNKNHSEKVKAMVKNISEF
UVRC_XYLF2      --------------------APGVYRMYAADDTLLYVGKAGALRKRVASYFNGTPKNTRLTAMLAQVVRM
UVRC_XYLFT      --------------------APGVYRMYAADDTLLYVGKAGALRKRVASYFNGTPKNTRLTAMLAQVVRM
UVRC_ALCBS      -------------------RKPGVYRMLDAEGGVLYVGKARNLQARLNSYFQKNVASVKTRALVGRIRDI
UVRC_CLOTH      ----------IQEELKKLPDKPGVYIMKDENGEIIYVGKAVVLKNRVRQYFQSSNQTPKVRAMVAHIKEF
UVRC_XANOR      --------------------APGVYRMYAGDDTLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_XANOP      --------------------APGVYRMYAGDDTLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_XANOM      --------------------APGVYRMYAGDDTLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_ERWT9      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRGNLGSRKTEALVALIEQI
UVRC_XYLFA      --------------------APGVYCMYAADDTLLYVGKAGALRKRVASYFNGTPKNTRLTAMLAQVVRM
UVRC_KLEP3      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVALIAQI
UVRC_JANMA      ---------IVLETVAKLPNLPGVYRYFDAEDNLLYVGKARDLKKRVSSYFLKNLASPRTALMVERIARL
UVRC_THIDA      ---------VDKEFLASLPTLPGVYRMVDAAGAVLYVGKAKDLRKRVGSYFLKTDQSPRIRLMLKSVDHI
UVRC_PSYCK      -----------------LPNLPGVYKMLGKNGDILYVGKAKSLKSRVNSYFAKTIDHPKTRALVARIHNI
UVRC_HERAR      -----------------LPNLPGVYRYFDAENNLLYVGKARDLKKRVSSYFLKNLASPRTALMVEKIARL
UVRC_HAEDU      -----------------VPHLPGVYRMYDANQAIIYVGKAKDLKKRLASYFRSQVASKKIEALVGNIHHI
UVRC_SHEFN      -----------------VTSAPGVYRMYDKHQQVIYVGKAKDLKKRLSSYFRVNIANVKTQALVSHIDHI
UVRC_BORPA      -----------------LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLASPRIAQMVAKVASV
UVRC_BORBR      -----------------LPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLASPRIAQMVAKVASV
UVRC_COXB1      --------------LKTLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFRRQLDS-KTQAMMAQVQSI
UVRC_BORPE      -----------------LPHLPGVYRHLDAAGEAMYVGKARDLKKRVSSYFQKNLASPRIAQMVAKVASV
UVRC_CLOTE      -------------QLKVLPEKPGVYLMKNSSDEVIYVGKAKILKNRVKQYFQQKNHSEKVRVMVSNIAEF
UVRC_SHEPC      --------------LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLDNVKTQALVSHIHHI
UVRC_PROMH      --------------LSRVTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRAQVNSRKTEALVKCIANI
UVRC_SHEB9      --------------LRTVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLANVKTQALVSHIHHI
UVRC_COXBR      --------------LKTLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFRRQLDS-KTQAMMAQVQSI
UVRC_COXBN      --------------LKTLPTGSGVYQIQDAQGKVIYVGKARNLQKRVSSYFRRQLDS-KTQAMMAQVQSI
UVRC_COXB2      --------------LKTLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFRRQLDS-KTQAMMAQVQSI
UVRC_SHEB8      --------------LRTVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLANVKTQALVSHIHHI
UVRC_ERWCT      --------------LKTVTSQPGVYRMYDAGNTVIYVGKAKDLKKRLASYFRSHVASRKTEALVKSIKHI
UVRC_SHESW      --------------LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLDNVKTQALVSHIHHI
UVRC_COXBU      --------------LKTLPTGSGVYQMQDAQGKVIYVGKARNLQKRVSSYFRRQLDS-KTQAMMAQVQSI
UVRC_PASMU      ----------------------GVYRMYDEKDTVIYVGKAKDLKKRLSSYFRTHLSSKKTEALVSAIARI
UVRC_DESAA      ----------IEKKLATLSNGPGVYLMKDESGEIIYVGKARSLKKRVSSYFLEKNRDLKTGILVKKIASF
UVRC_CLOBH      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_CLOB1      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_SHESA      --------------LRMVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHI
UVRC_CLOBM      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_ALISL      -----------------VTHQPGVYRMYNAEAEVIYVGKAKDLKKRLSSYFRSNIPSEKTKALVTHIAQI
UVRC_SHEB5      --------------LRTVSSSAGVYRMYDVKNDVIYVGKAKDLKKRLTSYFRKNLANVKTQALVSHIHHI
UVRC_CLOBK      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_CLOBJ      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_SHESM      --------------LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHI
UVRC_ENTFA      ----------IKNKLALLPDQPGCYLMKDKNGTIIYVGKAKILKNRVRSYF-RGSHDTKTERLVSEIDDF
UVRC_CLOCE      ----------IQEELKKLPDKSGVYIMKDANGVVIYVGKAVVLKNRVRQYFQQSNHPPKVQAMVSKVSEF
UVRC_CLOBL      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_MANSM      -----------KKFLANVTHDPGVYRMFDDKDTVIYVGKAKDLKKRLSSYFRANLSSKKTEALVASICRI
UVRC_CLOD6      ----------IQEHLKKLPSEPGVYLMKDKYDHIIYVGKAISLKNRVRQYFSSKNHTSKVKSMVKNIYKF
UVRC_BACSU      ----------LKEKLALLPDQPGCYLMKDRQQTVIYVGKAKVLKNRVRSYFTG-SHDAKTQRLVTEIEDF
UVRC_SHESR      --------------LRTVSSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHI
UVRC_FINM2      ----------IKKELQKVPHKPGVYIMHDKNDEIIYVGKAIDLRRRVGQYFDSSKKLAKVAAMVSHVEYF
UVRC_CLOPH      ------------EELKKLPAKPGVYIMHNNKDEIIYVGKAISLKNRVRQYFSSRNLSTKIQQMVSNIDHF
UVRC_EDWI9      --------------LKTVTNQPGVYRMYDAGAEVIYVGKAKDLKKRLSSYFRCQLASRKTEALVRQIAQI
UVRC_SHIDS      --------------LKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIQQI
UVRC_LISMH      -----MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSG-THDSKTQRLVQEIVDF
UVRC_LISMF      -----MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSG-THDSKTQRLVQEIVDF
UVRC_LISMC      -----MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSG-THDSKTQRLVQEIVDF
UVRC_CHRSD      --------------LKTVSESPGVYRMLDAEGNVLYVGKAKRLKARLASYFRGALNA-KTQALVSRIEDI
UVRC_LISIN      -----MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFSG-THDSKTQRLVQEIVDF
UVRC_BACAN      ----------LKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACAC      ----------LKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACAA      ----------LKEKLAILPDQPGCYLMKDRQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_CLOB6      -------------QLKNLPDKPGVYLMKNNLGEIIYVGKAKILKNRVRQYFQKQKHSEKVKAMVKNIEEF
UVRC_BACHK      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACCZ      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACC3      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACC0      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACAH      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_SHEON      --------------LRTVTSSAGVYRMYDVKGDVIYVGKAKDLKKRLSSYFRKNLGNVKTQALVSHIHHI
UVRC_LISW6      -----MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFSG-THDSKTQRLVQEIVDF
UVRC_BACC1      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_AZOSE      -----------RAFLRTVPEEPGVYRMIGADERVLYVGKAKNLKRRVSSYFQRTQPSPRIAMMVAQILRV
UVRC_ALKMQ      ----------IKEQLKLLPDKPGVYLMKNKANEIIYVGKAISLKNRVRQYFQSSNNQHPKVRMVTHINFF
UVRC_XANC5      --------------------APGVYRMYAGDDTLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_LISMO      -----MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKILKNRVRSYFSG-THDSKTQRLVQEIVDF
UVRC_BACC7      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_ENTS8      --------------LKTVTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVAQIHNI
UVRC_XANAC      --------------------APGVYRMYAGDDTLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_BDEBA      ----------VRDKVKEFPTQSGVYLMKNTADKIIYIGKAKNLRNRVRSYFNDKDHSPKTRLLVSNICEV
UVRC_SERP5      --------------LSTVTSQPGVYRMYDATGTVIYVGKAKDLKKRLASYFRQQVGSRKTETLVKNIAQI
UVRC_PSYA2      -----------------LPNLPGVYKMLGKNGDILYVGKAKSLKSRVNSYFAKTIDHPKTRALVARIHNI
UVRC_BACCQ      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_SHEDO      -----------------LSSSAGVYRMYDAKGEVIYVGKAKDLKKRLSSYFRANLGNIKTQALVSHITNI
UVRC_CHRVO      -----------RNVLQNLPTLPGVYRMLDAAGKVLYVGKAIDLKRRVSSYFQKNDLSPRIQLMVRQIASI
UVRC_CLOK5      ------------QQLKILPDKPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQKKNHSEKVRTMVKHISEF
UVRC_BACC2      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_STRMK      --------------------APGVYRMYAADDTLLYVGKARALRNRVGSYFNGSPKNARIMSMISQIVRM
UVRC_BACC4      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_STRM5      --------------------APGVYRMYAADDTLLYVGKARALRNRVGSYFNGSPKNARIMSMISQITRM
UVRC_VIBF1      --------------LKSVTHQPGVYRMYNAEADVIYVGKAKDLKKRLSSYFRSNVPSEKTKALVSHIHQV
UVRC_RALSO      -----------------LPSLPGVYRYFDAQGSVLYVGKARDLKKRVSSYFTKTLLSPRIAMMVAKIAHI
UVRC_XANCP      --------------------APGVYRMYAADDSLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_XANC8      --------------------APGVYRMYAADDSLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_BACWK      ----------LKEKLAILPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_BACCR      ----------LKEKLAISPDQPGCYLMKDKQGTVIYVGKAKVLKNRVRSYFTG-SHDGKTLRLVGEIVDF
UVRC_GEOKA      ----------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKARVRSYFTG-THDGKTQRLVEEIADF
UVRC_XANCB      --------------------APGVYRMYAADDSLLYVGKAGALRKRVGSYFNGTPKNARLTSMLSQVARM
UVRC_STAAB      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAU      -------KKRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAR      -------KKRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_CLOB8      -----------KAQLKILPNEPGVYLMKNSLGEIIYVGKAKILKNRVRQYFQNKNHSEKVKAMVKNVAEF
UVRC_VIBCM      --------------LKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALVSNIAKI
UVRC_VIBCH      --------------LKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALVSNIAKI
UVRC_VIBC3      --------------LKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLTSYFRKNLDSEKTKALVSNIAKI
UVRC_STAAT      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAN      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAM      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAE      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAC      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAA9      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAA8      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAA3      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAA2      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAA1      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAW      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_STAAS      -------KQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRRF
UVRC_PSYWF      -----------------LPNLPGVYKMLGKNGDILYVGKAKSLKSRVNSYFAKTIDHPKTRALVSRIHDI
UVRC_CLONN      -------------QLKIIPEKPGVYLMKNSLGEVIYVGKAKVLKNRVRQYFQNKNHGSKVRAMVKNIAEF
UVRC_SYMTH      ----------LEEQLRLLPDRPGCYLFKDASGRIIYVGKARNLKNRVRQYFSSRNLTAKVLAMVGQIVEI
UVRC_STACT      ----EAYKEKIKEKLSVVPFEPGCYLMKDRNNQVIYVGKAKRLRNRLRSYFTGA-HDAKTTRLVGEIRNF
UVRC_STAEQ      ----------IKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGA-HDAKTTRLVGEIRNF
UVRC_PROMP      -------KDLLKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKTLRNRVSSYFNNYAELSRLSLMVRQITEI
UVRC_THETN      ----------------------GVYLMKDEEGNIIYVGKASVLKNRVRQYFQNTNHPPKVKVMLSHVEDF
UVRC_FRAP2      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRVNSYFSKGAKDSKTLMMVEQVARI
UVRC_OCEIH      ----------IEKKLSILPQQPGCYLMKDKNGTVIYVGKSKKLRNRVRSYFRGANDR-KTQRLVQEIRDF
UVRC_STAES      ----------IKEKLNVVPLEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGA-HDAKTTRLVGEIRNF
UVRC_ANASP      -----LVKDPERLEARLIPPEPGVYFMRDGSDRIIYIGKSRKLRSRVRSYFREGNKTERIATMAKLVTEI
UVRC_RALEJ      -----------------LPGLPGVYRYIDSAGNVLYVGKARNLKKRVSSYFNKTQLSPRIAMMVAKIARI
UVRC_MOOTA      ----------LEEKLARLPDHPGVYIMHDANGAIIYVGKAASLRNRVRSYFRGQ-HQPRTQAMVSHVADF
UVRC_CARHZ      -----------------LPDSPGVYLYKDEKGEVIYVGKAKNLKNRVRSYFQPPEKLLKTRVMMEKARDI
UVRC_STAHJ      -------KEKIKNKLSVVPFEPGCYLMKDRNDQVIYVGKAKRLRNRLRSYFTGA-HDAKTTRLVGEIRNF
UVRC_PROAC      -----------------IPTQPGVYRFSDAHGQVIYVGKAKNLRNRLNSYFQDISALHRTQRMVTTAAHV
UVRC_BURM1      -----------KKILAQLPHMPGVYRYYDAAGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_STAS1      ----ETYQEKIKQKLTVVPIEPGCYLMKDRNDQIIYVGKAKKLRNRLRSYFTGA-HDAKTTRLVGEIRNF
UVRC_BACLD      ----------IKEKLALLPDQPGCYLMKDRQDTVIYVGKAKILKNRVRSYFSG-SHDAKTQRLVSEIEDF
UVRC_GLOVI      ------------------PTSAGVYLMRDEAGEILYVGKAKNLRNRVRSYFQPHDHSPRIAIMVGKVHDF
UVRC_TRIEI      ----------LENRLKEIPQTPGVYLMRDRSDRILYIGKSKKLRNRVRSYFRDKNHTHRISLMIQQIVEI
UVRC_STRU0      --------ELIKYKLELLPDSPGCYLHKDKHGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEMLVSEIEDF
UVRC_NOSP7      ----------LENRLAEIPPEPGVYFMRDNSDRIIYIGKSRKLRSRVRSYFRDGNKTERIATMVKLVTEI
UVRC_DESPS      ------------KILQSTPHKPGVYLMLDAKARVIYVGKAKDLVKRLTSYTRHSSEHNKTTVMLKKVEQV
UVRC_ANADF      ----------LRKTLDELPAEPGCYLMKDRRGAVVYVGKASSLRSRVRSYFASRGDDRAFVALLDELLDV
UVRC_FRATM      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRVNSYFSKGAKDSKTLMMVEQIARI
UVRC_MICAN      --------DRLENRLREIPLEPGVYFLRDQNGEILYIGKSKKLRSRVRSYFRPSQPLSRIALMVRQVTEI
UVRC_CLOPS      -------------QLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNKNHSEKVRAMVKNIAEF
UVRC_SYNAS      -----MNRQQLEGRIDIAPRTPGVYLMKDAAGKILYVGKAKNLKSRTRAYFSGTDSRAMIPFLVSRIHDI
UVRC_BURS3      -----------KKILAQLPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_RALME      -----------RPILARMPGLPGVYRYFDADGNILYVGKARDLKKRVSSYFNKTQLSPRIAMMVAKIARI
UVRC_FRATN      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRVNSYFSKGAKDSKTLMMVEQIARI
UVRC_FRATO      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRINSYFSKGAKDSKTLMMVEQIARI
UVRC_FRATF      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRINSYFSKGAKDSKTLMMVEQIARI
UVRC_FRATH      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRINSYFSKGAKDSKTLMMVEQIARI
UVRC_FRATW      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRVNSYFSKGAKDSKTLMMVEQIARI
UVRC_ANASK      ----------LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDPGRGDQRAFVALLDELDL
UVRC_BURCH      -----------KKILAQLPHMPGVYRYYDTTGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_BURCA      -----------KKILAQLPHMPGVYRYYDTTGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_ANAVT      -----LVKDPERLEARLIPPEPGVYFMRDGSDRIIYIGKSRKLRSRVRSYFREGNKTERIATMAKLVTEI
UVRC_BURCC      -----------KKILAQLPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_LYSSC      --------DLIKRKLDILPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTG-THEGKTQRLVSEIEDF
UVRC_SYNWW      -----MGDEMLKERLKKVPLQPGVYLFKNQEGQVLYVGKARVLRQRMRSYAPERMHP-KVKAMMAWVSDF
UVRC_CHLPN      --------------LKLIPSSPGVYLMKDVHDQVLYIGKAKNLKNRLASYFHEKGDSRRIPFLMKKTASI
UVRC_BURVG      -----------KKILAQLPHMPGVYRYYDATGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_SYNY3      ---------------------PGVYFMGDRQGEILYIGKAKKLRTRVRSYFRDSQHTARIALMVQQVAEI
UVRC_MYXXD      ------------EKLDALPTEPGVYLMKDRRGQVIYVGKAINLRSRVRSYFNRTGDTRVFVSLLDQLLDL
UVRC_CLOP1      -------------QLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNKNHSEKVRAMVKNIAEF
UVRC_BACHD      -------KDHIKQKLTVLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTG-SHDAKTQRLVGEIADF
UVRC_ANADE      ----------LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYAGRGDQRAFVALLDGLLGDL
UVRC_STRP7      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_POLSJ      ---------------------PGVYRYFDAEGGVLYVGKARNLKKRVSSYFQKNHGATRIGHMVTKIVRM
UVRC_FRATT      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRVNSYFSKGAKDSKTLMMVEQIARI
UVRC_FRAT1      ----------------------GVYRMLDKHGEIIYVGKAKNLKNRVNSYFSKGAKDSKTLMMVEQIARI
UVRC_STRZP      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRPN      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRP4      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_CALS8      ----------LQEKLANLPTTPGVYMMKDENGKVIYVGKAVNLRNRVRQYFQNSDMTPKTRLMVKKIKDF
UVRC_STRZT      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRSV      ---------LIQSKLELLPTSPGCYIHKDKNDTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIEDF
UVRC_BREBN      ----------LKDKLAVLPDKPGCYLMKNASGEIIYVGKAKVLKNRVRSYFTG-SHNGKTQLLVSEIVDF
UVRC_STRPS      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRPJ      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRZJ      --------NLIKSKLELLPTSPGCYIHKDKNGSIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_METBU      ----------MRPDISNIPELPGVYLMKDISDNIIYIGKAKSLKKRVSQYFSSKNHSSKTRAMVRKIADV
UVRC_ANAD2      ----------LRRKLDELPAEPGCYLMKDRAGEVVYVGKASSLRSRVRSYFDPGRGDQRAFVALLDELDL
UVRC_STRR6      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRP2      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRGC      ---------LIQSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRPI      --------NLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF-RGSHDTKTEALVSEIVDF
UVRC_STRPG      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRP8      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_DICT6      ----------LKQKVENFPESTGVYIFYDHSGKVIYVGKAKNLRKRVLSYFNDSNYILKKAK------NI
UVRC_BACA2      ----------LKEKLALLPDQPGCYLMKDRQKTVIYVGKAKVLKNRVRSYFTG-SHDAKTQRLVSEIEDF
UVRC_ACIBL      ----------LHQKIRTLPTSPGVYLYKNAEGEIIYVGKAKNLRSRVGSYFADENS--KTGSLLREAVDV
UVRC_METST      -----------------VPQKPGVYIMHNKEDEVIYVGKAKKLKSRLQSYFRDEDKLDRTQFLMRHFSYF
UVRC_LACRJ      -----MASEHLEHKLALLPDKPGCYLMKNINDQIIYVGKAKNLKNRVRSYF-KSSHTGKVAKMVSEVADF
UVRC_LACRD      -----MASEHLEHKLALLPDKPGCYLMKNINDQIIYVGKAKNLKNRVRSYF-KSSHTGKVAKMVSEVADF
UVRC_DESAH      ------------------PQNPGVYLMKDKRGTIIYVGKALNLKKRLASYFAETGHDMKTGVLLKKVVDF
UVRC_CLOPE      -------------QLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQNKNHSEKVRAMVKNIAEF
UVRC_RHOFD      -----------------LPPLPGVYRYFDFDGAVLYVGKAINLKKRVSSYFQKNHGGTRIGHMVSKIVRL
UVRC_THEP3      ----------IEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKMLSHVEDF
UVRC_GEMAT      ----------VAQKLPHLPESPGVYLWKDVEGQVLYVGKAKRLRSRVRSYWAQEHESSKTRAMVRKVRDL
UVRC_STRPM      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRP6      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_PROM1      -----------------IPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELSRISLMVRQVADI
UVRC_THEPX      ----------IEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQNKEKQLPKVKMLSHVEDF
UVRC_STRPZ      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRPF      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRPD      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRPC      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRPB      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_STRP3      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_PROMT      -----------------IPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELSRISLMVRQVADI
UVRC_SYNJB      -------RDVLESRLKEIPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTSDLSRIQRMVAQVCEI
UVRC_STREM      --------ELIKHKLELLPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYF-RGSHDTKTELLVSEIADF
UVRC_CHLFF      ----------------IIPPSPGVYLMKDSSGEVLYIGKAKNLRNRITTYFQKQGDSRRIPFLMKKTTDI
UVRC_SYNJA      --------EVLESRLKEIPAEPGVYLMRDATDQILYVGKSKKLRSRVRSYFRFTGDLSRIQRMVVQVCEI
UVRC_STRP1      --------ELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYF-RGSHDTKTELLVSEIVDF
UVRC_PEDPA      -----MASEHIEHKLALLPDKPGCYQMKNLNSQIIYVGKAKNLKNRVRSYF-KSSHEGKTAKLVSEIADF
UVRC_STRMU      --------ELIKHKLELLPDSPGCYIHKDKNGTIIYVGKAKNLKNRVRSYF-HGSHNTKTELLVSEIEDF
UVRC_CHLTR      -----------------VSSSPGVYLMKDSQGTVLYVGKAKNLRNRLSSYLQKKGDSRRIPFLMKKTTDI
UVRC_CHLTA      -----------------VSSSPGVYLMKDSQGTVLYVGKAKNLRNRLSSYLQKKGDSRRIPFLMKKTTDI
UVRC_STRE4      --------ELIKHKLELLPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYF-RGSHDTKTELLVSEIADF
UVRC_LACS1      ----------IENKLKLLPDLPGCYMMKDINSRIIYVGKAKNLKNRVRSYF-KSSHEGKTAKLVSEIRNF
UVRC_BACP2      ---------LIKEKLSVLPDQPGCYLMKDRQNTVIYVGKAKILKNRVRSYFTG-SHDAKTQRLVSEIEDF
UVRC_STRS7      --------ELIKHKLELLPDSPGCYLHKDKAGTIIYVGKAKNLRNRVRSYF-RGSHDTKTELLVSEIADF
UVRC_STRA5      --------ELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYF-HGSHNTKTELLVSEIEDF
UVRC_CHLAB      ----------------LIPASPGVYLMKDSSGEVLYIGKAKNLRNRISTYFRKDGDSRRIPFLMKKTTDI
UVRC_STRAW      -----------------IPDSPGVYKFRDEHHRVIYVGKAKSLRQRLASYFQDLAGLHRTRTMVTTAAXX
UVRC_GEOLS      ----------LRDSIRSFPTAPGVYLMRDATGTILYVGKARNLRQRVSNYFGATDGRPQVRFLMARVTSI
UVRC_FUSNN      -----------------IPESSGVYLMKKNNKVI-YVGKAKNLKNRVSSYFNRVHESEKTNELVKNIEDI
UVRC_STRT1      --------DLIKHKLELLPSNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYF-RGSHDTKTELLVSEIADF
UVRC_STRA3      --------ELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVKSYF-HGSHNTKTELLVSEIEDF
UVRC_LACLM      ----------IKAKLELLPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYF-HGSHNTKTELLVSEIEDL
UVRC_STRT2      --------DLIKHKLELLPNNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYF-RGSHDTKTELLVSEIADF
UVRC_LEPIC      -----LNHTLILEKIKNLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKENHPDVKTKVLQREIFDL
UVRC_STRA1      --------ELIKHKLELLPDSPGCYLHKDKNGTIIYVGKAKNLKNRVRSYF-HGSHNTKTELLVSEIEDF
UVRC_LEPIN      -----LNHTLILEKIKNLGASPGCYLWKSKKGEVLYVGKAKNLDKRVRSYLKENHPDVKTKVLQREIFDL
UVRC_LACBA      -----MASEYLEHKLALLPGLPGCYLMKNINSQIIYVGKAKNLKNRVRSYF-KSSHTGKTAQLVSEIVDF
UVRC_GEOMG      -----------KSRLNTLPESPGVYLMKGSDGTILYVGKAKSLRKRVRSYAGESRYHIRF--LVARVAEV
UVRC_CORJK      -----------RPEPGSIPTDPGVYTFRDAHERVIYVGKAKNLRARLSNYFQDLDQLHRTRAMVQSANHV
UVRC_CHLCV      ----------------LVPTSPGVYLMKDDSGEVLYIGKAKNLRNRITTYFQKQGDSRRIPFLMKKTTTI
UVRC_PROM9      -------KELLKSRLSEIPKSSGCYLFKDIDNNLLYIGKSKKLRSRVSSYFNNYSDLTRLSLMVRQITEI
UVRC_LACPL      ----------IEHKLSLLPDLPGCYLMKNLNSQIIYVGKAKNLKNRVRSYF-KSSHTGKTARLVSEIADF
UVRC_COREF      -----------------IPTEPGVYKFRDDARRVIYVGKAKNLRARLSNYFQDVTQLHRTRQMVFAASSV
UVRC_CYAP4      --------DRLESRLKEIPAEPGVYFMRDSQDQILYIGKSKKLRSRVRSYFRKFNELPRLELMVRQVAEI
UVRC_THEFY      -------RPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHRTQTMISTAADV
UVRC_STRTD      ---------LIKHKLELLPSNPGCYLHKDKFGNIIYVGKAKNLKNRVRSYF-RGSHDTKTELLVSEIADF
UVRC_RENSM      -----------------IPTDPGVYRFRDEHGRVIYVGKAKNLRSRLTSYFANPVTLLKTFAMVHTATSV
UVRC_LACLA      ----------IKAKLELLPDSPGCYLHKDKNGTVIYVGKAKNLKNRVRSYF-HGSHNTKTELLVSEIEDL
UVRC_LEPBL      --------------------SPGCYLWKSRKGEVLYIGKAKNLDKRVRNYLKENHPDIKTRALQKEIFDL
UVRC_LEPBJ      --------------------SPGCYLWKSRKGEVLYIGKAKNLDKRVRNYLKENHPDIKTRALQKEIFDL
UVRC_ACAM1      -------RDRLEARLKEIPPEPGVYFMRDANDDILYIGKSKKLRNRVRSYFRQQDHPPRIELMVHQVADI
UVRC_METMP      -----------------IPKNPGCYIYKNESGTVIYVGKAKNLKKRVSSYFNKKNHDPKTEKLVKSIYEM
UVRC_PROM4      -----------------IPSEPGCYLMRDKNETLLYIGKSKSLKSRVRSYFNTNNTALRISLMVRQVYDI
UVRC_MYCLE      -----------------IPVEPGVYRFRDPYGRVIYVGKAKSLRSRLASYFADVANLHRTRQMVTIAAKV
UVRC_MYCLB      -----------------IPVEPGVYRFRDPYGRVIYVGKAKSLRSRLASYFADVANLHRTRQMVTIAAKV
UVRC_DESHY      --------EILREKLSLLPDKPGVYLMKDASGQIIYVGKAKVLKNRVRSYFTG-SHNGKTQLMISLIADF
UVRC_ARTCA      -----------------IPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPAGLLKTYAMVHAASSV
UVRC_LACSS      -----MASEHIEHKLALLPALPGCYLMKDINAQIIYVGKAKNLKNRVRSYF-KSSHEGKTAKLVSEIVDF
UVRC_PELCD      ------------------PTASGVYLMKGEAGTVFYVGKAKNLRSRLRSYFSEHGDNRPQIRLLKRVHDI
UVRC_RHOE4      -----------------IPAAPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVTTLHRTRQMVTTAGXX
UVRC_BACSK      --------ETITNKLALLPDKPGCYLMKDRQGTIIYVGKAKVLKNRVRSYFTG-SHDSKTQRLVGEICDF
UVRC_MYCTU      -----------------IPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLARTRQLVTTAAKV
UVRC_MYCTA      -----------------IPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLARTRQLVTTAAKV
UVRC_MYCBT      -----------------IPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLARTRQLVTTAAKV
UVRC_MYCBP      -----------------IPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLARTRQLVTTAAKV
UVRC_MYCBO      -----------------IPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLARTRQLVTTAAKV
UVRC_CHLMU      -----------------VSSSPGVYLMKDSQGVVLYVGKAKNLRNRLSSYLQKNGDSRRIPFLMKRTADI
UVRC_MYCMM      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADIAHLQRTRQMVTTAAKV
UVRC_OENOB      -----MASELIEQKLALLPSQPGSYQMKDKNGKIIYVGKAKNLKNRVRSYF-KAEHTGKTAELVANIHDF
UVRC_GEOSL      ------------KRLTTLPDAPGVYLMKGNGGDILYVGKAKSLRKRVRSYFSESRYHIRF--LVGRVADI
UVRC_CHLCH      -------KKVLTEKLATLPTSPGIYQFKNSAGRIIYVGKAKNLRNRVRSYFRNSHQLFKTLVLVSHIDDL
UVRC_ARTS2      -----------------IPTNPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFANPGGLLKTYAMVHAASSV
UVRC_KOCRD      -----------------IPTNPGVYRFRDEHGRVIYVGKAKNLRNRVSSYFAPLHQLAKTRXXXXXXXXX
UVRC_NOCFA      -----------------IPVEPGVYKFRDSYGRVIYVGKAKSLRSRLNSYFADVASLHRTKQMVTTAAXX
UVRC_NAUPA      ------------EKIKSLPDQPGIYQYFDENGKLLYIGKAKSLKKRVKSYFRADNLSPRIYKMISEAKDL
UVRC_LACF3      -----MASEYLEHKLALLPDQPGCYLMKNANAQIIYVGKAKNLKNRVRSYF-KSSHTGKVAAMVEEVADF
UVRC_LACDB      -----MASQLIENKLKLLPEKAGCYLMKDVNGKVIYVGKSKNLKNRVRSYFKSSQEG-RRAELVKNIADY
UVRC_LACDA      -----MASQLIENKLKLLPEKAGCYLMKDVNGKVIYVGKSKNLKNRVRSYFKSSQEG-RRAELVKNIADY
UVRC_CHLTE      -------KSALAEKLATLPTSPGVYRFSNAAGTVIYVGKARNLRNRVRSYFSQGRQPGKTAVMVSHIADL
UVRC_CHLPD      -----------------LPSSPGVYQFKNAQGRVIYIGKAKNLRNRVRSYFRNPQQLFKTLVMVGKIADI
UVRC_GRAFK      -------KPALEVQLKTLPNSPGVYQYFDKNGKILYVGKAKNLKKRVTSYFNKNHDSHRIGVMVKKICEI
UVRC_METTH      ------------KDPEKLPDATGVYIFRDRDDRVLYVGKSISIRKRVSSYFREQENP-RLRIMMRHLESI
UVRC_MYCGI      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADISGLARTRQMVMTASSV
UVRC_RHOSR      -----------------IPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHRTRQMVTTAGXX
UVRC_LACGA      ----------IENKLKLLPDKPGCYLMKDINGNVIYVGKSKNLKNRVRSYFKSKQ-VGRRAELVREIRDF
UVRC_LEPBP      MKDSLVLK-TIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNPNQKDRKTRALFVELYDL
UVRC_LEPBA      MKDSLVLK-TIQEKIKNLGSLPGCYLWKNELGQVIYVGKALKLQSRVRSYLNPNQKDRKTRALFVELYDL
UVRC_CAMJD      -------KEKLENELKTLPNSAGVYEYFNQEGKLLYVGKAKNLKNRVKSYFANPGNSLRIQKMIQETVHL
UVRC_MYCA9      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADITGLHRTRQMVTTAGSV
UVRC_PROMA      ----------LKTTLDNIPKAPGCYLMKDNEDNIIYIGKSINLNSRVKSYFRRRNNNPKNSLMLKQVSLI
UVRC_MYCPA      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADVANLHRTRQMVTTAAKV
UVRC_ARTAT      -----------------IPTTPGVYRFRDPHGRVIYVGKAKNLRSRLNSYFANPAGLLKTHAMVHAASSV
UVRC_MYCPE      ----------IKDKLKKIPHKPGCYLWKDKNGIVIYVGKAVDLANRIKQYFL-KDRDLKTKKLANEICDV
UVRC_CAMJE      -------KENLENELKTLPNSTGVYQYFNQEGKLLYVGKAKNLKNRVRSYFANPRNSLRIQKMIEETVHL
UVRC_PROMM      ----------LEQRLKEIPAEPGCYLMRDVEDRLLYVGKSKCLRNRVRSYFSSSDHGPRIRLMVRQIAEI
UVRC_GEOSM      ------------------PSSPGVYLMKSADDTVIYVGKARNLKKRVRSYAGDRDSRIHIRFMVQLVHSV
UVRC_GEOSF      ------------------PSSPGVYIMKDAEATVLYVGKARDLRKRIRSYFAASGDSRYQIRFLARVTDI
UVRC_GEOBB      ------------------PPSPGVYLMKSADDTVIYVGKARNLKKRVRSYAGDRDSRIHIRFMVQLVHSV
UVRC_SYNS3      -----------------IPTEPGCYLMRDADDRLLYVGKSKTLRSRVRSYFRSSHDLSPRIRMVRQICEI
UVRC_LACJO      ----------IENKLKLLPDKPGCYLMKDVNGNVIYVGKSKNLKNRVRSYFKSKQ-VGRRAELVREIRDF
UVRC_SOLUE      ----------LRDKVGQLPFSPGVYLYKDSGGKVIYVGKAKSLRNRVRSYFSEKLGDIKTGTLITEACDI
UVRC_CAMJR      -------KENLENELKTLPNSAGVYQYFNQEGKLLYVGKAKNLKNRVKSYFANPRNSLRIQKMIEETVHL
UVRC_DEIRA      -------------DLPVLPTTPGVY-IFRKGGVPIYIGKANNLRSRVSQHFKAGG---KSGKFTKLAESL
UVRC_CAMJ8      -------KENLENELKTLPNSAGVYQYFNQEGKLLYVGKAKNLKNRVKSYFANPRNSLRIQKMIEETVHL
UVRC_VEREI      ----------------------GVYRYFDSQGLLLYVGKARHLKRRVASYFTKNHGGTRIGHMVCKIARL
UVRC_BEUC1      -----------------IPDAPGVYRFRDPHGRVVYVGKAKSLRSRLSSYFQDLSALHRTQQMVTTASSV
UVRC_CAMJJ      -------KENLENELKTLPNSAGVYQYFNQEGKLLYVGKAKNLKNRVKSYFANPRNSLRIQKMIEETVHL
UVRC_SYNP6      --------DRLEARLRELPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLERLNRINLMVRQVCEI
UVRC_SYNE7      --------DRLEARLRELPAEPGVYFMRDASDRILYIGKSKKLRSRVRSYFRDLERLNRINLMVRQVCEI
UVRC_RUBXD      -----------------LPASPGVYIFRDGEGRVLYVGKARNIRSRVASYFTRSGDRPKIAELRERVRQI
UVRC_MYCSS      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLARTRQMVMTAAKV
UVRC_MYCSK      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLARTRQMVMTAAKV
UVRC_MYCSJ      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLARTRQMVMTAAKV
UVRC_ACIC5      ----------LQEKIRTLPTGPGVYLYKNADGEVIYVGKAKNLRSRVRSYLLEASQAAKTGSLMREAVDL
UVRC_PROA2      ------------KKLSNLPTCPGVYQFKNNQGTIIYVGKAKNIRSRVRSYFREGPHISKTKVLVNHIADI
UVRC_SYNPX      --------EVLERRLKEIPPEPGCYLMRDGEDRILYVGKSKSLRSRVRSYFRSRHDLSPRIRLMTQVCEI
UVRC_CORGL      -----------------IPTEPGVYKFRDENRRVIYVGKAKNLRSRLSNYFQDVTQLHRTRQMVFXXXXX
UVRC_CORGB      -----------------IPTEPGVYKFRDENRRVIYVGKAKNLRSRLSNYFQDVTQLHRTRQMVFXXXXX
UVRC_CYTH3      -----LEKEDIRSLLKELPSSPGVYRFYSIEKELIYVGKAKSLRKRVANYFTNKKNLDQKTRMVRKIYHA
UVRC_SYNSC      ----------LERRLKEIPAEPGCYLMRDCDDRILYVGKSKALRSRVRSYFRSRHDLSPRIRLMTQVCEI
UVRC_LACCB      ----------IEHKLSLLPDLPGSYQMKDINGKIIYVGKAKNLKNRVRSYF-KSSHDGKVAAMVSQVADF
UVRC_HELP2      ----------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSIRNNEIRVQMMVKQIAFL
UVRC_LACC3      ----------IEHKLSLLPDLPGSYQMKDINGKIIYVGKAKNLKNRVRSYF-KSSHDGKVAAMVSQVADF
UVRC_SALRD      --------EVLVQKLDALPTDPGVYKFLDDEESVLYVGKAKNLRNRVRTYFQQRQRDGRIEVMVQKAVDV
UVRC_ACIC1      -----------------IPESPGVYRFWDAHDRVIYVGKAKNLRARLTSYFADPALLHRTRAMVTAAARL
UVRC_DESAP      ------------------PDKPGVYLFRGARGEVLYVGKAVSLKNRVRSYFTGARSD-KVQALVGKTRDV
UVRC_LEIXX      -----------------IPTQPGVYRFRDKTRRVLYVGKAKNLRARLSNYFQPLRSLHRTRRMVTTAASV
UVRC_MYCVP      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADLSGLARTRQMVMTAAXX
UVRC_HELPY      ----------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSIRNNEIRIQMMVKQIAFL
UVRC_MESFL      ----------LKNKVSNLPSKPGCYLYLNKDKHVIYVGKAKNLKKRVSSYF-DRAQNLKTTRLVREIADL
UVRC_HELPG      ----------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSICNNEIRIQMMVKQIAFL
UVRC_THEP1      -------KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSSRLRSYLNPQTE--KVFRIVEEADEL
UVRC_ARCB4      ----------LQEKLQQLPNDAGVYQYFDKNGHLLYIGKAKILKNRVKSYFKFTPKLQRIYKMISEVESC
UVRC_LAWIP      -----------------IPTTPGVYLYKDSQGRIIYVGKARNLRKRVLSYFRDGLVITKTKAMMNHANLL
UVRC_HELPJ      ----------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSVRNNEIRVQMMVKQIAFL
UVRC_PELLD      ----------LRETVASLPTGPGIYQFKNSAGKVIYVGKAKNIRSRVRSYFRDPRQLTKTQVLVGHITDL
UVRC_PORG3      -------RDELNIILPTLPEKPGCYQYFDEDGKVIYVGKAKNLRRRVSSYFYKEHADRKTRILVRQIRSI
UVRC_PETMO      -----------RSILNNIPKKPGVYIFKNNKGDPIYIGKAKNLKNRVSSYFNKKNYIEKTYEMLEKATNL
UVRC_HELPS      ----------------------GVYQYFDKNHQLLYIGKAKNLKKRIKSYFSVRNNEIRIQMMVKQIAFL
UVRC_THESQ      -------KEKIRKKILLASEEPGVY-IFKNKGVPIYIGKAKRLSSRLRSYLNPQTE--KVFRIVEEADEL
UVRC_THEMA      -------KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEADEL
UVRC_THEEB      -------RDRLEQVLRQLPLAPGVYFLKDKTDQILYIGKSKRLRSRVRSYFREPAQLPRLERMVYQVAEI
UVRC_PORGI      --------------LPTLPEKPGCYQYFDEDGKVIYVGKAKNLRRRVSSYFYKEHADRKTRILVRQIRSI
UVRC_HELPH      ----------------------GVYQYFDKNRQLLYIGKAKNLKKRIKSYFSIHNNEIRIQMMVKQIAFL
UVRC_HELAH      -----------------------VYQYFDKNRQLLYIGKAKNLKKRIKSYFSIHNNEIRIQMMVKQIAFL
UVRC_SYNS9      ----------LERRLKDIPAEPGCYLMRDGDDRILYVGKSKTLRSRVRSYFRSRHDLSPRIRLMTQVCEI
UVRC_LACAC      -----MATELIENKLKLLPEKPGCYLMKDINGTVIYVGKSKNLKNRVRSYFKSKQ-VGRRAELVREIRDY
UVRC_BACTN      -----------------LPEKPGVYQYLNTEGTIIYVGKAKNLKKRVYSYFSKEHEPGKTRVLVSKIADI
UVRC_MYCGA      ----------LKQKLDLAPKKPGCYLWKNHLNEIIYIGKAKNIYKRVHQYFNGPKD-LKTSKLVNEIFYV
UVRC_PELPB      -------KKALVEKLGTLPPSPGVYQFRNSSGRVIYVGKAKNLRNRVRSYFRNQQQLYKTLVLVTHIADF
UVRC_LACH4      -----MATQLIENKLKLLPEKPGCYLMKDINGTVIYVGKSKNLKNRVRSYFKSKQ-VGRRAELVREIRDY
UVRC_METMA      -------------DLEALPHLPGCYLFKDEEGIVLYVGKAKDLKKRVSSYFQKRDHDPKTASLMQFARGL
UVRC_MYCMS      ----------LKQQVDLLPNKPGCYLFFNKDNDVIYVGKAKNLKKRVSTYF-NKAYNIKTTRLVREITDL
UVRC_CORDI      -----------------IPTEPGVYKFRDPEGRVIYVGKAINLRSRLSNYFQDLSVLHRTRQMVTTATSV
UVRC_FRASN      -----------------IPETPGVYRFRDEHGRVIYVGKAKSLRARLANYFADIHTLHRTQHMVTTAGXX
UVRC_BACFR      LKTSEYLKGIVSN----LPEKPGIYQYLNAEGTIIYVGKAKNLKRRVYSYFSKEHQPGKTRVLVSKIADI
UVRC_BACFN      LKTSEYLKGIVSN----LPEKPGIYQYLNAEGTIIYVGKAKNLKRRVYSYFSKEHQPGKTRVLVSKIADI
UVRC_HELHP      -----------------LPTQSGIYQFFDNEDTLLYVGKAKNLKNRIKSYLSENKHIVRIALMVSQITRI
UVRC_FLAJ1      -----MSKPSLDLQILTLPDNPGVYQYYDKDGKILYVGKAKNLKKRVSSYFNKIHDTAKTNXXXXXXXXX
UVRC_METBF      -------------DLEALPHLPGCYLFKNEEGTVIYVGKAKDLKKRVSSYFQKREHDPKTASLIEAVRGF
UVRC_FLAPJ      -------------QIQTLPDNPGVYQYYDKDGKILYVGKAKNLKKRVSSYFNKVHDTAKTNXXXXXXXXX
UVRC_HALWD      ----------------------GVYQFLED-NTVRYVGKALELRDRVRSYADPRSERIR--QMVARADDI
UVRC_METHJ      -------------DLTTIPEEPGCYQFKDETGTILYVGKAKNLKKRVSSYFQKKSITPRIDILVSLIRDI
UVRC_TREDE      ------------------PKTSGVYLWKDKAGTVIYVGKAKSLKNRLSSYFTS-NRDIKTRILVSRAESI
UVRC_BORGA      -----------------LPTTSGCYKMLNENKKILYIGKAKNLRSRIKSYFLEKSHKIKI--LMKNVKSI
UVRC_SULDN      ----------LRECIKQLPDSAGVYQYFDKDGHLLYIGKAKSLAKRVKSYFPNSNLSSRISKMISQTHTL
UVRC_TROW8      -----------------IPCKPGVYRFEDENGRILYVGKAKNLRNRLGSYFTNARRGRRISYMLSISKKV
UVRC_CORA7      -----------------IPTDPGVYKFRDENRRVIYVGKAKNLRARLSNYFQDITQLHRTRQMVLTAASV
UVRC_TROWT      -----------------IPCKPGVYRFEDENGRILYVGKAKNLRNRLGSYFTNARRGRRISYMLSISKKV
UVRC_AYWBP      ---------ILLEKIKTLPPNPGCYLFKNTKDTIIYVGKAKNLKKRVQSYFTKRNNL-KTAMLIEETQDF
UVRC_METAC      -------------DLEALPHLPGCYLFKDEEGVVLYVGKAKDLKKRVSSYFQKRDHDPKTTSLVQAARGL
UVRC_MYCCT      ----------LKEQVDLLTNKPGCYLFLNKDNEVIYVGKAKNLKKRVSTYF-NKAYNIKTTRLIREITHL
UVRC_HALMA      --------DEVRERAGSLPREPGVYLFRDDKRRVLYVGKAVDLRDRVRSYADPRSE--RIAKMVERAETI
UVRC_UREU1      --------DLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFGPKDN--KTSKLVSNIKDL
UVRC_FRASC      -----------------IPETPGVYRFRDEHGRVLYVGKAKNLRARLANYFAELHTLHRTQHMVSSASSV
UVRC_UREPA      --------DLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFCKDN---KTSKLVNNINDL
UVRC_UREP2      --------DLLKNKLKLIPHKPGCYLWKDQFNQIIYIGKAKDLYNRTHSYFCKDN---KTSKLVNNINDL
UVRC_HYDS0      ------------------PEEPGVYIFKNQKHYI-YIGKAINIKKRLLQHLKEREQSKKEANIFNHSKEL
UVRC_BORAP      -----------------LPTTSGCYKMLNENKKILYIGKAKNLRSRIKSYFLEKSHKIKI--LMKNVKSI
UVRC_BORBZ      -----------------LPTTSGCYKMLNENKKILYIGKAKNLRSRVKSYFLEKNHKIKI--LMKNVKSI
UVRC_BORBU      -----------------LPTTSGCYKMLNENKKILYIGKAKNLRSRVKSYFLEKNHKIKI--LMKNVKSI
UVRC_FERNB      ------------KILEKIPNKSGVYIFKKGEEYI-YIGKAKELKKRLTSHFKAKDG--KSKLIVEEADDL
UVRC_NATPD      ----------VRKRAAELPAEPGVYQF-EAGESVLYVGKAVDLRERVRSYVAPRSDRIR--RMXXXXXXX
UVRC_BORHD      ----------LHKKVQELPTTSGCYKMYSQNNKILYIGKAKNLRARVKNYFLKRSH--KTKILMRNVANI
UVRC_SALTO      -----------------IPESPGVYRFRDGTGRVIYVGKARNLRNRLNSYFADPVNLHRTRQMVFTAESV
UVRC_BURTA      --------------LAQLPHLPGVYRYYDAQEAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_SALAI      -----------------IPESPGVYRFRDGTGRVIYVGKARNLRSRLNSYFADPVNLHRTRQMVFTAESV
UVRC_BURCM      -----------KKILAQLPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_BURA4      -----------KKILAQLPHMPGVYRYYDTAGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARI
UVRC_BURPP      -----------KKVLAQLPHLPGVYRYYDTHGAVLYVGKARDLKKRVSSYFTKTLLSPRIAMMVTRIARI
UVRC_BORRA      ------------KQIEKFPKTSGCYKMYSKDNKILYIGKAKNLRSRVKNYFSKRTSH-KTKILMXXXXXX
UVRC_THEAB      -----------------VSEKPGVYIFKNGSEYI-YIGKAKNLKRRLNSHFSLKEE--KSRLIVEESNSL
UVRC_BORDL      ------------KQIEKFPKTSGCYKMYSKDNKILYIGKAKNLRSRVKNYFSKRTSH-KTKILMXXXXXX
UVRC_BURXL      -----------KKVLTQLPHLPGVYRYYDTHGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARV
UVRC_BURPS      --------------LAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BURP6      --------------LAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BURP1      --------------LAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BURP0      --------------LAQLPHLPGVYRYYDAQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_RHOOB      -----------------IPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHRTRQMVTTAGXX
UVRC_BURMS      --------------LAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BURMA      --------------LAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BURM9      --------------LAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BURM7      --------------LAQLPHLPGVYRYYDVQDAVLYVGKARDLKKRVSSYFTKTQLSPXXXXXXXXXXXX
UVRC_BORT9      ----------LHKKVQEFPTTSGCYKMYSQDNKILYIGKAKNLRSRLKNYFLEKISL-KTKILMRNVVNI
UVRC_THELT      ----------------------GVYIFYGKNKEYIYVGKAKRLRNRLLSYFNRSNYSKKIQAIVNEAEEL
UVRC_STRCO      -----------------IPDSPGVYRFRDEHRRVIYVGKAKSLRQRLANYFQDLAHLHRTRTMVTTAAXX
UVRC_WOLSU      --------ETLLETLQNLPDQSGVYHYFDSRSKLLYVGKAKSLKKRVKSYFQFTPTLARIHKMISEAAFI
UVRC_AQUAE      ------------------PEKPGVY-LFKKGNRPIYIGKAKNLKKRLLQHLKASEYDSKERAIISNSDNL
UVRC_DEIGD      -------------DLPVLPASPGVY-IFRRGGTPIYIGKAVNLRSRVAQHFKAGG---KSGKFTALADSL
UVRC_SACEN      -----------------IPDAPGVYRFHDAEGRVIYVGKAKSLRSRLSSYFADLSGLHRTRQMVTTATGV
UVRC_STRGG      -----------------IPDSPGVYKFRDEHRRVIYVGKAKNLRQRVANYFQDLANLHRTRTMVTTAAXX
UVRC_MYCGE      ----------LKQKLKTAPKKPGCYLWKDSNGKVLYVGKASNIFNRVHQYF-QKNNPYKTQLLSSQISDV
UVRC_HALSA      --------DEVRARASELPAEPGVYQFVARDERVLYVGKAVDIRDRVRSYGDPRSE--RIAGMXXXXXXX
UVRC_HALS3      --------DEVRARASELPAEPGVYQFVARDERVLYVGKAVDIRDRVRSYGDPRSE--RIAGMXXXXXXX
UVRC_MYCBV      -----MDKNEIILMLKNVSTSPGVYLWKDAKQNVLYVGKAKNLRKRMLQYFDGAINSYKTNKLVSLIYDF
UVRC_DESDG      -------------DISCIPTTPGVYLYKDPAGKVVYVGKAKHLRRRVASYFRDQRHTPKTRAMLRSAATV
UVRC_THET8      ------------QDLPPLPETPGVY-LWKRGEEVLYVGKAKSLRARVKSYFHAEG---KARRIAEEATGL
UVRC_MYCPN      ------------------PHKPGCYLWKDDAGQVLYVGKAKDIFKRVHHYF-NPNRSFKTRALVERIADV
UVRC_DESVH      -----------RPDLSTIPLTPGVYLYKDESGRIIYVGKARCLRRRVASYFRDVSALTKTVAMLRHAVTI
UVRC_MYCS2      -----------------IPVEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFADITSLARTRQMVMTAGSX
UVRC_THET2      ----------------------------------------------------------------------
UVRC_MYCAP      -----MDKNEIILKLKNTSTSPGVYLWKDAKQNVLYVGKAKNLRKRLLQYFDGAINSYKTSKLMSLVADF
UVRC_HALLT      --------DAVRERAADLPTEPGVYQFRAG-ETTLYVGKAVNLRNRVRSYADPRSGRIRG--MVGRADRI
UVRC_TREPS      MRPSESLVETLRIQALSAPSTSGVYLWKDVHGVVIYVGKAKSLRTRLTSYFRCR-HDPKTRVLMSRAAAL
UVRC_TREPA      MRPSESLVETLRIQALSAPSTSGVYLWKDVHGVVIYVGKAKSLRTRLTSYFRCR-HDPKTRVLMSRAAAL
UVRC_BIFLO      -------RDLFRPKTSDIPAKPGVYKWRDGEGRVIYVGKAKNLRNRLTNYF-QPLYLLRTQTMVLTARSL
UVRC_BIFLD      -------RDLFRPKTSDIPAKPGVYKWRDGEGRVIYVGKAKNLRNRLTNYF-QPLYLLRTQTMVLTARSL
DNLJ_CHLMU      ----------------------------------------------------------------------
DNLJ_THICR      ----------------------------------------------------------------------
DNLJ_MYCGE      ----------------------------------------------------------------------
DNLJ_CHLAB      ----------------------------------------------------------------------
DNLJ_COLP3      ----------------------------------------------------------------------
CHO_SALTY       ----------LRPFLSEAPALPGVYIFHSESDTLLYIGKSVNIRSRVLSHLRTPDE----ATMLRQARRI
CHO_SALTI       ----------LRPFLSEAPALPGVYIFHSESDTLLYIGKSVNIRSRVLSHLRTPDE----AAMLRQARRI
DNLJ_SYMTH      ----------------------------------------------------------------------
DNLJ_CHLFF      ----------------------------------------------------------------------
DNLJ_HAEPS      ----------------------------------------------------------------------
DNLJ_ACTP2      ----------------------------------------------------------------------
DNLJ_FRATO      ----------------------------------------------------------------------
DNLJ_PROAC      ----------------------------------------------------------------------
DNLJ_FRATW      ----------------------------------------------------------------------
DNLJ_FRATT      ----------------------------------------------------------------------
DNLJ_FRATM      ----------------------------------------------------------------------
DNLJ_FRATH      ----------------------------------------------------------------------
DNLJ_FRATF      ----------------------------------------------------------------------
DNLJ_FRAT1      ----------------------------------------------------------------------
CHO_ECO57       ----------LRSFLNDLPTRPGVYLFHGESDTMLYIGKSVNIRSRVLSHLRTPDE----AAMLRQSRRI
UVRB_CAMHC      ----------------------------------------------------------------------
DNLJ_CHLTR      ----------------------------------------------------------------------
DNLJ_CHLTB      ----------------------------------------------------------------------
DNLJ_CHLT2      ----------------------------------------------------------------------
CHO_ECOLI       ----------LRSFLNDLPTRPGVYLFHGESDTMLYIGKSVNIRSRVLSHLRTPDE----AAMLRQSRRI
CHO_ECOL6       ----------LRSFLNDLPTRPGVYLFHGESDTMLYIGKSINIRSRVLSHLRTPDE----AAMLRQSRRI
Y017_RICPR      ----------------------------------------------------------------------
DYHC2_PLAF7     ----------------------------------------------------------------------
CHO_SHIFL       -----------------LPTRPGVYLFHGESDTMLYIGKSVNIRSRVLSHLRTPDE----AAMLRQSRRI
DNLJ_FRAP2      ----------------------------------------------------------------------
DNLJ_CHLCV      ----------------------------------------------------------------------
DNLJ_TROWT      ----------------------------------------------------------------------
DNLJ_TROW8      ----------------------------------------------------------------------
DNLJ_PETMO      ----------------------------------------------------------------------
DNLJ_FRATN      ----------------------------------------------------------------------
DNLJ_ACTPJ      ----------------------------------------------------------------------
DNLJ_ACTP7      ----------------------------------------------------------------------
DNLJ_ACIC1      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
DNLJ_HAEDU      ----------------------------------------------------------------------
DNLJ_THEAB      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
DNLJ_MYCPN      ----------------------------------------------------------------------
DNLJ_SYNFM      ----------------------------------------------------------------------
DNLJ_STRA5      ----------------------------------------------------------------------
DNLJ_STRA3      ----------------------------------------------------------------------
DNLJ_STRA1      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
DNLJ_CORJK      ----------------------------------------------------------------------
DNLJ_CITK8      ----------------------------------------------------------------------
DNLJ_CHLTA      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
MUTS_CLONN      ----------------------------------------------------------------------
DNLJ_MYCA9      ----------------------------------------------------------------------
DNLJ_HAES2      ----------------------------------------------------------------------
DNLJ_HAES1      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
RNH3_CHLMU      ----------------------------------------------------------------------
DNLJ_SALAR      ----------------------------------------------------------------------
DNLJ_RHOE4      ----------------------------------------------------------------------
DNLJ_MYCTU      ----------------------------------------------------------------------
DNLJ_MYCTA      ----------------------------------------------------------------------
DNLJ_MYCBT      ----------------------------------------------------------------------
DNLJ_MYCBP      ----------------------------------------------------------------------
DNLJ_MYCBO      ----------------------------------------------------------------------
DNLJ_MANSM      ----------------------------------------------------------------------
DNLJ_KLEP7      ----------------------------------------------------------------------
DNLJ_ENTS8      ----------------------------------------------------------------------
DNLJ_CYAP7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASA
UVRC_PELUB      EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASA
UVRC_MESSB      EFVVTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGNHPAPGIFKHRGARSRRGDYFGPFASA
UVRC_BARHE      EFVVTHTXXXXXXXXXXXXKRLHPRFNVLLRDDKSFPYIIITDDHRAPALYKHRGARTRKAHYFGPFASS
UVRC_RHILO      EFVVTRTXXXXXXXXXXXXKRLRPRFNVLMRDDKSFPYILLTGDHVSPGIYKHRGARSRKGDYFGPFASA
UVRC_AGRT5      EFVXXXXXXXXXXXXXXXIKRLRPRFNVLLRDDKSFPYILITADNRAPAIFKHRGARARKGDYFGPFASA
UVRC_RHOPS      EIISXXXXXXXXXXXXNLIKQLRPRFNVLLRDDKSFPYILITG-DHWAQILKHRGAQSRPGRYFGPFASV
UVRC_RHIL3      EFVXXXXXXXXXXXXXXXIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASA
UVRC_SILST      MFXXXXXXXXXXXXXQNLIKQLKPKYNVLLRDDKSFPYIMVSKNHAFPQLKKHRGARKGKXXXXXXXXXX
UVRC_RHOS4      MFXXXXXXXXXXXXXQNLIKQLKPRYNVLLRDDKSFPNILIAKDHPFPMLKKHRGKKSEKGSYFGPFASA
UVRC_GLUOX      EIVITRTEADALLLEANYIKRMKPRFNILLRDDKSYPWLMLTESHEFPQITKQRGKPVKGATYWGPFANA
UVRC_RHOP2      XXXXXXXXXXXXXXXXNLIKQLRPRFNVLLRDDKSFPYILITG-DHWAQILKHRGAQSRPGRYFGPFASV
UVRC_JANSC      MFXXXXXXXXXXXXXQNLIKQLKPKFNVLLRDDKSFPNILVSDEHAFPQIKKHRGSKKEKGSYFGPFASA
UVRC_BRUAB      EFVVTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASA
UVRC_RHIEC      EFVXXXXXXXXXXXXXXXIKRLRPRFNVLLRDDKSFPYILITGDHRAPAIFKHRGARARKGDYFGPFASA
UVRC_MARMM      EFVVTQXXXXXXXXXXNLIKSLKPRFNILLRDDKSFPYILIRKDHPAAQLTKHRGARKAKGDYFGPFASV
UVRC_BRUME      EFVVTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASA
UVRC_BRUA2      EFVVTRXXXXXXXXXXNLIKRLRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASA
UVRC_BRUSU      EFVVTRXXXXXXXXXXNLIKRSRPRFNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASA
UVRC_MAGSA      EVVTTRTEVEALLLESNLIKSLGPRYNILLKDDKTFPHILITADHDWPQVLKHRGARNRKGEYFGPFASA
UVRC_RHORT      XXXXXXXXXXXXXXXSNLIKKLKPRYNILLRDDKSFPYIEITSDHAFPRIVKFRGTLRKGGEYFGPFASA
UVRC_ZYMMO      TIVTTVTESEALLLEAQLIKRYRPPYNILLRDDKSFPYILLKEDGQFPSLQRHRGVKRAKGKYYGPFASA
UVRC_GRABC      EIVTTHTXXXXXXXXXNLIKRLKPRFNIVLRDDKSYPWLMLTEDHAFPQIMKHRGAQTKAASYWGPFASA
UVRC_RHOPB      EIISXXXXXXXXXXXXNLIKQLRPRFNVLLRDDKSFPYILITG-DHWAQIIKHRGAQSRPGRYFGPFASV
UVRC_RHIME      EFVTTRTXXXXXXXXXXXXKRLRPRFNVLLRDDKSFPYIVVTGDTRAPALYKHRGARSRKGDYFGPFASA
UVRC_RHOPA      XXXXXXXXXXXXXXXXNLIKQLRPRFNVQLRDDKSFPYILITS-DHWAQILKHRGAQSRPGRYFGPFASA
UVRC_BARQU      EFVVTHXXXXXXXXXXNLIKRLHPRFNVLLRDDKSFPYIIITENHRAPALYKHRGARTRKAHYFGPFASS
UVRC_SILPO      MFXXXXXXXXXXXXXQNLIKQLKPKYNVLLRDDKSFPNILVAKDHSFAQIKKHRGAKKEKGTYFGPFASA
UVRC_SPHAL      EIVTTTSXXXXXXXXXQLIKRYRPPYNVLLRDDKSFPFILLRTDHDFPRVQKHXXXXXXXXXXXXPFASA
UVRC_BRAJA      EIVSXXXXXXXXXXXXXXIKQLRPRFNVQLRDDKSFPYILITG-DHWAQILKHRGAQTRPGRYFGPFASA
UVRC_NITHX      XXXXXXXXXXXXXXXXNLIKQLRPRFNVQLRDDKSFPYILITG-DHWAQILKHRGAQSRPGRYFGPFASA
UVRC_HYPNA      EFVVXXXXXXXXXXXXSLVKSLKPRFNVLLRDDKSFPYILIRRNHEAPQIKKYRGSKQDEGDYFGPFANA
UVRC_NOVAD      TIVTTNSXXXXXXXXXQLIKRFRPPYNVLLRDDKSFPFILLRGDHAFPRISKHRGARKAKGNYYGPFASA
UVRC_CAUCR      EFITTRTEADALLLEINLIKQLKPRFNVLLRDDKSFPEIVIRRDHDAPQLRKHRGAHTIKGDYFGPFASA
UVRC_NITWN      EIVSTGXXXXXXXXXXNLIKQLRPRFNVQLRDDKSFPYILITG-DHWAQLLKHRGAQSRPGRYFGPFASA
UVRC_RICTY      EYIITHSEVEALLLEAQLIKKFQPKFNILLKDDKSFPFIKLSLDHDFPQLLKYRGKALSDGKLFGPFASN
UVRC_RICPR      EYIITNSEVEALLLEAQLIKKFQPKFNILLKDDKSFPFIKLSLDHDFPQLIKYRGKALSDGKFFGPFASN
UVRC_RICBR      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDDKSFPFIKLRLDHDFPQLLKYRGRALNDGKFFGPFASA
UVRC_THICR      EVTVTDTESEALILENTLIKRHKPRYNILFRDDKSYPYIFVSTGKKFPSLSYHRGAKRKVGRYFGPFPNA
UVRC_WOLWR      EIFITXXXXXXXXXXXXXXKSLKPLYNIVLKDGKFYPYITISKHD-YPRIAKYRGKFKKNEFYYGPFTSA
UVRC_WOLPM      EIFITXXXXXXXXXXXXXXKSLKPLYNIVLKDGKFYPYITISKHD-YPRIAKYRGKFKKNEFYYGPFTSA
UVRC_PSE14      ETTITGNETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSDGN-YPRLSIHRGAKKAKGRYFGPYPSA
UVRC_NITOC      KITVTHTENEALILESNLIKALQPRYNVLLRDDKSYPYIFLS-ADDFPRLGFHRGVKQVSGQYFGPYPNI
UVRC_PSEU2      ETTITGNETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSD-NAFPRLSIHRGTKKAKGRYFGPYPSA
UVRC_PSEFS      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSDGN-FPRLSIHRGAKKQKGKYFGPYPSA
UVRC_WOLPP      EIFITXXXXXXXXXXXXXXKSLKPSYNILLRDGKSYPYITISKHD-YPRIAKYRGKFKKNEFYYGPFPSA
UVRC_METFK      ETTVTRSXXXXXXXXXXXIKGFMPRYNVLFRDDKSYPYIALTG-DTFPRLAFHRGAQRKGSSYFGPFPNA
UVRC_PSEPW      ETTITANETEALLLEQNLIKQWRPPYNILLRDDKSYPYVFLSD-GQFPRLGIHRGAKKAKGRYFGPYPSA
UVRC_WOLTR      EVLVTENEIDALLLEARLIKSLKPPYNIIFKDGRSYPYIVIS-KHNYPRIAQYRGKFKKGEFYYGPFISV
UVRC_RICPU      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDCKSFPFIKLRLDHDFPQLLKYRGKTLSDGKFFGPFASS
UVRC_RICAE      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDCKSFPFIKLRLDHDFPQLLKYRGKTLSDGKFFGPFASS
UVRC_PSEPK      ETTITANETEALLLEQNLIKEWRPPYNILLRDDKSYPYVFLSD-GEFPRLGIHRGAKKAKGRYFGPYPSA
UVRC_RICCN      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDCKSFPFIKLRLDHDFPQLLKYRGKTLSDGKFFGPFASS
UVRC_RICRS      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDCKSFPFIKLRLEHDFPQLLKYRGKTLSDGKFFGPFASS
UVRC_RICRO      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDCKSFPFIKLRLEHDFPQLLKYRGKTLSDGKFFGPFASS
UVRC_PSESM      XXXXXXXXXXXXXXXXXXXKEWRPPYNILLRDDKSYPYVFLSD-GTYPRLSIHRGAKKAKGRYFGPYPSA
UVRC_PSEE4      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSD-GEFPRLGIHRGAKKAKGRYFGPYPSA
UVRC_PSEP1      ETTITANETEALLLEQNLIKEWRPPYNILLRDDKSYPYVFLSD-GEFPRLGIHRGAKKAKGRYFGPYPSA
UVRC_PSEPF      ETTITSNETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSD-GQFPRLSIHRGAKKAKGKYFGPYPSA
UVRC_SACD2      EVTVTPSEAEALVLEHNLIKSQKPPFNILLRDDKSFPYIFISEGEPYPKLAFHRGPKKKKGQYFGPFPNA
UVRC_RICCK      EYSVTSSEVEALLLEAQLIKKFQPKFNILLKDDKSFPFIKLRLDHDFPQLLKYRGRTRSDGKFFGPFASA
UVRC_PSEF5      XXXXXXXXXXXXXXXXXXXKEWRPPYNILLRDDKSYPYVFLSDGD-FPRFSIHRGAKKQKGKYFGPYPSA
UVRC_LEGPL      EISVTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRVELYRSKKKPSGNFFGPYPGV
UVRC_ALHEH      QVTVTHTEAEALILENTLIKELRPRYNVLLRDDKSYPWIYLSSHQDFPRLSFHRGARKGPGRWFGPFPSG
UVRC_LEGPC      EISVTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPSGNFFGPYPGV
UVRC_LEGPH      EISVTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPSGNFFGPYPGV
UVRC_NITEC      ETTVTRSXXXXXXXXXXXIKSLAPRYNILFRDDKSYPYLLLTNH-AFPRLAFYRGALDNRHQYFGPFPNA
UVRC_PSEFL      XXXXXXXXXXXXXXXXXXXKEWRPPYNILLRDDKSYPYVFLSD-GEFPRFSIHRGAKKQKGKYFGPYPSA
UVRC_NEIMA      ETTITRSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLSGH-QYPQMAYYRGTLKKPNQYFGPYPNS
UVRC_SHEPA      DVTVTHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLSNH-QHPRLAYHRGPKRDKGQYFGPYPNG
UVRC_LEGPA      EISVTRSETEALLLESNLIKALRPKYNVLLRDDKSYPYIHLSNHPDFPRIELYRSKKKPSGNFFGPYPGV
UVRC_NEIG1      ETTITRSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLSGH-QYPQMAYYRGTLKNPNQYFGPYPNS
UVRC_ANAMM      DVIVTQSXXXXXXXXXQLIKTLKPKYNIIMRDDKFYPYILLS-KHEYPRIVKYRGRKEAGGKCYGPFISS
UVRC_ACIBY      ETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRIASGRGKKHQIGKFFGPYPSA
UVRC_ACIBS      ETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRIASGRGKKHQIGKFFGPYPSA
UVRC_PSEMY      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSD-GEFPRLGIHRGAKKAKGRYFGPYPSA
UVRC_NITMU      ETTVTRSXXXXXXXXXXXIKSLNPRYNILFRDDKSYPYVILSGH-RFPRLGFHRGPLDKKHHYFGPFPNA
UVRC_NEIMB      ETTITRSESEALILENNFIKALSPKYNILFRDDKSYPYLMLSGH-QYPQMAYYRGTLKKPNQYFGPYPNS
UVRC_PSEAE      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA
UVRC_PSEAB      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA
UVRC_PSEA8      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA
UVRC_PHOPR      DVTVTHTETEALILEHNYIKLYLPKYNVLLRDDKSYPYIFLSNHHH-PRLSIHRGTKKRKGEYFGPYPDA
UVRC_RICAH      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDDKSFPFIKLRLDHDFPQLLKYRGKTLNDGKCFGPFASA
UVRC_SHEHH      DVTVTHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLSNHKH-PRLAYHRGPKRDKGLYFGPYPNG
UVRC_ACTSZ      XXXXXXXXXXALLLEHNYIKTFQPRYNVLLRDDKSYPYILLT-KERHPRIAAYRGAKKIQGEYFGPYPHA
UVRC_RICFE      EYSITNSEVEALLLEAQLIKKFQPKFNILLKDDKSFPFIKLRLDHDFPQLLKYRGKTLNSGKFFGPFASS
UVRC_PSEA7      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPFVFLSSEDEYPRLSLHRGAKKRKGRYFGPYPSA
UVRC_ACIAD      ETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSSDKPYPRIASGRGKKHQIGKFFGPYPSA
UVRC_HAEI8      DTMXXXXXXXXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHPRITSYRGSKKFAGEYFGPYPHA
UVRC_HAHCH      EITITHSETEALLLEQNLIKTLKPPYNILLRDDKSYPYIYLSSHDEYPSLTRVRQKKTGKGRFFGPYTSA
UVRC_METCA      EVTVTRTEGEALLLENQLIKRHKPRYNINLRDDKSYPYIYVSTHQEFPRLAFHRGSRARPGRFFGPFPSA
UVRC_EUBE2      EYIITDSELEALVLECNLIKEHRPKYNTMLKDDKSYPFIKITVGEEYPRVLFARKMKHGAGKYFGPYTSA
UVRC_HAEIE      DTMXXXXXXXXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHPRITSYRGSKKFAGEYFGPYPHA
UVRC_IDILO      DVTVTNTEAEALILENSFIKKYRPRYNVLLRDDKSYPYIILTSH-QHPKLGFHRGARRAKGDYFGPFPNG
UVRC_AZOVD      ETTITANETEALLLEQTLIKEWRPPYNILLRDDKSYPYVFLSD-GAFPRLGIHRGAKQRKGRYFGPYPSA
UVRC_SHEPW      DVTITHSETDALILENDYIKQYMPKYNVLLRDDKSYPYILLSNHKH-PRLSYHRGPKRAKGQYFGPYPNG
UVRC_ALKOO      EYIVTDTELEALILECNLIKENRPKYNVLLRDDKTYPYIKITTNEEYPRILKTRKVIKDKAKYFGPYTNI
UVRC_PSEA6      DVTVVHSEAEAFILENNFIKKYKPRYNVLLRDDKSYPFIFLSDH-QHPRLANHRGPKKRKGEYFGPYPSA
UVRC_VIBPA      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYILISGHKH-PRLSMHRGAKKRKGEYFGPYPDS
UVRC_HAES1      XXXXXXXXXXXXXXXXNYIKAFQPRYNVLLRDDKSYPYILLT-KERHPRITSHRGSKKVQGEYFGPYPHA
UVRC_HAEIN      DXXXXXXXXXXXXXXHNFIKLYQPRYNVLLRDDKSYPFILLT-KERHQRITSYRGSKKFAGEYFGPYPHA
UVRC_ACTPJ      XXXXXXXXXXALLLEHNYIKENQPKYNVLLRDDKSYPYILLT-KHQHPRITSFRGSKKVAGEYFGPYPNA
UVRC_HAES2      XXXXXXXXXXXXXXXXNYIKAFQPRYNVLLRDDKSYPYILLT-KERHPRITSHRGSKKVQGEYFGPYPHA
UVRC_ACTP7      XXXXXXXXXXALLLEHNYIKENQPKYNVLLRDDKSYPYILLT-KHQHPRITSFRGSKKVAGEYFGPYPNA
UVRC_COLP3      EVTVTHTEGEALILENNYIKKYQPKYNILLRDDKSYPYLLIT-AHKHPKLGLHRGGKKVKGEYFGPFPTV
UVRC_PSEHT      XXXXXXXXXXXXXXXXXXIKKYQPRYNILLRDDKSYPYILLTNHKH-PRLAFHRGSRKVKGEYFGPFPSA
UVRC_NITEU      ETTVTRSXXXXXXXXXXXIKSLAPRYNILFRDDKSYPYLLLT-RHIFPRLAFYRGALDDRHQYFGPFPNA
UVRC_ACTP2      XXXXXXXXXXALLLEHNYIKENQPKYNVLLRDDKSYPYILLT-KHQHPRITSFRGSKKVAGEYFGPYPNA
UVRC_DECAR      XXXXXXXXXXXXXXXXXXIKSLAPRYNILFRDDKSYPYIVLS-KGKFPRLGFFRGNPDRKADYFGPYPSS
UVRC_ECOK1      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOUT      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO45      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ANAPZ      EITVXXXXXXXXXXXXXXIKSLKPKYNIIMRDDKFYPYILFS-KHKYPRIVLHREKRS-EGRYYGPFLSS
UVRC_YERPS      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADEHPRLAVHRGAKHEKGEYFGPFPNS
UVRC_SHISS      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOSM      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOSE      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOLU      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOLI      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOL6      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOHS      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECODH      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECOBW      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO8A      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO81      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO7I      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO5E      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO57      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO55      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO27      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_ECO24      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_BORA1      EVTVTRSEAEALILENNLIKSLRPRYNILFRDDKSYPYLLIT-AHEWPRIAYYRGSTSKRGQYFGPYPNS
UVRC_ECOLC      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_VIBVY      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLS-AHRHPRVSLHRGAKKRKGEYFGPYPDS
UVRC_VIBVU      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLS-AHRHPRVSLHRGAKKRKGEYFGPYPDS
UVRC_SHIB3      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_YERPN      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADEHPRLAVHRGAKHEKGEYFGPFPNS
UVRC_YERPE      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADEHPRLAVHRGAKHEKGEYFGPFPNS
UVRC_YERPA      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADEHPRLAVHRGAKHEKGEYFGPFPNS
UVRC_YERP3      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADEHPRLAVHRGAKHEKGEYFGPFPNS
UVRC_ESCF3      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_CITK8      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SHESH      DVTVTHSETDALILENDYIKQYMPRYNVLLRDDKSYPYILLSDHKH-PRLAYHRGPKRDKGSYFGPYPNG
UVRC_SODGM      DVTITHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DAHPRITSHRGAKHAKGDYFGPFPNG
UVRC_SALTY      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALPB      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLSMHRGAKHAKGEYFGPFPNG
UVRC_DEHSB      EYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMADDGGRYFGPFANT
UVRC_SALTI      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALNS      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALA4      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_DICNV      QTTSTPTXXXXXXXXXXXIKQYQPKFNILLRDDKSYPYICLSQHD-FPRLFLYRGAR-KNGDFFGPYPNV
UVRC_SALSV      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALPK      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALPC      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALPA      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALHS      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALCH      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_YERE8      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADKHPRLAIHRGAKHEKGEYFGPFPNS
UVRC_SHELP      DVTLTPSETDALILENDYIKQYMPRYNVLLRDDKSYPYIFLSGH-RHPRLAYHRGPQREKGHYFGPYPNG
UVRC_SALDC      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_SALG2      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_DEHSC      EYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMADDGGRYFGPFANT
UVRC_SALEP      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_PHOLL      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLS-ADKHPRLAMYRGAKHFKGEYFGPFPNT
UVRC_DEHE1      EYLITGSEQEALILELNLIKRHRPYFNVRLKDDKGFPYLKITLNEKWPRIYITRSMADDGGRYFGPFAST
UVRC_PARUW      ETIVVTSEKEALLLENNLIKQHKPRYNALLKDDKSYIALKISQNDAWATVVRYKGTPEPDGLYFGPYTSA
UVRC_CLOAB      EYIVTDSEIEALILECNLIKKYKPRYNILLKDDKHYPFIKVTMNEDFPRIIVTRNMVKDGSKYFGPYPDV
UVRC_XYLF2      DVTITRXXXXXXXXXXQLIKSLTPRYNVLLRDDKSYPYVLLT-REAWPRIALHRGPQIVPGRYFGPYPGV
UVRC_XYLFT      DVTITRXXXXXXXXXXQLIKSLTPRYNVLLRDDKSYPYVLLT-REAWPRIALHRGPQIVPGRYFGPYPGM
UVRC_ALCBS      QTTVTGSEVEALLLEQSLIKELKPPYNILLRDDKSYPYIRITRSDRFPRVTFHRGTRRAGSQYFGPYPSG
UVRC_CLOTH      EYIVTDTELEALILECNLIKKHRPKFNILLKDDKNYPYIKVTMNEDFPRILMTRRVEKDGAKYFGPYTSA
UVRC_XANOR      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLT-REHWPRIALHRGPRAVQGRYFGPYTGV
UVRC_XANOP      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLT-REHWPRIALHRGPRAVQGRYFGPYTGV
UVRC_XANOM      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLT-REHWPRIALHRGPRAVQGRYFGPYTGV
UVRC_ERWT9      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLS-ADHHPRLASHRGAKHAKGEYFGPFPNG
UVRC_XYLFA      DVTITRXXXXXXXXXXQLIKSLAPRYNVLLRDDKSYPYVLLT-REAWPRIALHRGPQIVPGRYFGPYPGV
UVRC_KLEP3      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_JANMA      ETTVTRSXXXXXXXXXXXIKTLQPRYNILFRDDKSYPYLKITGQE-YPRMAYYRGAVDKKNQYFGPFPSG
UVRC_THIDA      DTTVTRTXXXXXXXXXXXIKGLKPRFNILFRDDKSYPYLLLTGHG-YPRLAYFRGAPKKRDQAFGPYPNS
UVRC_PSYCK      ETIITRSETEALLLEQNLIKEYRPPYNVLLRDDKSYLYVFISADKPYPRLAYGRGKGNQKGRFFGPFPSA
UVRC_HERAR      ETTITRSXXXXXXXXXXXIKTLQPRYNILFRDDKSYPYLKITGQ-KFPRMAYYRGAVDKKNQYFGPFPSG
UVRC_HAEDU      DTTITHSETEALLLEHNYIKQHQPKYNVLLRDDKSYPYLLLT-KHQHPRLTAFRGSKKVAGEYFGPYPNV
UVRC_SHEFN      DVTVTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSGHKH-PRLAYHRGPKREKGHYFGPYPNG
UVRC_BORPA      DVTVTRSXXXXXXXXXXXIKSLRPRYNILFRDDKSYPYLLITGH-AWPRIAYYRGATSKRGQYFGPYPNS
UVRC_BORBR      DVTVTRSXXXXXXXXXXXIKSLRPRYNILFRDDKSYPYLLITGH-AWPRIAYYRGATSKRGQYFGPYPNS
UVRC_COXB1      QTTITRNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFGPYPNA
UVRC_BORPE      DVTVTRSXXXXXXXXXXXIKSLRPRYNILFRDDKSYPYLLITGH-AWPRIAYYRGATSKRGQYFGPYPNS
UVRC_CLOTE      EYIITDSEMEALILECNLIKKYRPKYNILLKDDKGYPYIKITINEDFPRVFISRTIAKDGSRYFGPYTDY
UVRC_SHEPC      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNG
UVRC_PROMH      DVTVTHTETEALLLEHSYIQRYQPRYNVLLRDDKSYPYIYLS-ADKHPRLASYRGAKHAKGEYFGPFPNS
UVRC_SHEB9      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNG
UVRC_COXBR      QTTITRNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFGPYPNA
UVRC_COXBN      QTTITRNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFGPYPNA
UVRC_COXB2      QTTITRNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFGPYPNA
UVRC_SHEB8      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNG
UVRC_ERWCT      DVTITHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPMIFLSG-DAHPRLTVHRGAKHAKGEYFGPFPNG
UVRC_SHESW      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNG
UVRC_COXBU      QTTITRNENEALLLEASFIKQFRPRYNVLLRDDKSYPYLYLATHQKFPRLDFYRGAKKAPGRYFGPYPNA
UVRC_PASMU      DTTITSSETEALLLEHNYIKTYQPRYNVLLRDDKSYPYILLT-AERHPRISAYRGSKKIKGEYFGPYPHA
UVRC_DESAA      DAILVTTEKEALILEANLIRKHKPRYNILLKDGKRFPSLRIDVRTSYPRLEVVRKVKKDGAIYFGPFSSA
UVRC_CLOBH      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTR-KVTKDGSYFGPYVDG
UVRC_CLOB1      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTR-KVTKDGSYFGPYVDG
UVRC_SHESA      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPQREKGYYFGPYPNG
UVRC_CLOBM      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTR-KVTKDGSYFGPYVDG
UVRC_ALISL      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFISNHKH-PRISIHRGTKRKKGEYFGPYPDS
UVRC_SHEB5      NVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNG
UVRC_CLOBK      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTR-KVTKDGSYFGPYVDG
UVRC_CLOBJ      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTR-KVTKDGSYFGPYVDG
UVRC_SHESM      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPQREKGYYFGPYPNG
UVRC_ENTFA      EYIVTESXXXXXXXXXXXXHKNNPKYNIMLKDDKTYPFIKITNEKYPRLMITRKVLKDK-ALYFGPYPDV
UVRC_CLOCE      EYIVVDSEVEALMLECTLIKKYKPKYNILLKDDKHYPYIKVTLNEEYPRILKTRRVEKDGARYFGPYSSG
UVRC_CLOBL      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVVSTR-KVTKDGSYFGPYVDG
UVRC_MANSM      XXXXXXXXXXXXXXXHNYIKTFQPRYNVLLRDDKSYPYILLT-KERHPRITSHRGSKKVTGEYFGPYPHA
UVRC_CLOD6      EYIITDSELEALILECNLIKRYRPKYNVVLRDDKTYPYIKVTTNEDYPRILKVRRVLKDKAKYFGPYTNI
UVRC_BACSU      EYIVTSSNLEALILEMNLIKKHDPKYNVMLKDDKTYPFIKLTHERHPRLIVTRNVKKDK-GRYFGPYPNV
UVRC_SHESR      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYIFLSQHEH-PRLAYHRGPLREKGYYFGPYPNG
UVRC_FINM2      EYIIVNNECEALVLESNLIKKNSPKYNIVLRDDKQYPYIKITN-EKFPRVLKTRRVLKDKAKYFGPFPNA
UVRC_CLOPH      EYIIVDSEMEALVLECNLIKEHRPKYNTMLKDDKSYPYIKVTVNEAYPRVLFARQQKKDKAKYFGPYTSL
UVRC_EDWI9      DVTVTHTETEALLLEHNYIKRYQPRYNVLLRDDKSYPLIFLS-ADRHPRLAVHRGARRARGDYFGPFPNA
UVRC_SHIDS      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSG-DTHPRLAMHRGAKHAKGEYFGPFPNG
UVRC_LISMH      EYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITRQVKKDK-GKYFGPYPNV
UVRC_LISMF      EYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITRQVKKDK-GKYFGPYPNV
UVRC_LISMC      EYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITRQVKKDK-GKYFGPYPNV
UVRC_CHRSD      QVXXXXXXXXXXXXXXXXIKEQRPPYNILLRDDKSYPFIFVSDRHPYPALEFKRARQKRDGRYLGPFPST
UVRC_LISIN      EYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITRQVKKDK-GKYFGPYPNV
UVRC_BACAN      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACAC      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACAA      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_CLOB6      EYIITDSEIEALILECNLIKKYRPKYNILLKDDKHYPFIKVTLAEDFPRVISTR-KVTKDGSYFGPYVDG
UVRC_BACHK      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACCZ      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACC3      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACC0      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACAH      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_SHEON      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYILLSQHEH-PRLAYHRGPQREKGHYFGPYPNG
UVRC_LISW6      EYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITRQVKKDK-GKYFGPYPNV
UVRC_BACC1      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_AZOSE      DITPTRSXXXXXXXXXXXIKSLAPRYNILFRDDKTYPYIELSG-DEFPRLAYHRGAFTKGARYFGPFPNV
UVRC_ALKMQ      EYIVTDSELEALILECNLIKENRPKYNVLLRDDKTYPYIKVTMNETFPRVLKTRKVLKDKAKYFGPYTNI
UVRC_XANC5      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLT-REQWPRIALHRGPRAVQGRYFGPYTGV
UVRC_LISMO      EYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIKITNERHPRLIITRQVKKDK-GKYFGPYPNV
UVRC_BACC7      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_ENTS8      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPYIFLSG-DTHPRLAIHRGAKHAKGEYFGPFPNG
UVRC_XANAC      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLT-REQWPRIALHRGPRAVQGRYFGPYTGV
UVRC_BDEBA      EYILTKTEVEAFLLEASLIKKHRPKYNIRLRDDKAYPYIRFSWGDQAPRLYLARKVKKDGSLYFGPYTSG
UVRC_SERP5      DVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPLIFLS-ADSHPRLAVHRGAKHAKGEYFGPFPNS
UVRC_PSYA2      ETIITRSETEALLLEQNLIKEYRPPYNVLLRDDKSYLYVFISADQPYPRLAYGRGKVNQKGCFFGPFPSA
UVRC_BACCQ      EYIVTXXXXXXXXXXXXXXXXHDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_SHEDO      DVTLTHSETDALLLENDYIKQYMPKYNVLLRDDKSYPYLFLSGHKH-PRLAYHRGPQREKGRYFGPYPNG
UVRC_CHRVO      ETTVTRSEAEALILENNLIKALAPRYNILFRDDKSYPYLMFSGH-AFPQMAYYRGEPKKPNQYFGPYPNG
UVRC_CLOK5      EYIVTDSEMEALVLECNLIKKYRPRYNILLKDDKIYPLIKITLNEDFPRIICARNKIKDGAKYFGPYIST
UVRC_BACC2      EYIVTXXXXXXXXXXXXXXXXYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_STRMK      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKTYPHVLLTRED-WPRIALHRGPRAIPGRYFGPYPGV
UVRC_BACC4      EYIVTXXXXXXXXXXXXXXXXYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_STRM5      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKTYPHVLLTRED-WPRIALHRGPRAIPGRYFGPYPGV
UVRC_VIBF1      DVTVTHSETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFIS-QHKHPRISIHRGVKRKKGEYFGPYPDS
UVRC_RALSO      ETTVVRSXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-QHAYPRMAYYRGATDRKHQYFGPFPSA
UVRC_XANCP      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLTRED-WPRIALHRGPRAVNGRYFGPYAGV
UVRC_XANC8      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLTRED-WPRIALHRGPRAVNGRYFGPYAGV
UVRC_BACWK      EYIVTXXXXXXXXXXXXXXXXYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_BACCR      EYIVTXXXXXXXXXXXXXXXXYDPKYNIQLKDDKTYPFIKITAEKQPRLLITRNVKKDK-GKYFGPYPNA
UVRC_GEOKA      EYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDKSYPFIKITAEKHPRLLITRKVKKDG-GKYFGPYPNV
UVRC_XANCB      DVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLTRED-WPRIALHRGPRAVNGRYFGPYAGV
UVRC_STAAB      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAU      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAR      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_CLOB8      EYIVTDSEMEALILECNLIKKYSPKYNISLKDDKFYPFIKVTTNEDFPRVFITRNYAKDGNKYFGPYPNA
UVRC_VIBCM      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLS-AHKHPRLSSHRGAKKRRGEYFGPYPDS
UVRC_VIBCH      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLS-AHKHPRLSSHRGAKKRRGEYFGPYPDS
UVRC_VIBC3      DVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLS-AHKHPRLSSHRGAKKRRGEYFGPYPDS
UVRC_STAAT      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAN      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAM      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAE      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAC      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAA9      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAA8      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAA3      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAA2      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAA1      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAW      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_STAAS      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKQGTGKYFGPYPNA
UVRC_PSYWF      ETIITRSETEALLLEQNLIKEHRPPYNVLLRDDKSYLYVFISADQPYPRLAYGRGKKHQKGKFFGPFPSA
UVRC_CLONN      EYIITDSEMEALILECNLIKKYRPRYNILLKDDKHYPFLKITTNEDFPRIFVTRVRAKDGARYLGPYPET
UVRC_SYMTH      EHIVTDTETEALVLESNLIKKHKPKYNIRLRDDKHYPYLRLTLTEQWPRLVVARSMKKDGSRYFGPYTSS
UVRC_STACT      EFIVTDXXXXXXXXXXXXIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLLVTRTVKKGSGKYFGPYPNA
UVRC_STAEQ      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKHPRLLVTRTVKKNSGKYFGPYPNA
UVRC_PROMP      EIIVTDSEYEALNLESNLIKTNKPYFNILLKDDKKYPYLCITWSEQYPRIFITRKRRNRNNFYYGPYVDV
UVRC_THETN      EYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKITVAEDYPRIMFTR-KIDMDGSYFGPYGSA
UVRC_FRAP2      EITIAPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_OCEIH      EYMVTSSEIEALILEMNLIKKYDPRYNVMLKDDKSYPYLKITSERHPRLIVTRRLKKDK-GKYFGPYPNV
UVRC_STAES      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKHPRLLVTRTVKKNSGKYFGPYPNA
UVRC_ANASP      EFIVTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRITRKRQLGKEKDKYYGPYTDS
UVRC_RALEJ      DTTVVRTXXXXXXXXXXXXXXXXPRYNILFRDDKSYPFLKLTGH-RFPRMAYYRGATDRKHQYFGPFPSA
UVRC_MOOTA      EYILTDNEVEALILECNLIKQHRPRYNVSLKDDKSYPYIKITTQEDFPRIQITRSVTRDGSRYFGPYTSA
UVRC_CARHZ      EVIITSTEVEALILEQNLIKRYRPRYNILLKDDKSYPYLKITG-EEFPRLLITRRVVNDGGRYFGPYPDA
UVRC_STAHJ      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKHPKLIVTRTVKKGTGKYFGPYPNA
UVRC_PROAC      QWTVVQNEVESLQLEYTWIKEFDPRFNVMYRDDKSYPWLCFTWTDEYPRVFVGRGAHHKGWRYYGPFGQA
UVRC_BURM1      ETTVTRSXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLTSH-RFPRMAYYRGAVDKQNQYFGPFPSA
UVRC_STAS1      EFIVXXXXXXXXXXXXNLIKQYQPRYNILLKDDKSYPFIKIT-KEKYPRLIVTRTVKKGSGKYFGPYPNA
UVRC_BACLD      EYIVTSSNIEALILEMNLIKKYDPKYNVMLKDDKSYPFIKITNERHPKLVVTRKVKKDK-GRYFGPYPNV
UVRC_GLOVI      ELILTDTEAEALVLEDNLIKTHKPRYNVLLKDDKQYPYLCITWSEEYPRVTRRRGSGHPEDRYFGPYTDA
UVRC_TRIEI      EFIVTDTXXXXXXXXXXXVKQHQPYFNVLLKDDKKYPYLCITWSEDYPRITRKRRLGKAKDRYYGPYVDT
UVRC_STRU0      EFIVTGSNTEALLLEINLIQKNMPKYNIKLKDDKSYPFIKITN-EPFPRLLITRQIKKQDGLYFGPYPDS
UVRC_NOSP7      EFIVTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYLCITWSEDYPRIRKRQLGKEKDKFY-GPYTDA
UVRC_DESPS      KTIITTTEKEALILEASLIKKHKPRYNIILRDDKNYPYIAVTVGEEWPRVMMVRRKRRDNSRYFGPYSSA
UVRC_ANADF      EVIVTRSEKEAVLLENELIKRHRPRFNIRLRDDKDFIVLRLDERHAFXXXXXXXXXXXXXXXYFGPYSSA
UVRC_FRATM      EITITPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_MICAN      EFIVTDTEAESLALEANLIKQHQPHFNTLLKDDKKYPYICITWSETYPRITRKRRINNQKDRYYGPYVDT
UVRC_CLOPS      EYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIKITTNEDFPRVYVTRNFAKDGNRYFGPYTNG
UVRC_SYNAS      EFILTETEKEALILENNLIKEHHPRYNICFRDDKAYFNIRADLNEPFPRFQLVRRPRKDGAKYFGPYPSS
UVRC_BURS3      ETTVTRSXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-AHRFPRMAYYRGSVDKQNQYFGPFPSA
UVRC_RALME      DTTVVRTXXXXXXXXXXXXXXXXPRYNILFRDDKSYPFLRLTGH-KFPRMAYYRGATDRKHQYFGPFPSA
UVRC_FRATN      EITITPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_FRATO      EITITPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_FRATF      EITITPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_FRATH      EITITPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_FRATW      EITITPSDYEAYLLENNLIKQHRPKYNILFKDDKSYPYLVIS-RDKFPRVSFYRGKSAKKGQCFGPYVSI
UVRC_ANASK      EVIVTRSEKEAVLLENELIKKHRPRFNVRLRDDKDFIVLKLDERHPYPEVRRAREKRQPGARYFGPYSSA
UVRC_BURCH      ETTVTRSXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-AHRFPRMAYYRGSVDKQNQYFGPFPSA
UVRC_BURCA      ETTVTRSXXXXXXXXXXXXXXXXPRYNILFRDDKSYPYLKLT-AHRFPRMAYYRGSVDKQNQYFGPFPSA
UVRC_ANAVT      EFIVTDTXXXXXXXXXXXIKQHQPYFNVLLKDDKKYPYVCITWSEDYPRITRKRQLGKEKDKYYGPYTDS
UVRC_BURCC      ETTV