[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ20910.1

[Show Plain Result]


## Summary of Sequence Search
    1::293
    3::290     2e-63  44%  290 aa  ILVE_RICCN RecName: Full=Probable branched-chain-amino-acid
    6::267     4e-61  46%  306 aa  ILVE_METTH RecName: Full=Putative branched-chain-amino-acid
    3::262     6e-58  44%  290 aa  ILVE_RICPR RecName: Full=Probable branched-chain-amino-acid
    3::290     3e-56  41%  290 aa  ILVE_RICFE RecName: Full=Probable branched-chain-amino-acid
    6::264     3e-56  44%  307 aa  ILVE_PSEAE RecName: Full=Branched-chain-amino-acid
    1::287     4e-56  40%  288 aa  ILVE_RICTY RecName: Full=Probable branched-chain-amino-acid
   12::288     4e-55  42%  289 aa  ILVE_RICBR RecName: Full=Probable branched-chain-amino-acid
    4::268     4e-48  39%  309 aa  ILVE_ECOLI RecName: Full=Branched-chain-amino-acid
    4::268     4e-48  39%  309 aa  ILVE_ECOL6 RecName: Full=Branched-chain-amino-acid
    4::268     4e-48  39%  309 aa  ILVE_ECO57 RecName: Full=Branched-chain-amino-acid
    4::268     1e-47  39%  309 aa  ILVE_SALTY RecName: Full=Branched-chain-amino-acid
    4::268     1e-47  39%  309 aa  ILVE_SALTI RecName: Full=Branched-chain-amino-acid
    2::250     2e-36  39%  288 aa  ILVE_METJA RecName: Full=Putative branched-chain-amino-acid
   11::273     9e-35  37%  311 aa  ILVE_AQUAE RecName: Full=Probable branched-chain-amino-acid
    4::260     1e-34  34%  290 aa  ILVE_ARCFU RecName: Full=Putative branched-chain-amino-acid
    9::264     1e-29  34%  305 aa  ILVE_SYNY3 RecName: Full=Probable branched-chain-amino-acid
  265::514     4e-24  32%  555 aa  BCAL1_ARATH RecName: Full=Branched-chain-amino-acid
  262::511     7e-24  32%  559 aa  BCAL2_ARATH RecName: Full=Branched-chain-amino-acid
    2::250     9e-24  27%  283 aa  DAAA_BACLI RecName: Full=D-alanine aminotransferase;       
   32::326     2e-21  30%  358 aa  ILVE_STAAW RecName: Full=Probable branched-chain-amino-acid
   32::326     2e-21  30%  358 aa  ILVE_STAAS RecName: Full=Probable branched-chain-amino-acid
   32::326     2e-21  30%  358 aa  ILVE_STAAN RecName: Full=Probable branched-chain-amino-acid
   32::326     2e-21  30%  358 aa  ILVE_STAAM RecName: Full=Probable branched-chain-amino-acid
   32::326     2e-21  30%  358 aa  ILVE_STAAC RecName: Full=Probable branched-chain-amino-acid
   35::325     3e-21  32%  358 aa  ILVE_STAES RecName: Full=Probable branched-chain-amino-acid
   35::325     4e-21  31%  358 aa  ILVE_STAEQ RecName: Full=Probable branched-chain-amino-acid
   32::326     4e-21  30%  358 aa  ILVE_STAAR RecName: Full=Probable branched-chain-amino-acid
    2::247     3e-20  26%  282 aa  DAAA_BACSU RecName: Full=D-alanine aminotransferase;       
  111::371     6e-20  32%  415 aa  BCAT5_ARATH RecName: Full=Branched-chain-amino-acid
    2::253     8e-20  30%  289 aa  DAAA_LISMF RecName: Full=D-alanine aminotransferase;       
   33::310     2e-19  33%  363 aa  ILVE2_BACSU RecName: Full=Branched-chain-amino-acid
  108::369     3e-19  32%  413 aa  BCAT3_ARATH RecName: Full=Branched-chain-amino-acid
    3::249     2e-18  29%  282 aa  DAAA_STAAS RecName: Full=D-alanine aminotransferase;       
    3::249     2e-18  29%  282 aa  DAAA_STAAN RecName: Full=D-alanine aminotransferase;       
    3::249     2e-18  29%  282 aa  DAAA_STAAM RecName: Full=D-alanine aminotransferase;       
    3::249     2e-18  29%  282 aa  DAAA_STAAC RecName: Full=D-alanine aminotransferase;       
    3::249     3e-18  29%  282 aa  DAAA_STAAW RecName: Full=D-alanine aminotransferase;       
    3::249     3e-18  29%  282 aa  DAAA_STAAR RecName: Full=D-alanine aminotransferase;       
    2::249     8e-18  26%  283 aa  DAAA_BACYM RecName: Full=D-alanine aminotransferase;       
   32::310     1e-17  30%  356 aa  ILVE1_BACSU RecName: Full=Branched-chain-amino-acid transaminase 1;
    3::282     2e-17  27%  282 aa  DAAA_STAHA RecName: Full=D-alanine aminotransferase;       
   32::301     1e-16  30%  340 aa  ILVE_HELPJ RecName: Full=Branched-chain-amino-acid
   45::312     1e-16  27%  367 aa  BCAT7_ARATH RecName: Full=Putative branched-chain-amino-acid
   43::308     7e-16  28%  354 aa  BCAT4_ARATH RecName: Full=Probable branched-chain-amino-acid
    3::252     9e-16  27%  282 aa  DAAA_STAES RecName: Full=D-alanine aminotransferase;       
    3::252     9e-16  27%  282 aa  DAAA_STAEQ RecName: Full=D-alanine aminotransferase;       
    2::232     2e-15  30%  289 aa  DAAA_LISIN RecName: Full=D-alanine aminotransferase;       
   32::301     5e-15  29%  340 aa  ILVE_HELPY RecName: Full=Branched-chain-amino-acid
   42::288     2e-14  27%  356 aa  BCAT6_ARATH RecName: Full=Branched-chain-amino-acid
   37::318     5e-14  26%  362 aa  ILVE_STRCO RecName: Full=Probable branched-chain-amino-acid
   58::347     9e-14  28%  393 aa  BCA1_YEAST RecName: Full=Branched-chain-amino-acid
    6::231     2e-13  23%  283 aa  DAAA_BACSH RecName: Full=D-alanine aminotransferase;       
    2::232     4e-13  29%  289 aa  DAAA_LISMO RecName: Full=D-alanine aminotransferase;       
   25::309     1e-12  30%  343 aa  ILVE_HAEIN RecName: Full=Branched-chain-amino-acid
    2::255     2e-12  28%  293 aa  PABC_BACSU RecName: Full=Aminodeoxychorismate lyase;       
  112::243     2e-12  40%  273 aa  ILVE_THEMA RecName: Full=Probable branched-chain-amino-acid
  246::357     4e-12  39%  384 aa  BCAT1_ARATH RecName: Full=Branched-chain-amino-acid
   38::324     6e-12  27%  376 aa  BCA2_YEAST RecName: Full=Branched-chain-amino-acid
   85::319     1e-11  26%  388 aa  BCAT2_ARATH RecName: Full=Branched-chain-amino-acid
   84::300     5e-11  28%  373 aa  BCAL3_ARATH RecName: Full=Branched-chain-amino-acid
   54::350     7e-11  29%  380 aa  BCA1_SCHPO RecName: Full=Branched-chain-amino-acid
   67::348     2e-10  26%  393 aa  BCAT2_RAT RecName: Full=Branched-chain-amino-acid aminotransferase,
   39::322     2e-10  27%  368 aa  ILVE_MYCLE RecName: Full=Probable branched-chain-amino-acid
   39::335     3e-10  26%  368 aa  ILVE_MYCTU RecName: Full=Probable branched-chain-amino-acid
   57::343     5e-10  30%  386 aa  BCAT1_MOUSE RecName: Full=Branched-chain-amino-acid
   80::334     8e-10  29%  378 aa  BCAT_DICDI RecName: Full=Branched-chain-amino-acid
   67::348     1e-09  26%  393 aa  BCAT2_MOUSE RecName: Full=Branched-chain-amino-acid
   63::254     1e-09  28%  267 aa  PABC_VIBCH RecName: Full=Aminodeoxychorismate lyase;       
   86::361     7e-09  26%  405 aa  BCAT_NEMVE RecName: Full=Branched-chain-amino-acid
   80::366     7e-09  26%  415 aa  BCAT_CAEEL RecName: Full=Branched-chain-amino-acid
   14::252     1e-06  25%  269 aa  PABC_ECOLI RecName: Full=Aminodeoxychorismate lyase;       
   71::347     7e-06  25%  392 aa  BCAT2_PONAB RecName: Full=Branched-chain-amino-acid
   66::253     3e-05  29%  271 aa  PABC_VIBHA RecName: Full=Aminodeoxychorismate lyase;       
  247::310     5e-04  33%  357 aa  TOXF_COCCA RecName: Full=Putative branched-chain-amino-acid
    1::293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKI
ILVE_RICCN      MVKLEQIFWHVWINGDLVPYQFARIHVLTHSLHYSGSVFEGERAYNGKVFKLKEHTARLIKSAEALGLKV
ILVE_METTH      -------SGKIWLNGEMVEWEEATVHVLSHVVHYGSSVFEGIRCYRNSIFRLREHVKRLFDSAKIYRMDI
ILVE_RICPR      MIKLDQIYGYIWINGDLIPYQFARIHVLTHSLHYSGSVFEGERAYNGKVFKLKEHTERLIQSAESLGLKV
ILVE_RICFE      MIKLEQIFWHVWINGDLVPYQFARIHVLTHSLHYSGSVFEGERAYNGKVFKLKEHTERLIKSAEALGLKV
ILVE_PSEAE      ------RDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYDTAIFRLQAHTDRLFDSAHIMNMQI
ILVE_RICTY      MIKLEQICRYVWINGDLIPYQFARIHVLTHSLHYSGSVFEGERAYNGKVFKLKEHTERLIQSAEALGLKV
ILVE_RICBR      ----------IWINGELVPYELATVHALTHSLHYSGSVFEGERAYNGKVFKLKEHTERLVKSAEVLGLKV
ILVE_ECOLI      -----KKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
ILVE_ECOL6      -----KKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
ILVE_ECO57      -----KKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
ILVE_SALTY      -----KKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLRDSAKIYRFPV
ILVE_SALTI      -----KKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLRDSAKIYRFPV
ILVE_METJA      ---------KIYLNGKFVDEKDAKVSVFDHGLLYGDGVFEGIRAYDGVVFMLKEHIDRLYDSAKSLCIDI
ILVE_AQUAE      -----------FFEGKIVPVEEAKISIMTNSFHYGTAIFEGIRAYWNEILFAKEHYERLLTNARCLFMEL
ILVE_ARCFU      ----------VYMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNGRVFRLKEHIDRLYDSAKAIDLEI
ILVE_SYNY3      -----------YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPLFRLDRHGDRLSKSAKFLHYDI
BCAL1_ARATH     -----------WVGDEILPREMAKVSVFDSVVQGGDSVWEGLRIYKGKIFKLEEHLDRLFDSAKALAFDN
BCAL2_ARATH     -----------WVGDEIVPREMAKVSVFDSVVQGGDSVWEGLRIYKGKVFKLEEHLDRLSDSAKALAFNN
DAAA_BACLI      ---------KVLFNGRLMERSECAVDIEDRGYQFGDGVYEVIRIYNGILFTLDEHIARLYKSAAEIGIDL
ILVE_STAAW      MLSYDYDADKGWHDLKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRALFRPEENFKRLNNSLARL--EM
ILVE_STAAS      MLSYDYDADKGWHDLKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRALFRPEENFKRLNNSLARL--EM
ILVE_STAAN      MLSYDYDADKGWHDLKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRALFRPEENFKRLNNSLARL--EM
ILVE_STAAM      MLSYDYDADKGWHDLKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRALFRPEENFKRLNNSLARL--EM
ILVE_STAAC      MLSYDYDADKGWHDLKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRALFRPEENFKRLNNSLARL--EM
ILVE_STAES      -VDYDADQG--WHDMKIVPYAPFEISPAAQGLHYGQAVFEGLKAYKHNLFRPDQNFKRINNSLARL--EM
ILVE_STAEQ      -VDYDADQG--WHDMKIVPYAPFEISPAAQGLHYGQAVFEGLKAYKHNLFRPDQNFKRINNSLARL--EM
ILVE_STAAR      MLSYDYDADKGWHDLKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKKALFRPDENFKRLNNSLARL--EM
DAAA_BACSU      ---------KVLVNGRLIGRSEASIDLEDRGYQFGDGIYEVIRVYKGVLFGLREHAERFFRSAAEIGISL
BCAT5_ARATH     --------------GQLQPFGNIDINPAAGVLNYGQGLFEGLKAYRKQLFRPEENAIRMRNGAERMCMPS
DAAA_LISMF      ---------KVLVNNHLVEREDATVDIEDRGYQFGDGVYEVVRLYNGKFFTYNEHIDRLYASAAKIDLVI
ILVE2_BACSU     MFVMDYAADKGWYDPRIIPYQPLSMDPAAMVYHYGQTVFEGLKAYVSELFRPEKNMERLNQSNDRLCIP-
BCAT3_ARATH     --------------GELQRFGNIEISPSAGVLNYGQGLFEGLKAYRKKLFRPEENAKRMRNGAERMCMPA
DAAA_STAAS      ---------KIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDL
DAAA_STAAN      ---------KIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDL
DAAA_STAAM      ---------KIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDL
DAAA_STAAC      ---------KIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDL
DAAA_STAAW      ---------KIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDL
DAAA_STAAR      ---------KIFLNGEFVSPSEAKVSYNDRGYVFGDGIYEYIRVYNGKLFTVTEHYERFLRSANEIGLDL
DAAA_BACYM      --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
ILVE1_BACSU     MFVMDYEEGIGWHHPRIAPYAPLTLDPSSSVFHYGQAVFEGLKAYRTDLFRPDQNIKRLNRSCERMSMP-
DAAA_STAHA      ---------KVFINGEFIDQNEAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQLDL
ILVE_HELPJ      -----------WSQGELVSENALQLSEGSPVLHYGQACFEGLKAYRSQLFRPLENAKRLQTSCERL--LM
BCAT7_ARATH     ------KQGESFSTGEIVPYGDISISPCAGILNYGQGLFEGLKAYRTTLFRPDQNAIRMQTGADRLCMTP
BCAT4_ARATH     --------GESFQEGKILPFADLQLNPCAAVLQYGQGLYEGLKAYRTELFRPDQNGLRLQAGADRLYMPY
DAAA_STAES      ---------KVFINGEFVNEEDAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVKEHFERFLRSAEEIGLDL
DAAA_STAEQ      ---------KVFINGEFVNEEDAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVKEHFERFLRSAEEIGLDL
DAAA_LISIN      ---------KVLVNDRLVERNDATVDVEDRGYQFGDGVYEVVRLYNGKFFTYNEHIDRLYASAAKIDLVI
ILVE_HELPY      -----------WSQGGLVSENMLQLSEGSPVLHYGQACFEGLKAYRSQLFRPLENAKRLQTSCERL--LM
BCAT6_ARATH     ------RQGESFTQGKIVPYGDISISPCSPILNYGQGLFEGLKAYRTEIFRPDQNALRMQTGAERLCMTP
ILVE_STRCO      MVTIKWTEGRGWHDGQLVPYAPLSLDPATMVLHYAQEIFEGLKAYDGSVFRPEKNGARFQASSRRLGMEL
BCA1_YEAST      -IPWSAKEG--WGTPHIKPYGNLSLDPSACVFHYAFELFEGLKAYRTTMFRPDKNMARMNKSAARICLPT
DAAA_BACSH      ------------WNDQIVEEGSITISPEDRGYQFGDGIYEVIKVYNGHMFTAQEHIDRFYASAEKIRLVI
DAAA_LISMO      ---------KVLVNNHLVEREDATVDIEDRGYQFGDGVYEVVRLYNGKFFTYNEHIDRLYASAAKIDLVI
ILVE_HAEIN      ------KDGK-WDEGKLTTDSTLHIHEGSTALHYGQQCFEGLKAYDGSIFRPQANAERMQRTADRLLMPR
PABC_BACSU      ----------IYVNGRYMEEKDAVLSPFDHGFLYGIGVFETFRLYEGCPFLLDWHIERLERALKDLQIEY
ILVE_THEMA      ----------------------------------------------------------------------
BCAT1_ARATH     ----------------------------------------------------------------------
BCA2_YEAST      MLTAEWTAEKGWGTPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYDNKIFRPDMNMKRMNKSAQRICLPT
BCAT2_ARATH     --------------GELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKELFRPDHNAIRMKLGAERMLMPS
BCAL3_ARATH     -------------DGITTDPAAMVLPLDDHMVHRGHGVFDTALIINGYLYELDQHLDRILRSASMAKIPL
BCA1_SCHPO      ---------KGWSTPEIVPFGKLCFHPASSVFHYGFECFEGMKAFRDELFRPIKNAERMLSTGTRISLP-
BCAT2_RAT       MVEWNSKTG--WGPPRIQPFQNLTLHPACSGLHYSLQLFEGLKAYKGRLFRPWLNMDRMLRSARRLCLP-
ILVE_MYCLE      MVSIDYIDGRGWHDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYDGSIVSFRPDANXXXXXXXXXXXXX
ILVE_MYCTU      MVSIDYAEGRGWHNARVIPYGPIELDPSAIVLHYAQEVFEGLKAYDGSIVSFXXXXXXXXXXXXXXXXXI
BCAT1_MOUSE     MLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFDNKIFRPDLNMDRMCRSAVRTTLPM
BCAT_DICDI      -------------------------------LHYALECFEGMKAYKDSLFRPDQNMNRFLNSAKRICLPE
BCAT2_MOUSE     MVEWNNKAG--WGPPRIQPFQNLTLHPACSGLHYSLQLFEGLKAYKGGLFRPWLNMDRMLRSARRLCLP-
PABC_VIBCH      ----------------------------------------------------------------------
BCAT_NEMVE      -----------WDNPQIIPYGNLSLPPAASALHYGLECFEGMKAYRGDMFRPLMNMKRMNNSAARACLPT
BCAT_CAEEL      MMTCDWDAERGWHHPKIEPIGELKIHPGAKVLHYASELFEGMKAYDNKIFRPEMNMARMKRTALRAALPD
PABC_ECOLI      --------------------------VSDRATQFGDGCFTTARVIDGKVSLLSAHIQRLQDACQRLMISC
BCAT2_PONAB     -------SDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLSF
PABC_VIBHA      ----------------------------------------------------------------------
TOXF_COCCA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
ILVE_RICCN      PYNVDEIIKAHECVIKQNNIKDAYIRPLIWCGDESLNITNQYLSTNLLIA----GIPSMPRSFEKGINLH
ILVE_METTH      PYTQEQICDAIVETVRENGLEECYIRPVVFRGYGEMGVHPVNCPVDVAVAAWEWGAYLGAEALEVGVDAG
ILVE_RICPR      PYSVDEIIKAHELLIIQNNIKDAYIRPLIWCGDESLNITNPDLSTNFLIASIS----SMPRSCEQSVHLH
ILVE_RICFE      PYSVDEIIKAHELVIKQNNIKDAYIRPLIWCGDESLNITNPDLSTNLLIA----GIPSMPRSFEKGINLH
ILVE_PSEAE      PYSRDEINEATRAAVRENNLESAYIRPMVFYGSEGMGLRASGLKVHVIIAAWSWGAYMGEEALQQGIKVR
ILVE_RICTY      PYSVDEIIKAHEFLITHNNIKDAYIRPLIWCGDESLNITNPALSTNFLIASIP----SMPMSCEQGVNLH
ILVE_RICBR      PYNVEEIIKAHELLIEKNKIQDAYIRPLVWCGSESLNIINPKLSTNVLIAAVP----SMPRAFAAGFNLY
ILVE_ECOLI      SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGSTDVIIAAFPWGAYLGAEALEQGIDAM
ILVE_ECOL6      SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGSTDVIIAAFPWGAYLGAEALEQGIDAM
ILVE_ECO57      SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGSTDVIIAAFPWGAYLGAEALEQGIDAM
ILVE_SALTY      SQSIDELMEACRDVIRKNNLTSAYIRPLVFVGDVGMGVNPPPGTTDVIIAAFPWGAYLGAEALDQGIDAM
ILVE_SALTI      SQSIDELMEACRDVIRKNNLTSAYIRPLVFVGDVGMGVNPPPGTTDVIIAAFPWGAYLGAEALDQGIDAM
ILVE_METJA      PLTKEEMIDVVLETLRVNNLRDAYIRLVVTRGVGDLGLDPRKTIFCIAIP-------MPPLLGEDGIRAI
ILVE_AQUAE      NYSAEELVEITKEILRKSEIRDVYIRPIAYFKDLKLTPKLIDYTPEIAIYLYRFGRYLDTS---KGIRAK
ILVE_ARCFU      PITKEEFMEIILETLRKNNLRDAYIRPIVTRGIGDLGLDPRKCQPSIIVITKPWGKLYG-DLYEKGLTAI
ILVE_SYNY3      S-AEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDFLVYGLEMGDY----LAADGVSCR
BCAL1_ARATH     VPAREEVKEAIFRTLITNGMFDNHIRLSLTRGKKVTSGMSPAYNRYIVLAEWKPPVYDNE----GGIVLV
BCAL2_ARATH     VPTREEIKEAIFRTLITNGMFDNHIRLSLTRGKKVTSGMSPAFNRYIVLAEWKPPVYDND----GGIVLV
DAAA_BACLI      SFSEAELKSQLKELVDINQRRDGGLYLQVTRG------KAPRKHQYGAGLTPQVTAYTFPIQKPEKEQQN
ILVE_STAAW      PQVDEELLEGLKQLVDIERIPEGYIRPFVFATEGALGVGASQYKLLIILSPS--GAYYGGET-LKPTKIY
ILVE_STAAS      PQVDEELLEGLKQLVDIERIPEGYIRPFVFATEGALGVGASQYKLLIILSPS--GAYYGGET-LKPTKIY
ILVE_STAAN      PQVDEELLEGLKQLVDIERIPEGYIRPFVFATEGALGVGASQYKLLIILSPS--GAYYGGET-LKPTKIY
ILVE_STAAM      PQVDEELLEGLKQLVDIERIPEGYIRPFVFATEGALGVGASQYKLLIILSPS--GAYYGGET-LKPTKIY
ILVE_STAAC      PQVDEELLEGLKQLVDIERIPEGYIRPFVFATEGALGVGASQYKLLIILSPS--GAYYGGET-LKPTKIY
ILVE_STAES      PEVDEEALLEGKQLIDVERVPEGYIRPFVFATEGVLGVSSHQYKLLIILSPS--GAYYGGDT-LKSTKIY
ILVE_STAEQ      PEVDEEALLEGKQLVDVERVPEGYIRPFVFATEGILGVSSHQYKLLIILSPS--GAYYGGDT-LKSTKIY
ILVE_STAAR      PQVNEELLEGLKQLVDLERVPEGYIRPFVFATEGVLGVGASQYKLLIILSPS--GAYYGGET-LKPTKIY
DAAA_BACSU      PFSIEDLEWDLQKLVQENAVSEGAVYIQTTRG-----VAPRKHQYEAGLEPQTTAYTFTVKKPEQEQAYG
BCAT5_ARATH     PTVEQFVELANKRWIPPPGKGSLYIRPLLMGTGAVLGL-APAPEYTFLIFVSPVGNYF--KEGVAPINLI
DAAA_LISMF      PYSKEELRALLEKLVAENNINTGNVYLQVTRG-------VQNPRNHVMPDDFPLEGVLTAAAR--EVPRN
ILVE2_BACSU     QIDEEQVLEGLKQLVAID--KDWYIRPFIIATEPFLGVAASHT-YKLLIILSPVGSYY--KEGIKPVKIA
BCAT3_ARATH     PTVEQETVLANKRWVPPPGKGSLYVRPLLMGTGAVLGL-APAPEYTFIIYVSPVGNYF--KEGVAPINLI
DAAA_STAAS      NYSVEELIELSRKLVDMNQIETGVIYIQATRGVAERNHSFPTPEVEPAIVAYT-KSYDRPYDHLEGVTVE
DAAA_STAAN      NYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYT-KSYDRPYDHLEGVTVE
DAAA_STAAM      NYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYT-KSYDRPYDHLEGVTVE
DAAA_STAAC      NYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYT-KSYDRPYDHLEGVTVE
DAAA_STAAW      NYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYT-KSYDRPYDHLEGVTVE
DAAA_STAAR      NYSVEELIELSRKLVDMNQIETGAIYIQATRGVAERNHSFPTPEVEPAIVAYT-KSYDRPYDHLEGVTVE
DAAA_BACYM      PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVII----GYTKENPRPLENLEKG
ILVE1_BACSU     PLDEELVLEALTQLVELE--KDWYIRPFVIATEPSLGVKASRSYTFMIVLSPVGSYYGDDQLK--PVRIY
DAAA_STAHA      GYTVEELIDVVRELLKVNNIQNGYIQATRGVAPRNHSFPTPEVKVIMAFAKSYDRPYDDLENGINAATVE
ILVE_HELPJ      PKVSEELFLACAEVIKANQYKSGYLRPFVIGVGDNLGVKPASEYLFIVFCA-PVGAYFKGGIEKGGARFI
BCAT7_ARATH     PSPEQFVELANNKWVPPPGKGALYIRPLLIGTGAVLGV-ASAPEYTFLIYTSPVGNYHKAS---SGLNLK
BCAT4_ARATH     PSVDQQVALANKKWIPPPGKGTLYIRPILFGSGPILGSFPIPETTFTAFAC-PVGRYHKDN---SGLNLK
DAAA_STAES      NYTXXXXXXXXXXXXXXNNVVNGGIYIQATRGAAPRNHSFPTPPVKPVIMAFT-KSYDRPYEELEAITTE
DAAA_STAEQ      NYTXXXXXXXXXXXXXXNNVVNGGIYIQATRGAAPRNHSFPTPPVKPVIMAFT-KSYDRPYEELEAITTE
DAAA_LISIN      PYSKETLRALLDKLVAENNINTGNVYLQVTRG-------VQNPRNHV----------LPDDFPLEGVRQF
ILVE_HELPY      PKVSEELFLACAEVVKANQYKSGYLRPFVIGVGDNLGVKPANEYLFIVFCA-PVGAYFKGGIEKGGARFI
BCAT6_ARATH     PTLEQFVELANKKWVPPPGKGTLYIRPLLLGSGATLGVAPAPEYTFLIYAS-PVGDYHKVS---SGLNLK
ILVE_STRCO      PVDTDALVAQDEKWVPAHGGEESYLRPFMIATEVGLGVRPANEYLFIVIAS-PAGAYFPGGVK--PVSIW
BCA1_YEAST      FESEELIKLTGKLIEQDKHVPQGYIRPTMIGTSKGLGVGTPSEAL-LYVITSPVGPYY--KTGFKAVRLE
DAAA_BACSH      PYTKDVLHKLLHDLIEKNNLNTGHVYFQITRGTTSRNHIFPDASVPAVLT----GNVKTGERSIENFEKG
DAAA_LISMO      PYSXXXXXXXXXXXVAENNINTGNVYLQVTRG-------VQNPRNHV----------IPDDFPLEGVRQF
ILVE_HAEIN      VPTELFVR-ACKEVVKANQDWLGYLRPFLIGVGENIGVKTAPEFIF-SVFCCPVGAYF--KGGLAPSNFI
PABC_BACSU      TVSKHEILEMXXXXXXXXXXXXGNVRLNISAGISDKGFVAQTYDKPTVLC-------FVNQLKPESLPLQ
ILVE_THEMA      -----------------------------------------------------------------GVEVK
BCAT1_ARATH     ----------------------------------------------------------------------
BCA2_YEAST      FDPEELITLIGKLIQQDKCVPEGYIRPTLIGTTAGLGVSTPDRALLYVICC-PVGPYY--KTGFKAVRLE
BCAT2_ARATH     PSVDQFVNLANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYAS-PVGNYFKEGMAALNLYVE
BCAL3_ARATH     PFDRETIKRILIQTVSVSGCRDGSLRYWLSAGPGDFLLSPSQTLYAIVIKT-------NFAINPIGVKVV
BCA1_SCHPO      SFDPAELAEIIRKFVAHENVPDQYIRPTFIGTDEALGVHHCDNAMLYVIAS-PVGPYYSSGFK--AVKLC
BCAT2_RAT       DFDKQELLECIRQLIEVDWVPDGYVRPVL-IGNEPSLGVGMVTQALLFVILCPVGSYFPGDSMTPVSLLA
ILVE_MYCLE      PELPDELFIDSLQLIAVDGEEALYLRPFIFATEPGLGVRPAKQYRYLLIAS-PVGAYFKGGINPVTVWVS
ILVE_MYCTU      PELPDAVFIESRQLIAVDGEEALYLRPFIFATEPGLGVRPATQYRYLLIAS-PAGAYFKGGIAPVSVWVS
BCAT1_MOUSE     -FDKEELLKCILQLLQIDQEASLYIRPT-FIGTEPSLGVKKPSKALLFVILSPVGPYFS-----SGSFTP
BCAT_DICDI      FNKEAVIELIKKLVLDKDWIPEGYLRPTLIATQNSLGVGASNSALMFVIAS-PVGPYYPEGFK--PVKLI
BCAT2_MOUSE     DFDKQELLECIRQLIEVDWVPDGYVRPVL-IGNEPSLGVGMVTQALLYVILCPVGSYFPGDSMTPVSLLA
PABC_VIBCH      ----------------------------VWQGLQSMILPQEKAGLKIHISRGLGGRGYSPTQVSESI-VT
BCAT_NEMVE      FNSGEMVECIRKLIVPHSNTCSLYIRPTMIGTQASLGVNKANSAMLFVILS-PVGPYFRTGTFNPVALLA
BCAT_CAEEL      FDSEEMINVLTELLVPNSDVCSLYLRPTLIGTDPTLGVGC-ATEAKMFVITGPVGAYYSTGFQPVSL-LA
PABC_ECOLI      PQLEQEMKLAAEQ-------QNGVLKVVISRGSGGRGYSTLNSGPATRISVTAYPAHYD-RLRNEGITLA
BCAT2_PONAB     DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPTRALLFVILCPVGTYF-PGGSVTPVSLF
PABC_VIBHA      -----------------------------WAMSATLKDESAGIKIHISRGCG--GRGYSPS-GVEGPVVT
TOXF_COCCA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
ILVE_RICCN      VSRWRKAMPDSTPVQSKSAAQYNMAITSKKEAKALGYEDALLLDYEGYIAECTTTNIFFKDK--ILYTPI
ILVE_METTH      VSTWRRMAPNTMPNMAKAGGNYLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSE-GEIYTPV
ILVE_RICPR      VSRWRKAMPNSTPVQSKSAAQYNMAITSKKEAKXXXXXXXXXXXXEGFIAECTTTNIFFKDKT--LYTPI
ILVE_RICFE      VGRWRKAIPDSTPVQSKSAAQYNMAITSKKEAKXXXXXXXXXXXXXXXIAECTTTNIFFKDKT--LYTPI
ILVE_PSEAE      TSSFTRHHVNISMTRAKSNGAYINSMLALQEAISGGADEAMMLDPEGYVAEGSGENIFI-IKDGVIYTPE
ILVE_RICTY      VSRWRKAMPDSTPVQSKSAAQYNMAITSKKEAKXXXXXXXXXXXXEGFIAECTTTNIFFV-KDTTLYTPI
ILVE_RICBR      VSRWRKAAPNMMPVQSKSAAHYNMAITSKKEAKXXXXXXXXXXXXXXXIAECTTTNIFFV-KDNVLYTPI
ILVE_ECOLI      VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
ILVE_ECOL6      VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
ILVE_ECO57      VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
ILVE_SALTY      VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
ILVE_SALTI      VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
ILVE_METJA      TVSVRRLPVDVLNPAVKSLN-YLNSVLAKIQANYAGVDEAFLLDDKGFVVEGTGDNIFIV-KNGVLKTPV
ILVE_AQUAE      VSSWRRNDDNSIPSRWKVAGAYVNSALAKTEALMSGYDEAILLNSQGYVAEGSGENIFI-IKNGKAITPS
ILVE_ARCFU      TVAVRRNSFDALPPNIKSLN-YLNNILAKIEANAKGGDEAIFLDRNGYVSEGSGDNIFVV-KNGAITTPP
ILVE_SYNY3      ISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAILMNSQGKVCEATGMNVFMV-RNGQIVTPG
BCAL1_ARATH     TATTRRNSPNNL--DSKXXXXXXXXXXAKIESNNTNAADAIMLDKDGYVSETNATNIFMV-KKGCVLTPH
BCAL2_ARATH     TATTRRNSPNNL--DSKXXXXXXXXXXAKIESNNANVDDAIMLDKDGFVSETNATNIFMVKKD-RVLTPH
DAAA_BACLI      VSAITADDMRWLRCDIKSLNL-LYNVMIKQKAQEASAFEAILI-RDGLVTEGTSSNVYVAKQNVIYTHPV
ILVE_STAAW      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYIEEVGSMNIFFVE-NGKVITPL
ILVE_STAAS      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYIEEVGSMNIFFVE-NGKVITPL
ILVE_STAAN      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYIEEVGSMNIFFVE-NGKVITPL
ILVE_STAAM      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYIEEVGSMNIFFVE-NGKVITPL
ILVE_STAAC      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYIEEVGSMNIFFVE-NGKVITPL
ILVE_STAES      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYVEEVGSMNIFFVE-NGKVVTPL
ILVE_STAEQ      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYVEEVGSMNIFFVE-NGKVVTPL
ILVE_STAAR      VEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWLDEQKYIEEVGSMNIFFVE-NGKVITPL
DAAA_BACSU      VAAITDEDLRWLRCDIKSLNL-LYNVMTKQRAYEAGAFEAILL-RDGVVTEGTSSNV-YAVINGTVRTPA
BCAT5_ARATH     VETEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDHKRYLEEVSSCNIFIV-KDNVISTPI
DAAA_LISMF      EQQFVQGGPEDVRWDIKSLNL-LGNILAKNKAHQQNALEAVL--HRGQVTECSASNISI-IKDGVLWTHA
ILVE2_BACSU     VESEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDEKKYIEEVGSMNIFFKI-NGEIVTPM
BCAT3_ARATH     VENEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDYKRYLEEVSSCNIFIV-KDNVISTPI
DAAA_STAAS      DIRWLR-------CDIKSLNL-LGNVLAKEYAVKYNAVEA--IQHRGETVTEGSSSNAYAIKDGVIYTPI
DAAA_STAAN      DIRWLR-------CDIKSLNL-LGNVLAKEYAVKYNAVEA--IQHRGETVTEGSSSNAYAIKDGVIYTPI
DAAA_STAAM      DIRWLR-------CDIKSLNL-LGNVLAKEYAVKYNAVEA--IQHRGETVTEGSSSNAYAIKDGVIYTPI
DAAA_STAAC      DIRWLR-------CDIKSLNL-LGNVLAKEYAVKYNAVEA--IQHRGETVTEGSSSNAYAIKDGVIYTPI
DAAA_STAAW      DIRWLR-------CDIKSLNL-LGNVLAKEYAVKYNAVEA--IQHRGETVTEGSSSNAYAIKDGVIYTPI
DAAA_STAAR      DIRWLR-------CDIKSLNL-LGNVLAKEYAVKYNAVEA--IQHRGETVTEGSSSNAYAIKDGVIYTPI
DAAA_BACYM      VKATFVEDIRWLRCDIKSLNL-LGAVLAKQEAHEKGCYEAI-LHRNNTVTEGSSSNV-FGIKDGILYTPA
ILVE1_BACSU     VEDEYVRAVNGGVGFAKTAGNYAASLQAQRKANELGYDQVLWLDEKKYVEEVGSMNIFFVI-NGEAVTPL
DAAA_STAHA      DIRWLR-------CDIKSLNL-LGNVLAKEYAVK--YNAGEAIQHRGTVTEGASSNV-YAIKDGAIYTPV
ILVE_HELPJ      TTAFDRAAPKGTG-GVKVGGNYAASLLAHKIATEQGYDDCIYLDPTTHIEEVGAANFFGITHDDAFITPH
BCAT7_ARATH     VDHNHRRAHFGGTGGVKSCTNYSPVVKSLIEAKSSGFSDVLFLDAATNIEEVSTCNIFILKGNIVSTPPT
BCAT4_ARATH     IEDQFRRAFPSGTGGVKSITNYCPVWIPLAEAKKQGFSDILFLDAATNIEELFAANVFML-KGNVVSTPI
DAAA_STAES      DIRWLR-------CDIKSLNL-LGNVLAKEYAVK--YNAAEAIQHRGDIVTEGASSNVYAIKDGVIYTPV
DAAA_STAEQ      DIRWLR-------CDIKSLNL-LGNVLAKEYAVK--YNAAEAIQHRGDIVTEGASSNVYAIKDGVIYTPV
DAAA_LISIN      IEGGSAITEEDVRWDIKSLNL-LGNILAKNKAHQQNALEAIL--HRGQVTECSASNVSI-IKDGVLWTHA
ILVE_HELPY      TTIFDRAAPKGTG-GVKVGGNYAASLLAHKMATEQGYDDCIYLDPTTHIEEVGAANFFGITHDDAFITPH
BCAT6_ARATH     VDHKYHRAHSGGTGGVKSCTNYSPVVKSLLEAKSAGFSDVLFLDAATNIEELTACNIFIVKGNIVSTPPT
ILVE_STRCO      VSEDRVRAVPGGMGDAKTGGNYXXXXXXXXXXXXKGCDQVCYLDERKWVEELGGMNLYFVYGNKIVTPSL
BCA1_YEAST      ATDYATRAWPGGVGDKKLGANYAPCILPQLQAAKRGYQQNLWLGPEKNITEVGTMNVFFTGKKELVTAPL
DAAA_BACSH      VKATLVEDVRWLRCDIKSLNL-LGAVLAKQEASEKGCYEAIL--HRGDITECSSANV-YGIKDGKLYTPA
DAAA_LISMO      VEGGTAITEEDVRWDIKSLNL-LGNILAKNKAHQQNALEAIL--HRGQVTECSASNVSI-IKDGVLWTHA
ILVE_HAEIN      TTDYDRAAPMGTG-GVKVGGNYAASLLPHELAAEQGFADAIYLDPKTHIEEVGAANFFGITKDNKFITPK
PABC_BACSU      VLSIRRNTPEGS--FRLKSHHYLNNMYAKREIGNDPRVEGIFLTEDGAVAEGIISNVFWR-KGRCIYTPS
ILVE_THEMA      ISNVRRIPDLSTPPALKITGRTDI-VLARREIVD--CYDVILLGLNGQVCEGSFSNVFLV-KEGKLITPS
BCAT1_ARATH     -------------------------------AKSRGFSDVLYLDADTNIEEVSAANIFLVKGNTIVTPAT
BCA2_YEAST      ATDYATRAWPGGCGDKKLGANYAPCVLPQLQAASRGYQQNLWLGPNNNITEVGTMNAFFVFKDSKVTAPL
BCAT2_ARATH     -EEYVRAAPGGAG-GVKSITNYAPVLKALSRAKSRGFSDVLYLDSKKYLEEASSCNVFVV-KGRTISTPA
BCAL3_ARATH     TSSIPIKPPE---FATVKSVNYLPNVLSQMEAEAKGAYAGIWVCKDGFIAEGPNMNVAFVVNGGELVMPR
BCA1_SCHPO      CSEESVRAWPGGTGHYKLGGNYAPSVLPQKEAAKKGYAQILWLGDEDYITEVGTMNCFWINKNGEITAPL
BCAT2_RAT       DPSFVRAWIGGV-GDCKLGGNYGPTVAVQQEAQKKGCEQVLWLDHQLTEVGTMNIFVYWTHEDGELEPPL
ILVE_MYCLE      MEYVRASPGGT--GAAKFGGNYXXXXXXXXXXXXNGCDQVVWLDERRFVEEMGGMNIFFVLGSGRLVTPL
ILVE_MYCTU      -TEYVRACPGG-TGAAKFGGNYXXXXXXXXXXXXNGCDQVVWLDERRYIEEMGGMNIFFVLGSGRLVTPL
BCAT1_MOUSE     VSLWANPAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNITEVGTMNLFLEDGEEELATPP
BCAT_DICDI      ADDQYVRAWAGGSGAFKLGSNYAPTIFPQLEAAKKGFSQVLWLLND-YVTEVGTMNVFWNNAQGEITPPL
BCAT2_MOUSE     DPSFVRAWIGGV-GDCKLGGNYGPTVAVQREAQKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
PABC_VIBCH      ISAFAFPA-HYQAWRDKGMGLNPLLAGHKHEMDNAGWDDGVCLDINGKVIETTAANIFWC-RDGTMFTPL
BCAT_NEMVE      DPQYVRAWPGGV-GDCKMGGNYAPTILAQQNAERQGLQQVLWLDHQITEVGTMNMFMFWINENGEVTPPL
BCAT_CAEEL      DSRFIRAFPGGVGAYKMGCNYAPTIWVGKEAASKNCQQVLWLYGENEDLTEVGTMNIFWKNEEGDMELIT
PABC_ECOLI      LSPVRLGRNPHLAGIKHLNRLEQV--LIRSHLEQTNADEALVLDSEGWVTECCAANLFWR-KGNVVYTPL
BCAT2_PONAB     IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKQGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
PABC_VIBHA      ISNFSFPA-HYLAWQERGVQLGVCETLAKAEIDGTEFADAVTLNVQNHVIETTMANLFWV-KDEKVFTPL
TOXF_COCCA      ----------------------------------------------------------------QIILPE


                         .         .         .         +         .         .         .:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLN
ILVE_RICCN      ADRFLNGITRQTIIEIAKDLGLEVKEERLKLEQIEDFTGCFVTGTAIEVQNIDSIDLGNKKIIHKIADLK
ILVE_METTH      SSSLLRGITRDSVIKIARTEGVTVHEEPITREMLYIADEAFFTGTAAEITPIRSV---------------
ILVE_RICPR      ADRFLNGITRKTIIEIAKSLCLEVKEERLKLAQIEHFTGCFVTGTAIEVQNISSI---------------
ILVE_RICFE      ADRFLNGITRQTIIEIAKDLGLEVKEERLKLEQIENFTGCFVTGTAIEVQNIDSIDLGNKKITHQIADLK
ILVE_PSEAE      VTACLNGITRNTILTLAAEHGFKLVEKRITRDEVYIADEAFFTGTAAEVTPI------------------
ILVE_RICTY      ADRFLNGITRKTIIEIAKNLCLEVKEERLKLAQIEYFTGCFVTGTAIEVQNISSIGDKKFEDCKIADLLK
ILVE_RICBR      ADRFLDGITRQTIIEIAKNLGLEVKEERLKLEQIEDFISCFATGTAIEVQNINSIDIGNKKVIHKIADLK
ILVE_ECOLI      TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
ILVE_ECOL6      TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
ILVE_ECO57      TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
ILVE_SALTY      TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
ILVE_SALTI      TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
ILVE_METJA      YQSILKGITRDVVIKLAKEEGIEVVEEPLTLHDLYTADELFITGTAAEIVPV------------------
ILVE_AQUAE      PEHILEGITRNAVIXXXXXXXXXXXXRPIARSELYTADEVFLTGTAAEVTPVVEIDNRK-----------
ILVE_ARCFU      TINNLRGITREAVIEIINRLGIPFKETNIGLYDLYTADEVFVTGTAAEIAPIVVIDGRK-----------
ILVE_SYNY3      NEQILEGITRDSILTIAADLGIPTCQRPIDKSELMIADEVFLSGTAAKITPVKRI---------------
BCAL1_ARATH     ADYCLPGITRATVMELVVKENFILEERRISLSEFHTANEVWTTGTMGELSPV------------------
BCAL2_ARATH     ADYCLPGITRATVMELVVKENFILEERRISLSEFHTADEVWTTGTMGELSPV------------------
DAAA_BACLI      TTLILNGITRMKVLQLCEENGLNYEEKAVTKDELLNADEVFITSTTAEVIPVTSI---------------
ILVE_STAAW      NGSILPGITRKSIIELAKNLGYEVEERRVSIDELGELTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAAS      NGSILPGITRKSIIELAKNLGYEVEERRVSIDELGELTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAAN      NGSILPGITRKSIIELAKNLGYEVEERRVSIDELGELTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAAM      NGSILPGITRKSIIELAKNLGYEVEERRVSIDELGELTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAAC      NGSILPGITRKSIIELAKNLGYEVEERRVSIDELGELTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAES      NGSILPGITRKSIIQLAEDLGYEVEERRVSIEELFNLTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAEQ      NGSILPGITRKSIIQLAEDLGYEVEERRVSIEELFNLTEVFGSGTAAVISPVGTL---RYEDREIVINNN
ILVE_STAAR      NGSILPGITRKSIIELAKNLGYEVEERRVSIDELGELTEVFGSGTAAVISPVGTL---RYEDREIVINNN
DAAA_BACSU      NRLILNGITRMNILGLIEKNGIKLDETPVSEEELKQAEEIFISSTTAEIIPV------------------
BCAT5_ARATH     KGTILPGITRKSIIEVARSQGFKVEERNVTVDELVEADEVFCTGTAVVLSPVGSI---------------
DAAA_LISMF      ADNILNGITRQVIIAVAKKNGIPVKEADFTLTDLREADEVFISSTTIEITPVTHI---------------
ILVE2_BACSU     LNSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQLEEAFGTGTAAVISPV------------------
BCAT3_ARATH     KGTILPGITRKSMIDVARTQGFQVEERNVTVDELLEADEVFCTGTAVVVSPVGSV---------------
DAAA_STAAS      NNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLRNADEVIVSSTSAEVTPV------------------
DAAA_STAAN      NNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVSSTSAEVTPV------------------
DAAA_STAAM      NNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVSSTSAEVTPV------------------
DAAA_STAAC      NNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLKNADEVIVSSTSAEVTPV------------------
DAAA_STAAW      NNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLRNADEVIVSSTSAEVTPV------------------
DAAA_STAAR      NNYILNGITRIVIKKIAEDYNIPFKEETFTVDFLRNADEVIVSSTSAEVTPV------------------
DAAA_BACYM      NNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPV------------------
ILVE1_BACSU     SGSILSGVTRASAIELIRSWGIPVREERISIDEVGELTEVFGTGTAAVVTPV------------------
DAAA_STAHA      NNYILNGITRKVIKWISEDEDIPFKEETFTVEFLKNADEVIVSSTSAEVTPVVKIDGEQVKVGPVTRQLQ
ILVE_HELPJ      SPSILPSVTRKSLMVLAKEHKLKVEEREILIDELGAFKEAGACGTAAIITPIKEIAHN------------
BCAT7_ARATH     SGTILPGITRKSICELARDIGYEVQERDLSVDELLEAEEVFCTGTAVVIKAVETV---------------
BCAT4_ARATH     AGTILPGVTRNCVMELCRDFGYQVEERTIPLVDFLDADEAFCTGTASIVTSIASV---------------
DAAA_STAES      NNFILNGITRRVIKWIAEDEQIPFKEEKFTVEFLKSADEVIISSTSAEVMPITKI---------------
DAAA_STAEQ      NNFILNGITRRVIKWIAEDEQIPFKEEKFTVEFLKSADEVIISSTSAEVMPITKI---------------
DAAA_LISIN      ADNILNGITRQVIIDVAKKNGIPVKEADFTLTDL------------------------------------
ILVE_HELPY      SPSILPSITKKSLMVLAKEYNLKVEEREILMDELDAFKEAGACGTAAIITPIKEIVHN------------
BCAT6_ARATH     SGTILPGVTRKSISELAHDIGYQVEERDVSVDEL------------------------------------
ILVE_STRCO      TGSILEGVTRDSLLTVARDLGYEAEEGRVSDSENGTLTEVFACGTAAVITPVGTV---------------
BCA1_YEAST      DGTILEGVTRDSVLTLARDKEWDINERYYTITEVAELLEAFGSGTAAVVSPIKEIGWN------------
DAAA_BACSH      NNYILNGITRQVILKCAAEINLPVIEEPMTKGDL------------------------------------
DAAA_LISMO      ADNILNGITRQVIIDVAKKNGIPVKEADFTLTDL------------------------------------
ILVE_HAEIN      SESILPSITKYSLLHIAKERGMEAIEGDVYIDQLDQFVEAGACGTAAVITPVGGIQHNKFHVFDS-----
PABC_BACSU      LDTILDGVTRRFIIENAKDIGLELKTGRYELEALLTADEAWMTNSVLEIIPFTKIEE-------------
ILVE_THEMA      LDSILDGITRENVIKLAKSLEIPVEERVVWVWELFEADEMFLTHTSAGVVPVRRLNEHSF----------
BCAT1_ARATH     SGTILGGITRKSIIEIALDLGYKVEERSVPVEELKEAEEVFCTGTAAGVASVGSITRTEYKVGDGIV---
BCA2_YEAST      DGTILEGVTRDSILNLAKEREWTISERYFTIGEVTELLEAFGSGTAAIVSPI------------------
BCAT2_ARATH     TNTILEGITRKSVMEIASDQGYQVVEKAV-----------------------------------------
BCAL3_ARATH     FDNVLSGCTAKRTLTLAESKGI------------------------------------------------
BCA1_SCHPO      DGMILPGVTRDSILEICREKGWKITEGKYSMKEVARLLEVFGAGTAALVSPVKAI---NYKGTEYEIPMP
BCAT2_RAT       DGIILPGVVRQSLLDLARTWGFRVAERKVTMKELKRALEVFGSGTACQVCPV------------------
ILVE_MYCLE      SGSLLPGVTRASLLQLAIDAGFSVEERKIKKAAAGEITEVFACGTAAFITPVS-----------------
ILVE_MYCTU      SGSLLPGITRDSLLQLAIDAGFAVEERRIKKAAAGEITEVFACGTAAVITPVARVGASEFRIAD------
BCAT1_MOUSE     LDGILPGVTRQSILELAQQWGFKVCERHLTMDDLATALEMFGSGTACVVCPVSDI---------------
BCAT_DICDI      GDTILPGVTRDSILKLTQQWGFKITEKNFTMTELAKAIEAFGAGTAAIVSPIESIS--------------
BCAT2_MOUSE     NGVILPGVVRQSLLDLARTWGFRVAERKVTMKELKRALEVFGSGTACQVCPV------------------
PABC_VIBCH      RHAGVAGVARRQILELAQQQEIPIVIDEFTLEDLLSAEEVFITNALLEVAPVTQIGQQRLTI--------
BCAT_NEMVE      NGLILPGVTRDSLLALAKRWGFKVTERTLMATEENRMLEMFGSGTACVVCPINRI---------------
BCAT_CAEEL      PGLILPGVTRDSLLELGREWGYKVTERTLNMEEVKKALSMFGSGTACVVSPVGKI---------------
PABC_ECOLI      DQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPVMPVCACGDVSF----------
BCAT2_PONAB     NGVILPGVVRQSLLDLAQTWGFRVVERTITTKQLLQALEVFGSGTACQVCPV------------------
PABC_VIBHA      CLSGVAGVMRRKVLEYLQSEGYSVQVXXXXXXXXXXXXEVWMCNSLLGVAPVSGISENK-----------
TOXF_COCCA      SAAAIQSITSDSVAWLAKSFGWNIVKQPVTIDELASLSEVMAVGTAAGLVPVSCIRHN------------


                         .         *         .         .         .         .         +:350
query           ESYQALVRKRKAx
ILVE_RICCN      EEYRRVVRE----
ILVE_METTH      -------------
ILVE_RICPR      -------------
ILVE_RICFE      KEYGRIVRE----
ILVE_PSEAE      -------------
ILVE_RICTY      KEYLRIVR-----
ILVE_RICBR      EEYGKIVR-----
ILVE_ECOLI      -------------
ILVE_ECOL6      -------------
ILVE_ECO57      -------------
ILVE_SALTY      -------------
ILVE_SALTI      -------------
ILVE_METJA      -------------
ILVE_AQUAE      -------------
ILVE_ARCFU      -------------
ILVE_SYNY3      -------------
BCAL1_ARATH     -------------
BCAL2_ARATH     -------------
DAAA_BACLI      -------------
ILVE_STAAW      ET-----------
ILVE_STAAS      ET-----------
ILVE_STAAN      ET-----------
ILVE_STAAM      ET-----------
ILVE_STAAC      ET-----------
ILVE_STAES      E------------
ILVE_STAEQ      E------------
ILVE_STAAR      ET-----------
DAAA_BACSU      -------------
BCAT5_ARATH     -------------
DAAA_LISMF      -------------
ILVE2_BACSU     -------------
BCAT3_ARATH     -------------
DAAA_STAAS      -------------
DAAA_STAAN      -------------
DAAA_STAAM      -------------
DAAA_STAAC      -------------
DAAA_STAAW      -------------
DAAA_STAAR      -------------
DAAA_BACYM      -------------
ILVE1_BACSU     -------------
DAAA_STAHA      EGFNKYIESRSS-
ILVE_HELPJ      -------------
BCAT7_ARATH     -------------
BCAT4_ARATH     -------------
DAAA_STAES      -------------
DAAA_STAEQ      -------------
DAAA_LISIN      -------------
ILVE_HELPY      -------------
BCAT6_ARATH     -------------
ILVE_STRCO      -------------
BCA1_YEAST      -------------
DAAA_BACSH      -------------
DAAA_LISMO      -------------
ILVE_HAEIN      -------------
PABC_BACSU      -------------
ILVE_THEMA      -------------
BCAT1_ARATH     -------------
BCA2_YEAST      -------------
BCAT2_ARATH     -------------
BCAL3_ARATH     -------------
BCA1_SCHPO      EGQEA--------
BCAT2_RAT       -------------
ILVE_MYCLE      -------------
ILVE_MYCTU      -------------
BCAT1_MOUSE     -------------
BCAT_DICDI      -------------
BCAT2_MOUSE     -------------
PABC_VIBCH      -------------
BCAT_NEMVE      -------------
BCAT_CAEEL      -------------
PABC_ECOLI      -------------
BCAT2_PONAB     -------------
PABC_VIBHA      -------------
TOXF_COCCA      -------------