[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ20943.1

[Show Plain Result]


## Summary of Sequence Search
    1::165
   26::171     1e-14  27%  182 aa  ATPF_RHORU RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   26::171     1e-14  27%  182 aa  ATPF_RHORT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   22::169     1e-12  27%  175 aa  ATPF_CHLPB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    7::123     4e-12  30%  163 aa  ATPF2_RHILO RecName: Full=ATP synthase subunit b 2;AltName:
   42::179     4e-12  25%  188 aa  ATPF1_BARHE RecName: Full=ATP synthase subunit b 1;AltName:
   34::173     2e-11  27%  177 aa  ATPF_MESFL RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   18::166     2e-11  28%  175 aa  ATPF_LACS1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::160     4e-11  23%  161 aa  ATPF_SINMW RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    4::150     7e-11  26%  164 aa  ATPF_RICFE RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   22::168     9e-11  29%  175 aa  ATPF_PROVI RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::179     2e-10  29%  181 aa  ATPF_MYCMS RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   28::107     2e-10  34%  185 aa  ATPF_RHOCA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   22::169     3e-10  27%  175 aa  ATPF_CHLTE RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::160     3e-10  21%  161 aa  ATPF_RHIME RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::157     3e-10  25%  161 aa  ATPF_BRAJA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   16::152     4e-10  32%  163 aa  ATPF_ILYTA RecName: Full=ATP synthase subunit b, sodium ion
    4::150     6e-10  27%  164 aa  ATPF_RICCN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::158     7e-10  22%  159 aa  ATPF2_MESSB RecName: Full=ATP synthase subunit b 2;AltName:
   14::155     1e-09  27%  156 aa  ATPF_COXBU RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   14::155     1e-09  27%  156 aa  ATPF_COXBR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   14::155     1e-09  27%  156 aa  ATPF_COXBN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   14::155     1e-09  27%  156 aa  ATPF_COXB2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   14::155     1e-09  27%  156 aa  ATPF_COXB1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::163     2e-09  28%  163 aa  ATPF_CALS8 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    6::162     3e-09  25%  163 aa  ATPF_RHOP2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   50::166     3e-09  27%  171 aa  ATPF_CLOD6 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    4::160     3e-09  23%  164 aa  ATPF2_BART1 RecName: Full=ATP synthase subunit b 2;AltName:
   19::164     4e-09  25%  171 aa  ATPF_LACPL RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   41::167     6e-09  28%  171 aa  ATPF_STAES RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   41::167     6e-09  28%  171 aa  ATPF_STAEQ RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   36::93      6e-09  43%  190 aa  ATPF_SILPO RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   55::179     6e-09  24%  181 aa  ATPF_MYCCT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   16::149     8e-09  31%  168 aa  ATPF_PROMO RecName: Full=ATP synthase subunit b, sodium ion
   20::72      1e-08  42%  176 aa  ATPF_SPHAL RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   22::155     1e-08  28%  175 aa  ATPF_CHLPD RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   22::155     1e-08  27%  175 aa  ATPF_CHLL2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     2e-08  28%  164 aa  ATPF_STRP3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   39::167     3e-08  21%  187 aa  ATPF_ERYLH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   43::145     5e-08  27%  162 aa  ATPF_THELT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   46::172     5e-08  28%  176 aa  ATPF_STAHJ RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   40::165     5e-08  26%  174 aa  ATPF_LEPBP RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   40::165     5e-08  26%  174 aa  ATPF_LEPBA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   14::162     5e-08  27%  168 aa  ATPF_LACF3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   27::167     5e-08  24%  172 aa  ATPF_BACME RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   18::165     9e-08  23%  169 aa  ATPF_SALRD RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::160     9e-08  24%  165 aa  ATPF_BACFR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::160     9e-08  24%  165 aa  ATPF_BACFN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   15::84      9e-08  36%  173 aa  ATPF1_ACICJ RecName: Full=ATP synthase subunit b 1;AltName:
   27::179     1e-07  27%  187 aa  ATPF_CLOPH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::153     1e-07  24%  156 aa  ATPF_BAUCH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   15::160     2e-07  26%  164 aa  ATPF_STRGC RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    6::162     2e-07  21%  163 aa  ATPF_RHIEC RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::74      2e-07  30%  161 aa  ATPF_NITWN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   39::154     2e-07  27%  162 aa  ATPF_LACC3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   46::161     2e-07  25%  165 aa  ATPF_STRTD RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   46::161     2e-07  25%  165 aa  ATPF_STRT2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   46::161     2e-07  25%  165 aa  ATPF_STRT1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    6::60      3e-07  42%  163 aa  ATPF_RHOPT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    6::60      3e-07  42%  163 aa  ATPF_RHOPA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   24::167     3e-07  24%  173 aa  ATPF_PEDPA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   13::157     3e-07  30%  165 aa  ATPF_ELUMP RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    3::62      3e-07  39%  163 aa  ATPF_BRASB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    4::150     3e-07  23%  157 aa  ATPF_RICBR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::119     3e-07  26%  161 aa  ATPF1_PARL1 RecName: Full=ATP synthase subunit b 1;AltName:
   31::156     5e-07  24%  161 aa  ATPF_BACSK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     6e-07  22%  164 aa  ATPF_STRR6 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     6e-07  22%  164 aa  ATPF_STRPS RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     6e-07  22%  164 aa  ATPF_STRPN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     6e-07  22%  164 aa  ATPF_STRPI RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     6e-07  22%  164 aa  ATPF_STRP4 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::160     6e-07  22%  164 aa  ATPF_STRP2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   36::162     6e-07  23%  176 aa  ATPF_OENOB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   43::158     6e-07  23%  163 aa  ATPF_BACPF RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::163     8e-07  21%  164 aa  ATPF_GRAFK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   43::158     8e-07  22%  161 aa  ATPF_FERNB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::155     8e-07  23%  159 aa  ATPF2_OCHA4 RecName: Full=ATP synthase subunit b 2;AltName:
   60::160     8e-07  25%  164 aa  ATPF2_BARHE RecName: Full=ATP synthase subunit b 2;AltName:
   30::118     1e-06  28%  180 aa  ATPF_SULSY RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   17::151     1e-06  22%  156 aa  ATPF_PSEAE RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   17::151     1e-06  22%  156 aa  ATPF_PSEAB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   17::151     1e-06  22%  156 aa  ATPF_PSEA7 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   37::182     1e-06  30%  184 aa  ATPF_MYCMO RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   15::163     1e-06  23%  171 aa  ATPF_LACBA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   39::159     1e-06  26%  159 aa  ATPF_CLOPS RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   14::66      2e-06  44%  169 aa  ATPF_CAUCR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    4::154     2e-06  21%  167 aa  ATPF_RICPR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::74      2e-06  28%  161 aa  ATPF_NITHX RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   39::154     2e-06  26%  162 aa  ATPF_LACCB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    9::145     3e-06  28%  159 aa  ATPF_CLOBB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    9::145     3e-06  28%  159 aa  ATPF_CLOBA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::155     4e-06  26%  156 aa  ATPF_FRAP2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   32::170     4e-06  28%  170 aa  ATPF_CAMC1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   93::180     5e-06  32%  180 aa  RRF_CHLFF RecName: Full=Ribosome-recycling factor;       
  450::596     5e-06  33%  856 aa  PLPA_MYCGA RecName: Full=Fibronectin-binding protein plpA;AltName:
 1560::1695    5e-06  23% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
    6::60      5e-06  36%  163 aa  ATPF_RHOPS RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::58      5e-06  33%  162 aa  ATPF_METRJ RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   53::176     5e-06  24%  186 aa  ATPF_MESVI RecName: Full=ATP synthase subunit b,
   15::165     5e-06  27%  166 aa  ATPF_FLAPJ RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    8::159     5e-06  22%  167 aa  ATPF_ALKOO RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   21::165     7e-06  23%  174 aa  ATPF_ENTHR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    7::60      7e-06  33%  164 aa  ATPF_AZOC5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   37::158     9e-06  25%  167 aa  ATPF_LEUMM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   24::172     9e-06  19%  179 aa  ATPF_ANADE RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     1e-05  24%  168 aa  ATPF_BACWK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   11::151     1e-05  22%  156 aa  ATPF_ACIAD RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::155     1e-05  24%  156 aa  ATPF2_PSEA6 RecName: Full=ATP synthase subunit b 2;AltName:
   93::180     1e-05  32%  180 aa  RRF_CHLAB RecName: Full=Ribosome-recycling factor;       
    1::155     1e-05  26%  156 aa  ATPF_SHEHH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   13::155     1e-05  22%  156 aa  ATPF_LEGPL RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   13::155     1e-05  22%  156 aa  ATPF_LEGPH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   13::155     1e-05  22%  156 aa  ATPF_LEGPC RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   13::155     1e-05  22%  156 aa  ATPF_LEGPA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    4::63      1e-05  36%  164 aa  ATPF_BRASO RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   32::104     1e-05  30%  170 aa  ATPF_ARCB4 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    8::157     2e-05  19%  162 aa  ATPF_NATTJ RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   42::138     2e-05  26%  162 aa  ATPF_BACHD RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   93::180     2e-05  30%  180 aa  RRF_CHLCV RecName: Full=Ribosome-recycling factor;       
   95::250     2e-05  26%  299 aa  LZTL1_HUMAN RecName: Full=Leucine zipper transcription factor-like
    1::155     2e-05  26%  156 aa  ATPF_SHEPA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   84::201     2e-05  24%  208 aa  ATPF_MYCGE RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   25::172     2e-05  18%  178 aa  ATPF_MAGSA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    6::151     2e-05  23%  159 aa  ATPF_CLOAB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    8::155     2e-05  23%  156 aa  ATPF2_VIBHB RecName: Full=ATP synthase subunit b 2;AltName:
   95::250     3e-05  26%  299 aa  LZTL1_PONAB RecName: Full=Leucine zipper transcription factor-like
   95::250     3e-05  26%  299 aa  LZTL1_MACFA RecName: Full=Leucine zipper transcription factor-like
   76::202     4e-05  28%  430 aa  TEKT2_MACFA RecName: Full=Tektin-2;
    9::153     4e-05  22%  154 aa  ATPF_VIBFM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    9::153     4e-05  22%  154 aa  ATPF_VIBF1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   36::163     4e-05  32%  169 aa  ATPF_UNCTG RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   63::165     4e-05  26%  170 aa  ATPF_BACA2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   36::170     4e-05  23%  184 aa  ATPF_ANEMR RecName: Full=ATP synthase subunit b,
    7::113     4e-05  24%  163 aa  ATPF1_XANP2 RecName: Full=ATP synthase subunit b 1;AltName:
   52::181     6e-05  24%  281 aa  Y8CB_CAEEL RecName: Full=Uncharacterized protein Y116A8C.11;
   86::224     6e-05  27%  330 aa  TFB3_CANGA RecName: Full=RNA polymerase II transcription factor B
  724::847     6e-05  20%  905 aa  CIP2A_HUMAN RecName: Full=Protein CIP2A;AltName: Full=Cancerous
   37::160     6e-05  21%  164 aa  ATPF_STRSV RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   30::66      6e-05  43%  184 aa  ATPF_PARDP RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   42::185     6e-05  21%  190 aa  ATPF_NOSP7 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   19::167     6e-05  21%  176 aa  ATPF_ENTFA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   73::191     6e-05  25%  192 aa  ATPF_DESDG RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   27::170     6e-05  22%  175 aa  ATPF1_SYNP2 RecName: Full=ATP synthase subunit b 1;AltName:
   12::78      7e-05  38%  424 aa  SYS_GEOSW RecName: Full=Seryl-tRNA synthetase;       
   19::160     7e-05  25%  169 aa  ATPF_LEUCK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::155     9e-05  24%  156 aa  ATPF_SHEON RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   24::172     9e-05  19%  179 aa  ATPF_ANASK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::110     9e-05  20%  161 aa  ATPF1_BEII9 RecName: Full=ATP synthase subunit b 1;AltName:
  324::401     1e-04  41%  777 aa  HOOK_CAEEL RecName: Full=Zygote defective protein 12;
   49::127     1e-04  33%  205 aa  ATPF_UREPA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   49::127     1e-04  33%  205 aa  ATPF_UREP2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   13::158     1e-04  18%  163 aa  ATPF_PETMO RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   81::194     1e-04  22%  198 aa  ATPF_MYCGA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::98      2e-04  34%  184 aa  VATE_FINM2 RecName: Full=V-type proton ATPase subunit E;AltName:
  978::1081    2e-04  31% 1418 aa  MIT1_SCHPO RecName: Full=Chromatin remodeling factor mit1;       
   17::164     2e-04  30%  168 aa  ATPF_STRSY RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   17::164     2e-04  30%  168 aa  ATPF_STRS2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    8::61      2e-04  35%  164 aa  ATPF_RHOP5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   50::163     2e-04  24%  168 aa  ATPF_LACLS RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   50::163     2e-04  24%  168 aa  ATPF_LACLM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   50::163     2e-04  24%  168 aa  ATPF_LACLA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::144     2e-04  26%  157 aa  ATPF1_METCA RecName: Full=ATP synthase subunit b 1;AltName:
  693::790     2e-04  24%  945 aa  CIN8_ASHGO RecName: Full=Kinesin-like protein CIN8;
   60::144     2e-04  25%  156 aa  ATPF_PSYCK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   30::170     2e-04  20%  171 aa  ATPF_CAMHC RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   31::170     2e-04  21%  187 aa  ATPF_ANGEV RecName: Full=ATP synthase subunit b,
  323::444     3e-04  36%  821 aa  SLK19_YEAST RecName: Full=Kinetochore protein SLK19;AltName:
   61::161     3e-04  18%  164 aa  ATPX_CYAPA RecName: Full=ATP synthase B' chain, cyanelle;AltName:
   33::155     3e-04  27%  156 aa  ATPF_ERWT9 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   76::157     4e-04  29%  430 aa  TEKT2_HUMAN RecName: Full=Tektin-2;AltName: Full=Testicular
   56::178     4e-04  26%  456 aa  SHOT1_PONAB RecName: Full=Shootin-1;
   56::178     4e-04  26%  631 aa  SHOT1_HUMAN RecName: Full=Shootin-1;
  143::278     4e-04  28%  777 aa  LON_BUCAI RecName: Full=ATP-dependent protease La;       
   29::155     4e-04  24%  156 aa  ATPF_SHEB5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   34::152     4e-04  25%  182 aa  ATPF_GUITH RecName: Full=ATP synthase subunit b,
   54::172     4e-04  23%  177 aa  ATPF_GEOKA RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   64::141     4e-04  26%  156 aa  ATPF_ACIBY RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   64::141     4e-04  26%  156 aa  ATPF_ACIBT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   64::141     4e-04  26%  156 aa  ATPF_ACIBC RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   64::141     4e-04  26%  156 aa  ATPF_ACIB5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   64::141     4e-04  26%  156 aa  ATPF_ACIB3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   60::160     4e-04  22%  164 aa  ATPF2_BARQU RecName: Full=ATP synthase subunit b 2;AltName:
   72::202     5e-04  28%  284 aa  PF08_PLAF7 RecName: Full=Uncharacterized protein MAL7P1.13;
   29::155     5e-04  24%  156 aa  ATPF_SHEB9 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   29::155     5e-04  24%  156 aa  ATPF_SHEB8 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   27::65      5e-04  38%  184 aa  ATPF_RHOS5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   61::155     5e-04  25%  156 aa  ATPF_MANSM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   50::164     5e-04  31%  170 aa  ATPF_LISMF RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   31::153     5e-04  28%  154 aa  ATPF_KLEP7 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   33::155     5e-04  28%  156 aa  ATPF_KLEP3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   47::163     5e-04  17%  169 aa  ATPF_DEHE1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   63::165     5e-04  24%  170 aa  ATPF_BACP2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     5e-04  21%  168 aa  ATPF_BACCN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::63      5e-04  29%  166 aa  ATPF1_GLUOX RecName: Full=ATP synthase subunit b 1;AltName:
  563::674     6e-04  24%  976 aa  SYCP1_HUMAN RecName: Full=Synaptonemal complex protein 1;       
   92::179     6e-04  30%  179 aa  RRF_CHLMU RecName: Full=Ribosome-recycling factor;       
  390::504     6e-04  31% 1101 aa  CC150_HUMAN RecName: Full=Coiled-coil domain-containing protein
  399::532     6e-04  22%  691 aa  BRE1_DEBHA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
   21::131     6e-04  24%  172 aa  ATPF_TROWT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   21::131     6e-04  24%  172 aa  ATPF_TROW8 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    4::122     6e-04  21%  167 aa  ATPF_RICTY RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   50::164     6e-04  31%  170 aa  ATPF_LISW6 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   33::155     6e-04  28%  156 aa  ATPF_ENT38 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     6e-04  21%  168 aa  ATPF_BACC7 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     6e-04  21%  168 aa  ATPF_BACC2 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     6e-04  21%  168 aa  ATPF_BACC1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  943::1053    8e-04  30% 1351 aa  YR555_MIMIV RecName: Full=Uncharacterized protein R555;
  543::685     8e-04  27% 1102 aa  CN145_MOUSE RecName: Full=Uncharacterized protein C14orf145
 1258::1402    8e-04  29% 2701 aa  CENPE_HUMAN RecName: Full=Centromere-associated protein E;AltName:
  681::800     8e-04  25%  954 aa  CCD46_MOUSE RecName: Full=Coiled-coil domain-containing protein 46;
    3::151     8e-04  22%  156 aa  ATPF_XANOR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    3::151     8e-04  22%  156 aa  ATPF_XANOP RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    3::151     8e-04  22%  156 aa  ATPF_XANOM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   15::151     8e-04  24%  167 aa  ATPF_CYTH3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   12::121     8e-04  20%  171 aa  ATPF_CAUSK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACHK RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACCZ RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACCR RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACC4 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACC0 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACAN RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   48::168     8e-04  21%  168 aa  ATPF_BACAH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    1::165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDNAQNKLDTAQT
ATPF_RHORU      ---DPAFWVSIAFLMVVG-FVYIKAKNKILGALDGRGAAVKAKLDEARKLRDDAQALLAEYQRRQRDAMK
ATPF_RHORT      ---DPAFWVSIAFLMVVG-FVYIKAKNKILGALDGRGAAVKAKLDEARKLRDDAQALLAEYQRRQRDAMK
ATPF_CHLPB      ------FWTTVTFLIVLFILKKFTWGPMLSALEERE-KGIKNSIDRAQSAKEEAEAVLNKNRQLLAQAGA
ATPF2_RHILO     ----ATLWATIALIIFLGVAIYIKVPGLIAKALDARAARISSELDEARKLRDEAQQLLGQYXXXXXXXXX
ATPF1_BARHE     ------FWLAISFGLFYLFISRVIVP-RIGGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLAQARS
ATPF_MESFL      ----------IVLVVILSKLMYKPFRKTIKDRRNK----INELLSEAVQKQTEANIGVRKAEALLQDAKT
ATPF_LACS1      ---DFIFYI-VTFLILL-ALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVEKRDLALKNSRS
ATPF_SINMW      MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNXXXXXXXXXXXXQSLVAEYQRKRKDXXX
ATPF_RICFE      --LDESFWLAVSFIIFV-YLIYRPAKKAILNSLDAKILEVQEKVLKAEKLKEDAALLFEQTNAQIQKLET
ATPF_PROVI      ------FWTAITFVLVL--LILKKIAWPILGALEEREKGIQSSIDRAYGAKEEAEAILRQNKETLAKAEA
ATPF_MYCMS      -------------------LVYKPYKQMIEKQTQKITEVLSDAIEK----QTQANIKIKQANTLLEDAKT
ATPF_RHOCA      ---NAHFVILVAFLIFVGVLIKFKVPSMLLGMLDKRAEGIKADLDEAKALRDEAQKILASYERKAREVQG
ATPF_CHLTE      ------FWTALTFLI---VLVILRKTAPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRXXXXXXXX
ATPF_RHIME      MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNXXXXXXXXXXXXQSLVAEYQRKRKDXXX
ATPF_BRAJA      MFFDPETWVAIAFVILMVVFGYLGVFKSAMTALDHRAARIKAELDDATRLKQEAAKVLADYKARSATAER
ATPF_ILYTA      ------FWQIINFLILM--FFFKKYFQKISKVLDARKEKIANELKQAEIDREMAAKANEETQGILKAART
ATPF_RICCN      --LDESFWLAVSFVIFL-YLVYRPAKKAILNSLDAKILEVQEKVLQAEKLKEDAALLFKHTNAQIKKLET
ATPF2_MESSB     --MDATFWALVALIIFVGILLYMKVPGMLAGSLDARAERIKNXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ATPF_COXBU      ------------FVVFIGLTMKFIWPP-LTKALEARRKNIADGLAAAEEGRKELELAEIKSKEQLTEAKT
ATPF_COXBR      ------------FVVFIGLTMKFIWPP-LTKALEARRKNIADGLAAAEEGRKELELAEIKSKEQLTEAKT
ATPF_COXBN      ------------FVVFIGLTMKFIWPP-LTKALEARRKNIADGLAAAEEGRKELELAEIKSKEQLTEAKT
ATPF_COXB2      ------------FVVFIGLTMKFIWPP-LTKALEARRKNIADGLAAAEEGRKELELAEIKSKEQLTEAKT
ATPF_COXB1      ------------FVVFIGLTMKFIWPP-LTKALEARRKNIADGLAAAEEGRKELELAEIKSKEQLTEAKT
ATPF_CALS8      ------FWAIINFLILY--LIYRKFFKKVTAFMEKRSKMIQEQLDFAAKSKEEAIKLKEEYENILSQAHA
ATPF_RHOP2      ---EAETWVAIAFVILMGIFAYLGVHRTVLKALDNRRDRIKAELDEARKLKDEAAKLLADYXXXXXXXXX
ATPF_CLOD6      --------------------------------------DIKSDLAEGEKAKNEGLALKKEYESKINFAKD
ATPF2_BART1     -----TFWXXXXXXXXXXXXXYFQIPQKIIHHLDARAKRIKXXXXXXXXXXXXXXXXXXXYQRKHAEAEK
ATPF_LACPL      -------FIGISFIVLM-ALISVVAWKPITKMMADRADKIANDIDSAQKSRQEASDLADQRRDALSHSRA
ATPF_STAES      ----------------------------LKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLDEVQK
ATPF_STAEQ      ----------------------------LKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLDEVQK
ATPF_SILPO      ------FVVTIAFLVFIAVLFYFKVPSMIGGALDKRAEGIQSDLDEARKLREEAQSLLASFERK------
ATPF_MYCCT      ------------------------------QMIEKQRQKITEVLSDAIEKQTQANIKIKQANSLLEEAKT
ATPF_PROMO      ------FWQIINFLILM--FFFKKYFQKIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVKSAKT
ATPF_SPHAL      --LDATVWVSIAMLVFLGILVWKGVPGAIAAMLDKRIAEISKQLGEAEQLRLDAE---------------
ATPF_CHLPD      ------FWTTVSFVIVL--LILRKLAWPIISALEEREKGIQSSIDRAHKAKDEAEEILRKNRELLAKADA
ATPF_CHLL2      ------FWTAVTFVIVLLILKQLAWGPIISALEERE-KGIQSSIDRAYSAKDEAEAILRKNRDMLAKADL
ATPF_STRP3      -----------NFILVTGSVIVLLLLIKIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLDASRS
ATPF_ERYLH      -------WVSVAMLVLIAIMLWKKVPSLVTGGLDNKIAEIKAQLDXXXXXXXXXXXXXDEYTAKIANAEK
ATPF_THELT      ---------------------------------------IQSDLASAEKELKEAQEMKKQAHDALESARK
ATPF_STAHJ      ----------------------------LKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTLDEVQR
ATPF_LEPBP      ---------------------------KILHALEERASGIQGDINKAESLRVEAEKSLKEYKDQLFKATE
ATPF_LEPBA      ---------------------------KILHALEERASGIQGDINKAESLRVEAEKSLKEYKDQLFKATE
ATPF_LACF3      ---DMLFYL-VSFLI-MAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAKRQEELKGSRQ
ATPF_BACME      -------------------LILLALLQKVMGIMKKREEHIAGEIDEAEKQNEEAKKLVEEQREILKQSRQ
ATPF_SALRD      ------FWKTVAFLIFL-YILYRFGWGPITXXXXXXXXXXXHSIQRAEEALEEAKXXXXXXXXXXXXXXX
ATPF_BACFR      ------FWMLLSFGIVFAVLAKYGFP-----VIIKMVEGRKTYIDESLEVAREANAQLSRLKEEGEAIVA
ATPF_BACFN      ------FWMLLSFGIVFAVLAKYGFP-----VIIKMVEGRKTYIDESLEVAREANAQLSRLKEEGEAIVA
ATPF1_ACICJ     -----TFWVTVAVLIFL-AFFGRKIVGAITTMLDQRSAAIQHELDEASRLRAEAEAMLKDAESRREAALA
ATPF_CLOPH      LVVDVAIMGLAIFVLFLILSYLLFNPAR--ELLQKRQDRIKEEMDSSAKDKKEATQLKTNYEAKIKEASK
ATPF_BAUCH      ---------AIAFTLFVLCCMKYVWPPLIS-IIEKRQQEIADNIKFIETTKKDLEKAKEEATKHLINIKL
ATPF_STRGC      --------VAGSFLLLI-VLIKKFAWGNITSIFEERAKKISDDIDSAESARKNAEVLEQKREEALAGSRE
ATPF_RHIEC      ---DATFFAFVGLILFLALVVYLKVPGMMARSLDDRADQIRNXXXXXXXXXXXXQHLLAEYQRKRKXXXX
ATPF_NITWN      MLAEPETWVAIAFLLLMGVFAYVGVHRTVLSALDRRSARIKNELDDARRLKDEAAKLLADYKARHASAER
ATPF_LACC3      ---------------------------------------ISGDLDYAEKSRKDADALVAKRQEELQHSQA
ATPF_STRTD      ---------------------------------------IATDIDSAENARQEAEILVQKRQEELAAART
ATPF_STRT2      ---------------------------------------IATDIDSAENARQEAEILVQKRQEELAAART
ATPF_STRT1      ---------------------------------------IATDIDSAENARQEAEILVQKRQEELAAART
ATPF_RHOPT      ---EAETWVAIAFVILLGVFAYLGVHRTVLQALDKRRDRIKAELDEARKLKDEAAKLL------------
ATPF_RHOPA      ---EAETWVAIAFVILLGVFAYLGVHRTVLQALDKRRDRIKAELDEARKLKDEAAKLL------------
ATPF_PEDPA      ---------AILFIVLM-ALIAKFAWGPVNAMLKERADRISNDIDSAEQSRIEAEKLAKQRKEALDNSHA
ATPF_ELUMP      ------FWTIVNFLLLVGKFAWKPIIGALEARENKISQDKKDAQDEAQKIKAELDVRLSNISKE---AQE
ATPF_BRASB      LLADPETWVAIAFVILMGLFAYLGVHRTVLKALDHRAERIRNELEEAKRLKQEAKVLAD-----------
ATPF_RICBR      --LDESFWLAISFIIFV-YLIYRPAKKAILKSLDMKVLEVQERVXXXXXXXXXXXXXFEQTEEQIKNLEA
ATPF1_PARL1     MFATAEFWILACLVAFFAILGYFKVHRTLAATLDKRAADIXXXXXXXXXXXXXXXXXXXSYQRKQREAMK
ATPF_BACSK      ----------------------LGVMQKRQDMINE-------QIDSAEQNRKEAEKLLAEQREEMQKARV
ATPF_STRR6      -----------NFILITGSFILLLVLIKITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRK
ATPF_STRPS      -----------NFILITGSFILLLVLIKITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRK
ATPF_STRPN      -----------NFILITGSFILLLVLIKITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRK
ATPF_STRPI      -----------NFILITGSFILLLVLIKITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRK
ATPF_STRP4      -----------NFILITGSFILLLVLIKITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRK
ATPF_STRP2      -----------NFILITGSFILLLVLIKITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRK
ATPF_OENOB      ----------------------------ITKIMDARANQINDDLDSAAKSKNEAKKLQTVADTNLKESQS
ATPF_BACPF      ---------------------------------------INEQISSAEKNRKDSEAFIAEQRQALEQARM
ATPF_GRAFK      ------FWQTIVFLILLFLMAKFAWKPILGSVRNRE-QSINDALASAEKARKEMQNLQSDNEQLLKEARA
ATPF_FERNB      ---------------------------------------IEGEIVEAEKLRKQAEEIKKNAEEELKNARI
ATPF2_OCHA4     --MDATFWXXXXXXXXXXXXXYLKVPGMVGRSLDERADRIKNXXXXXXXXXXXXXXLLAEYHRKRKEAEK
ATPF2_BARHE     -------------------------------------------------------------QRKHAEAEK
ATPF_SULSY      ------FWKAVNTVILLG-LVYYFGGKHIKKFLNGRRENVANMVLEAQKMREDSQKALEDAKRKLEEAKY
ATPF_PSEAE      ------------FVLFCMKFVWPPVIAALQERQKK----IADGLDAANRAARDLELAHEKAGQQLREAKA
ATPF_PSEAB      ------------FVLFCMKFVWPPVIAALQERQKK----IADGLDAANRAARDLELAHEKAGQQLREAKA
ATPF_PSEA7      ------------FVLFCMKFVWPPVIAALQERQKK----IADGLDAANRAARDLELAHEKAGQQLREAKA
ATPF_MYCMO      ----------VSFTILLVVLTKL-IYKPVKKMMKNRRDFIQNNIDESTKQVEKSNELLEKSNIEILDAKI
ATPF_LACBA      ---DSIFY-AVCFLLLMWIIKVLAW-KPVTKMMQDRADKISNDIDSAEKSRNDAAELVQKRQAALASSRS
ATPF_CLOPS      ------------------------------EAIDETILKADEDAEKARRLR------LDN-ERILKSAKE
ATPF_CAUCR      ------FWVLAALVIFFGLLVVLKVPGALFGALDGYAAKIKAELDEAQQLREEAQALL------------
ATPF_RICPR      --LDESFWLTISFVIFV-YLIYRPAKKAILNALDTKISEIQXXXXXXXXXXXXXXXXXXQTKLQIQKLET
ATPF_NITHX      MFAEPETWVAIAFVILMGVFAYVGVHRTVLTTLDRRSARIKGELDDARRLKDEAAKLLADYRARHASAER
ATPF_LACCB      ---------------------------------------ISGDLDYAEKSRKDADALAAKRQEELQHSQA
ATPF_CLOBB      ------FMTIINFCILVAILKHFKIKGIINERQDFVDEQLLKVDEDSEKARM---YLLEN-QRILQTAKE
ATPF_CLOBA      ------FMTIINFCILVAILKHFKIKGIINERQDFVDEQLLKVDEDSEKARM---YLLEN-QRILQTAKE
ATPF_FRAP2      ----------ITFAIFVGFTMKFVWPP------------LRKALDERREKIAEGLASADRASRELEVAKR
ATPF_CAMC1      ----------LNFLLFFAILVYFAA-KPLKALYQSRIDRIANKLESIQEKLRESKAKKDDVLKRVEEAKQ
RRF_CHLFF       -----------------GAIIRIKIPEPTAEYRNEVIKQLRRK-------SEEAKVTIRNVRREANDKLK
PLPA_MYCGA      ----------------------------INDIKSKNNQPSQEEVDSRSKLEQRLEELLDQTKEIIDETSE
MYSS_CYPCA      ----------------------LRVQLELNQVKSEIDRKLAEKDEEMEQIKRNSQRVIDSMQSTLDSEVR
ATPF_RHOPS      ---EAETWVAVAFVILMALFAYLGVHRTVLQALDNRRARIKAELDEARKLKDEAAKLL------------
ATPF_METRJ      MLLEAEFWVAVAFFIFMGIAWKVGAFSAMTKGLDGRANRVRHELDEAKRLREEAAAVL------------
ATPF_MESVI      -------------------------------LLQNRQQNILQSINDADERYKEAAEKLQQAQNEFEQAKL
ATPF_FLAPJ      ----------LQIILFVGLILLLK------KFAWKPILDAVNEREDGIK---NALLSAENARTEMQNLQA
ATPF_ALKOO      ---DATFFFQLANTLIMFLILKHFLFQPVTEFMDKRTKAIEESIAEAELKNKESNELKAQYESKLTEIKK
ATPF_ENTHR      --------VSGSFLILMFLLKHFAWGP-ISDILKKREDKIANDLDSAEKSRINSAKMEQEREQQLLASRS
ATPF_AZOC5      ----AELWVAVAFFVFVGILLYNGVHKALAKALDARGARIAAELDEARRLKEEAQKLV------------
ATPF_LEUMM      ----------------------------LTKVLDERADKISSDIDGAEVARQEAEKLASQRQAELQNATK
ATPF_ANADE      -----TLWTAITFLVMLAVLAKFAWGP-IVKMLAERERSIREAIDSXXXXXXXXXXXXXXQKESLSKAQR
ATPF_BACWK      ---------------------------------------VTNEIDAAERSNAEAKKLVEEQREMLKQSRV
ATPF_ACIAD      ---------AIAFAIFVAFCMKFVWPPLINAISERQ-RKIADGLNXXXXXXXXXXXXXXXXXXELDAAKA
ATPF2_PSEA6     MNINATFGELLAFIFFVWKFVWPPIMGAIEERQKK----IADGLAASERGEKDLELAQAKATEQLKEAKT
RRF_CHLAB       -----------------GSIVRIKIPEPTAEYRNEVIKQLRRK-------SEEAKVAIRNIRRESNDKLK
ATPF_SHEHH      MSINATLLQAISFLLFVWFCMKFVWPPLMNAIEERQ-KKIADGLADAGRAAKDLELAQVKATEQLKDAKA
ATPF_LEGPL      --------VFAAFVLFTMKLVWPPLAKALEERQDK----IADGLAAAERGRKELELAQHRVKDELKQAKA
ATPF_LEGPH      --------VFAAFVLFTMKLVWPPLAKALEERQDK----IADGLAAAERGRKELELAQHRVKDELKQAKA
ATPF_LEGPC      --------VFAAFVLFTMKLVWPPLAKALEERQDK----IADGLAAAERGRKELELAQHRVKDELKQAKA
ATPF_LEGPA      --------VFAAFVLFTMKLVWPPLAKALEERQDK----IADGLAAAERGRKELELAQHRVKDELKQAKA
ATPF_BRASO      LLADPETWVAIAFVILMGLFAYLGVHRMVLKALDHRADRIRDELAEAKRLKDEAKVLAD-----------
ATPF_ARCB4      ----------VNFIIFAAILWYL-LADKIKAFFANRTLSIQAELDKVQETLKASQDKVTDAQKKLEEARK
ATPF_NATTJ      -----TFVLTIVNILVLFYLLKRFLFKPIGEFMENRKNEIKQNLEDAEKERQEAEKLKEQYYEKLRGAKS
ATPF_BACHD      ---------------------------------------INDQIDQADKDRKAAQEYLEQQRLAVEKARE
RRF_CHLCV       -----------------GTIVRIKVPEPTAEYRNEVIKQLRRK-------SEEAKVAIRNIRRESNDKLK
LZTL1_HUMAN     ---------------------YLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLGTAEL
ATPF_SHEPA      MSINATLLQAISFLLFVWFCMKFVWPPLMNAIEERQ-KKIADGLADAGRAAKDLELAQVKATEQLKDAKA
ATPF_MYCGE      ---------------------------------------LEAQIKQANELEKQARNLLEESNQRHEKALI
ATPF_MAGSA      ------FWVDVAFILVV-ALAFKPVXXXXXXXXXXXXXXXXSRLDEAHKLREEAQEMLATYQRKQRDAMX
ATPF_CLOAB      --------VTIGFTIVNFIILMLILKHFFFDKVNKVIDDRNNEIKKADAQNEEARLLKVESEKNLEDSKL
ATPF2_VIBHB     ------FGQAISFVIFVWLCMKYVWPPLV-KLLDERRAEIAQGXXXXXXXXXXXXXXXXNGEALLTEARS
LZTL1_PONAB     ---------------------YLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLGTAEL
LZTL1_MACFA     ---------------------YLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDITKPKLGTAEL
TEKT2_MACFA     ------------------------------EMLDKCLTDLDAEIDALTQMKDSAGQNLQAKNLPLDVA--
ATPF_VIBFM      ---------AIAFTLFVWFCMKYVWPP-IMEAIEERQKKIADGLSAAERAAKDLDLAQANASDQLKEAKR
ATPF_VIBF1      ---------AIAFTLFVWFCMKYVWPP-IMEAIEERQKKIADGLSAAERAAKDLDLAQANASDQLKEAKR
ATPF_UNCTG      --------------------------------LKKILDERKRKIEQSLQDAENAKIALENASEK------
ATPF_BACA2      ---------------------------------------------EAQKLIEEQRVLLKEAKQE------
ATPF_ANEMR      --------IVISLLIYFGKGV-------LSNLLRNRKLAISNTIRDAEERYKEATQKLEQAKIRLEQAEM
ATPF1_XANP2     ----AELWVAVAFLLFVGILIYVGAHRAIGSALDSRGQRIXXXXXXXXXXXXXXQKLVAEFKRKQRXXXX
Y8CB_CAEEL      -----------------------------NEILKTRIASLEKDVKQEKNATKMAKSLNEETINEL----T
TFB3_CANGA      ----------------VGVEKEVDIRKRVFNVFNKTLEDFDNDLEAYNKYLEEVEDIVYKLDNKIDVVET
CIP2A_HUMAN     -----------------------------HEILTKSYMELLQRNESTEKKNKDLQITCDSLNKQIETVKK
ATPF_STRSV      -------------------------------ILDQRAQKISDDIDGAEAARKKAEDLAQKREDALAGSRV
ATPF_PARDP      ------FIVTLAFLLFVGILVYFRVPQIVGGLLDKRAEGIRND---------------------------
ATPF_NOSP7      ----------INLAILVGILFYFG-RKVLSNILNERQSNIATAIQEAEGRLKEAKTALSQAQEQLKQSQA
ATPF_ENTFA      -----------TMIVVSGAFLILMLLLKIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQLLSSRS
ATPF_DESDG      ---------------------------------------IEQELNDLETRKTDAKKQLGDVEKRIADLEN
ATPF1_SYNP2     ----------INLAIIIGVL-YVYGSKFIGNILETRKSKIVADLEDAENRAKKAQEALTKAQKDLEQAQA
SYS_GEOSW       --------------------------EEVKEKLLKRGEDLTN-IDRFEELDKKRRELIAKAEELKNKRNE
ATPF_LEUCK      -------FIIISFLVLM--VILKKVAYPLTKVLDERAEKISTDIDGAESARQEAENLAAQRQSELDTRQQ
ATPF_SHEON      ----------VAFIIFVWFCMKFVWPPLMNEARQKRIADGLADADRAVKDLELAQA---KATDQLKEAKV
ATPF_ANASK      -----TLWTAITFLVMLVVLGKFAWGP-IVKMLAERERSIREAIDSXXXXXXXXXXXXXXQKESLAKAQR
ATPF1_BEII9     MEFNEEFYVALGFVIFVAILLYYGVHNKLNAALDKRADRIREDXXXXXXXXXXXXXXXXSFEKRKXXXXX
HOOK_CAEEL      -----------------------------------IVFELTNENDRSDKERQRLQTVLDAAQSDLDEWKT
ATPF_UREPA      -------WVFIAQVIVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENAKSEHLAAQA
ATPF_UREP2      -------WVFIAQVIVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENAKSEHLAAQA
ATPF_PETMO      ----------VGFLAFM-FLMYRLLYKPYFDMTDKRKKEVEKNLNEAEKLRLEAQLKKEELDKQLSEADE
ATPF_MYCGA      ---------------------------------------IQAEINNANEIKKQAQFLLDNAKKQKQNAEL
VATE_FINM2      ----------------------------------------------------------------MSNLDN
MIT1_SCHPO      -------------------------------------------IARAHRYGQKKKVLVF----VLTTRDS
ATPF_STRSY      ILVTASFAVLI---ILIRVFAWDKITGIFEERANK----IANDIDAAEEKLTAAANLVQQREDELVQGRI
ATPF_STRS2      ILVTASFAVLI---ILIRVFAWDKITGIFEERANK----IANDIDAAEEKLTAAANLVQQREDELVQGRI
ATPF_RHOP5      ----AETWVAVGFAILMVVFVYFGVHRTVLNALDNRRDRIKAELDEASRLKEEAAKLL------------
ATPF_LACLS      ---------------------------------------ISDDIDAAEANNKQAADLVKQRQAELAGSKE
ATPF_LACLM      ---------------------------------------ISDDIDAAEANNKQAADLVKQRQAELAGSKE
ATPF_LACLA      ---------------------------------------ISDDIDAAEANNKQAADLVKQRQAELAGSKE
ATPF1_METCA     MNINATLFVTFALLVFTMKYVWPPLLQALEERKKK----IAEGLAAAEKGKHEMELAEKRATAALKEAKD
CIN8_ASHGO      --------------------VYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNS--MKDTVNEIIDNERS
ATPF_PSYCK      -----------------------------------------------------------DVQQELDLAKT
ATPF_CAMHC      -------WRTINFAIFFGILFYL-IKGPIKNAYNARINRISSRLEAIQTXXXXXXXXXXXXXXXXXDVKQ
ATPF_ANGEV      --------------VVLGVLIYLGAGCILNDLLENRKQTILSTIHDAEERYEEATEKLNQARTRLQQAKV
SLK19_YEAST     ----------------------------LNQMLNSLISKNESLSFQYEKLNKNHQLLIDLTNEKLDKLNT
ATPX_CYAPA      ---------------------------------------IQSNFNEAEKCLAQAAELTTQYETKITDARQ
ATPF_ERWT9      -------------------------------------------IEKRQKEVADGLASAERAKKDLDLAQA
TEKT2_HUMAN     ------------------------------EMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVA--
SHOT1_PONAB     --------------------------QKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKENKTLKR
SHOT1_HUMAN     --------------------------QKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKENKTLKR
LON_BUCAI       ---------------------------KLNKKIPLEILNVLNNIKNSEKL---ADTIAAHMPLKLNDKQS
ATPF_SHEB5      ---------------------------------------LMNAIEERQKRIADGLADADRAVKDLELAQA
ATPF_GUITH      ----------LNIAILLSGVIYLG-RNFLTSALESRQQKVTEAIQEAEERLQQANVKLLDAEKQLTQAQT
ATPF_GEOKA      ---------------------------------------IANEIDQAEKRRQEAEKLLEEQRELMKQSRQ
ATPF_ACIBY      ---------------------------------------------------------------ELDAAKA
ATPF_ACIBT      ---------------------------------------------------------------ELDAAKA
ATPF_ACIBC      ---------------------------------------------------------------ELDAAKA
ATPF_ACIB5      ---------------------------------------------------------------ELDAAKA
ATPF_ACIB3      ---------------------------------------------------------------ELDAAKA
ATPF2_BARQU     -------------------------------------------------------------QRKHAEAEK
PF08_PLAF7      -----------------------KLNEKINSLEEKLIEMHENSNKTFEKLNEKLNDIRNDVTNYKNELEE
ATPF_SHEB9      ---------------------------------------LMNAIEERQKRIADGLADADRAVKDLELAQA
ATPF_SHEB8      ---------------------------------------LMNAIEERQKRIADGLADADRAVKDLELAQA
ATPF_RHOS5      ---NTNFIVTLAFLIFMGILVYAKVPGRILGMLDRRAVQIRS----------------------------
ATPF_MANSM      -------------------------------------------------VEQEILAAKEEAQKIIDLANK
ATPF_LISMF      ---------------------------------------IGSEIDAAEESRAQAEQLL--AEQK------
ATPF_KLEP7      -------------------------------------------IEKRQKEISDGLASAERAKKDLDLAQA
ATPF_KLEP3      -------------------------------------------IEKRQKEISDGLASAERAKKDLDLAQA
ATPF_DEHE1      ---------------------------------------IKESMERTDQVKEQAQRAEEEFKKKIGEASQ
ATPF_BACP2      ---------------------------------------------QAEKLLEEQRVLLKEAREE------
ATPF_BACCN      ---------------------------------------VASEIDAAEKNHAEAKKLVEEQREMLKQSRV
ATPF1_GLUOX     MFHDPRFWTALAFVLFF-VIFGRKLWVAITGHLDARADSVRHDLDEAARLRREAEQMLEDANRE------
SYCP1_HUMAN     ------------------------------ENLQETETQLRNEL---EYVREELKQKRDEVKCKLDKSEE
RRF_CHLMU       -----------------GATVRINVPEPTEEYRREVIKQLKRK-------SEEAKVSIRNIRRTCNDRLK
CC150_HUMAN     ---------------------------------------------------QEQNLLLDAAHASINELQT
BRE1_DEBHA      ---------------------------KLNKVLNERINALESERHETGDNSKISELSKDELIQRINMLNS
ATPF_TROWT      ---------AIVLAIVLPFFWWFVIP-RISKLLSDRSSLIEGKISEAASAHARALETLELRKQQLDEAKS
ATPF_TROW8      ---------AIVLAIVLPFFWWFVIP-RISKLLSDRSSLIEGKISEAASAHARALETLELRKQQLDEAKS
ATPF_RICTY      --LDESFLLAVSFVIFI-YLIYRPAKKAILNSLDTKIIEIQXXXXXXXXXXXXXXXXXXQTKVQIQKLEA
ATPF_LISW6      ---------------------------------------IGSEIDAAEESRAQAEQLL--AEQK------
ATPF_ENT38      -------------------------------------------IEKRQKEIADGLASAERAKKDLDLAQA
ATPF_BACC7      ---------------------------------------VTNEIDAAERSNAEAKKLVEEQREMLKQSRV
ATPF_BACC2      ---------------------------------------VTNEIDAAERSNAEAKKLVEEQREMLKQSRV
ATPF_BACC1      ---------------------------------------VTNEIDAAERSNAEAKKLVEEQREMLKQSRV
YR555_MIMIV     ----------------------IKQRSKIQEQIRKILLNILNK-----KENQIIESKINKAQTELDALAE
CN145_MOUSE     --------------------------KELNDVLSKRALQEEELHCKEKKLNDQAELELE-VKNSLDTIHR
CENPE_HUMAN     ------------------------VSEKTAQIINTQDLEKSHKLQEEIPVLHEEQELLPNVKEVSETQET
CCD46_MOUSE     ---------------------------------------------EKDSLVRDHDREIENLEKQLRAANM
ATPF_XANOR      ----------ITLTIFAQALAFAGL---IWIVATKIWPPLLQAIEERQQKIAEGLAAADRSQKDLAQAQE
ATPF_XANOP      ----------ITLTIFAQALAFAGL---IWIVATKIWPPLLQAIEERQQKIAEGLAAADRSQKDLAQAQE
ATPF_XANOM      ----------ITLTIFAQALAFAGL---IWIVATKIWPPLLQAIEERQQKIAEGLAAADRSQKDLAQAQE
ATPF_CYTH3      ------FWQTVIFLVTL-------------YLLSKFAWGIMSAMKEREDSITDALSAADKARADIEKLQA
ATPF_CAUSK      -IANPELWVGVGLILFIAIVIWAKAPAMIAGKLDETAAKIQTDLDXXXXXXXXXXXXXXXXXXXXXXXXX
ATPF_BACHK      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV
ATPF_BACCZ      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV
ATPF_BACCR      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV
ATPF_BACC4      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV
ATPF_BACC0      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV
ATPF_BACAN      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV
ATPF_BACAH      ---------------------------------------VANEIDAAERNNAEAKKLVEEQREMLKQSRV


                         .         .         *         .         .         .         .:140
query           VSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEIKDVSIKIAVDSVKKIINTSV
ATPF_RHORU      EADEIIRHAKDEAARLRAKAEADLEASIRRREQQAVDRIAQAEAQALAQVRNEAVDVAVSAARSLMAGSL
ATPF_RHORT      EADEIIRHAKDEAARLRAKAEADLEASIRRREQQAVDRIAQAEAQALAQVRNEAVDVAVSAARSLMAGSL
ATPF_CHLPB      DADKIIREGKEYGDKLKAEITEKAHLEASRMISSAKDEIDQEKRRALTELRTEVADLAVKGAEKIIMANL
ATPF2_RHILO     XXXXXXXXXKREAEMLATEAHKKTEDYVIRRTALAEQKIGQAERDAVAEVR-------------------
ATPF1_BARHE     QAHVIAQTASEEIKQKVELERKEIEANLEKKLTDAEKQIAKIRDKAMKSVGSIAEEVALEIVKKLIDVEV
ATPF_MESFL      ESSLIIQTSKVDADIQKTHIISEAHKYADIIKNQAEKDIAQERSKIEAEIKTTIVNVAFDAAEQILQTEI
ATPF_LACS1      EASQIIDRAKKNGEQQKANIVSSAHEEVQTMKANAKKDIQQERQEALDSVKELSIEIASKIIRKELTADD
ATPF_SINMW      XXXXXXXXXXXXXXMLTAEAKQKTEEFVARRTALSEQKIKQAESDAINAVRAAAVDLAISAAEKVIASKA
ATPF_RICFE      LRSQMIEESNEVXXXXXXXXXXXXXXFLEHKKSDAIQLIQNQKSTATKELQDE----FCDEVIKLVSEYF
ATPF_PROVI      ESDRIIREGREFADKIRAEITEKAHTESQKMIGAAKDEIEQEKRRALDVLRNEVADLAVRGAEKIIRAS-
ATPF_MYCMS      ESVSILKTARIDAEIQKNKIIDNANLQAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILNKEI
ATPF_RHOCA      QADEIVAAAKRDA---------------------------------------------------------
ATPF_CHLTE      XXXXIIREAKEVADKLRADLTEKAHDESRKIIASAKEEIEQEKRRALDVLRNEVADMAVKGAEKIIRTTL
ATPF_RHIME      XXXXXXXXXXXXXXMLTAEAKQKTEEYVARRTALSEQKIKQAESDAINAVRAAAVDLAISAAEKVLASKA
ATPF_BRAJA      EAADIIANAKVEAERIATEAKAKMEDFVARRTKTAESKIXXXXXXXXXXXXXXXXXXXXXXXSTILSQSV
ATPF_ILYTA      EANEILLRAEKKADDRKEAILKEANSQREKTIKSAELEVEKMKKQARKELQSEVTALAVNLAEKMINEKL
ATPF_RICCN      LRSQMIEDSNEVXXXXXXXXXXXXXXFLEHKKSDAIQLMQNQKSTASKELQDE----FCDEVIKLVSEYF
ATPF2_MESSB     XXXXLVDAAKREAKLIVSDAKVKTEEYVSRRTALAEQKIAQAERDAVNEVRSRXXXXXXXXXGKLLAEKI
ATPF_COXBU      QAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTELLKQISTIAVAGAQKILQREV
ATPF_COXBR      QAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTELLKQISTIAVAGAQKILQREV
ATPF_COXBN      QAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTELLKQISTIAVAGAQKILQREV
ATPF_COXB2      QAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTELLKQISTIAVAGAQKILQREV
ATPF_COXB1      QAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTELLKQISTIAVAGAQKILQREV
ATPF_CALS8      KANEIVQEAQKQADKIIEDA--KLEANKIIENALKQLDIEKKKQ--INELKNQFVSIALLAASKVIEKNL
ATPF_RHOP2      XXXXIVASAKADAERIAAESKAKLEDFVVRRTKTAESKIXXXXXXXXXXXXXXXXXXXXXXXXIVLSQSV
ATPF_CLOD6      EGQEIIKQATIRAEQKSDDIVNTAKKDALDIKEKANKDIEQERQKVINEIKNDISNIALLAASKVIEKDL
ATPF2_BART1     DAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAIDLAISTARVLIAKEL
ATPF_LACPL      EASEIVADAKKSGEKQRSSIVADAQNEATQYKQNARKDIEQERQDALKDVADISVAIATKIIKKQLDPEG
ATPF_STAES      ILDDAKIQARKQHEEIIHEANEKANGMIE----TAQSEINSQKERAISDINNQVSELSVLIASKVLRKEI
ATPF_STAEQ      ILDDAKIQARKQHEEIIHEANEKANGMIE----TAQSEINSQKERAISDINNQVSELSVLIASKVLRKEI
ATPF_SILPO      ----------------------------------------------------------------------
ATPF_MYCCT      ESVSIINTARVDAEIQKNKIIDNANLQAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILSKEI
ATPF_PROMO      EANEMLLRAEKKADERKETILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVTDLAVKLAEKMINEKV
ATPF_SPHAL      ----------------------------------------------------------------------
ATPF_CHLPD      ESDKIIREGKEYGEKLRAGIXXXXXXXXXXMISMAKEEIEQEKRRALDVLRNEVAELAVMGAEKIIKTSL
ATPF_CHLL2      ESERIIREGKEYGEKLRQEMAEKAQFEAKKMIASAKDEIEQEKRRALDVLRNEVADLAIMGAEKIIKSSL
ATPF_STRP3      QASKIISDAKEQGDKLVAEATDEAKRLKE--KALTD--IEQSKSDAISAVKTEMSDLTVLLAKKIMGANL
ATPF_ERYLH      DAEAMMENARHEADAILEKAEADSKALVERRKKMAEDKISAAERDAVDEVRXXXXXXXXXXSRKLI----
ATPF_THELT      SADGIISEARQKSEEIINQAKVKAREEAEKVLNSARNEIEREKKQALQEIEKRAGEIAVTLALKILQGVL
ATPF_STAHJ      ILEDARVQARKQHEEIIHEANIRANGMIE----TAQSEINSEKERALADINNQVSELSVLIASKVLKKEI
ATPF_LEPBP      EAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQIVEMSVLIASEILEKQL
ATPF_LEPBA      EAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQIVEMSVLIASEILEKQL
ATPF_LACF3      EAARIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQARQDALKDIANLSIEIASKLIHKQLNADD
ATPF_BACME      EVQVMMENARKSAEDKKEEIVAAAREESERLKAAAKQEIEQQKDQAVAALREQVASLSVLIASKVIEKEL
ATPF_SALRD      XXXXXLREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDEVADLAIEAAQKIIENDL
ATPF_BACFR      AANKIMKEAMQEREKIIYEARKQAEIAAQKELDEVKRQIQIEKDEAIRDIRRQVALLSVDIAEKVIRKNL
ATPF_BACFN      AANKIMKEAMQEREKIIYEARKQAEIAAQKELDEVKRQIQIEKDEAIRDIRRQVALLSVDIAEKVIRKNL
ATPF1_ACICJ     QAKDML----------------------------------------------------------------
ATPF_CLOPH      EVDEILSEGRKKALKRENDIVDEAKVEASRIVDRANKEIELNKSKMKDEVKQEMIAVASVMAGKIIAGNI
ATPF_BAUCH      KAQDIIEQANKNKLQLIIEAKNEADITRKKILAQAQKQIETERKIAYEELRLQVIQLVILSTEKILENSI
ATPF_STRGC      EAATIVETAKETAENKASILADTTEEVSRLKQK-ANQEIAQSKAEALRSIKGDVADLSIDLASKIIGQTL
ATPF_RHIEC      XXXXXXXXXXXXXXMLTAEAKKKTEEFVANRTALSEQKIKQAEADAMKAVRSAAVDLAIAAAETVLAKKA
ATPF_NITWN      EAQD------------------------------------------------------------------
ATPF_LACC3      DAVKIVNQAKENGEKLRQSLVDAANAEVTTMKKNAQTEIDQARKDALNDVADLSLTIAQKLIGKELNADD
ATPF_STRTD      EATQIIDEAKKTGKTKESKIIAEAYDEAKRLKEKANQDIAQSWVEALAGVKGEVADLTVLLAEKVMKQNL
ATPF_STRT2      EATQIIDEAKKTGKTKESKIIAEAYDEAKRLKEKANQDIAQSWVEALAGVKGEVADLTVLLAEKVMKQNL
ATPF_STRT1      EATQIIDEAKKTGKTKESKIIAEAYDEAKRLKEKANQDIAQSWVEALAGVKGEVADLTVLLAEKVMKQNL
ATPF_RHOPT      ----------------------------------------------------------------------
ATPF_RHOPA      ----------------------------------------------------------------------
ATPF_PEDPA      EATSIINNAKDSGAKERELIIGNAQNEAKSLKDKAKQDIEQERADALKSAQDDIASLSIEIASKVIKKEL
ATPF_ELUMP      KLAQVEALAKQQKDAMIKDAQ----ASSERMIATAKEEIEAQKNQALKEVKKEIADMAVEAAAKIAGVKT
ATPF_BRASB      ----------------------------------------------------------------------
ATPF_RICBR      LQLQMTKENNEITEKIVQEKTKEIEEFLEHKKVETIKLIESQKLLASKELQDE----FSDEVVKLVSEYF
ATPF1_PARL1     EAEDIVAQAKVEAEQLAKETRANMEIQVERRTKLAEDKIAQAETQALND---------------------
ATPF_BACSK      EARELIENAKKAGEQQGQEMVRAAKEEAQRIHQQALAEIQNEKDQAVAALREQVASLSVLIAQKVIEKEL
ATPF_STRR6      EAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNL
ATPF_STRPS      EAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNL
ATPF_STRPN      EAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNL
ATPF_STRPI      EAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNL
ATPF_STRP4      EAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNL
ATPF_STRP2      EAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNL
ATPF_OENOB      QATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDEIADLSVSIASRIIGKEI
ATPF_BACPF      EANEIIQNAKKLSEQQGQDIVKAARNDAERIKESAVAEIQREKEQAVSALREQVAGLSVLIATKVIEKEL
ATPF_GRAFK      ERDAILKEARELKEKVITDASDEXXXXXXXXXXXXXRSIELEKQSAMAELKNHVAELSVEIAEKIVRKEL
ATPF_FERNB      RAEQIIASANSESXXXXXXXXXXXXXXXXXXLQNAYLEIEKQKQEALAQVQTIATELAINLAMKVLKGTL
ATPF2_OCHA4     EAGDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINXXXXXXXXXXXXXXGKIVADKV
ATPF2_BARHE     DAQEIIAAAKREVEAVISEARIKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAIDLAVSAARVLIEKEL
ATPF_SULSY      KLEESIETAEREREHAIMQANE------------------------------------------------
ATPF_PSEAE      QAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTGAEKILGASI
ATPF_PSEAB      QAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTGAEKILGASI
ATPF_PSEA7      QAAEIVEQAKKRANQIVDEARDQARAEGERLKAQAQAEIEQELNSVKDALRAQVGTLAVTGAEKILGASI
ATPF_MYCMO      KANTIIKDAQILAEE--IKNNSIKDAKDKSKQLLEETKIRQQKVLFAKESKKEIVEIAGEMTKKILSES-
ATPF_LACBA      EAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQERQDALSNVADLSIEIASKIIQRELKADD
ATPF_CLOPS      DGRKLREEQKKEADRIYKEIVDDAHREAESIINRANIEIQREEEKVKYELKQQVVDISVMLSEKALGESI
ATPF_CAUCR      ----------------------------------------------------------------------
ATPF_RICPR      LRSQMIEESDKATKQIIQDKTKEMEEFLERKKADAIQLIQNQKSTASKDLQDEFCDEVITLVSKYFRSAS
ATPF_NITHX      EAQD------------------------------------------------------------------
ATPF_LACCB      DAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALNDVADLSLTIAQKLIGKELNADD
ATPF_CLOBB      EGKKITESQKEKANKVYDEIVEDANEEAKSLLERAKTDIQREKEKAEYEIKKQAVDLAIELSIKALEENI
ATPF_CLOBA      EGKKITESQKEKANKVYDEIVEDANEEAKSLLERAKTDIQREKEKAEYEIKKQAVDLAIELSIKALEENI
ATPF_FRAP2      QSAEILREAKAKATEIVENAYVRAHKXXXXXXSMAMAEIEQEKVKAKEELKHEVVSLAMAAASKIISANV
ATPF_CAMC1      NANALIETAKKEAVNL----------AAKVKKE-AQNDIANI-EKGYKEQKEFEERKMTKGVVNEILSDI
RRF_CHLFF       KDSDLTEDAVKGMEKKIQELTDKFCKQID--------EMSKQKEADLSSI--------------------
PLPA_MYCGA      SSRESFQQSK---DQLIENFEKKIELLTE-KLNQTQESFNQSQEAKQQQDKEFAQKIANDSLQRVKESSL
MYSS_CYPCA      SRNDALRVKKKDLNEMEIQLSHANRQAAEAQKQL-RNVQGQLKDAQLH--LDEAVRGQEDMKEQVAMV--
ATPF_RHOPS      ----------------------------------------------------------------------
ATPF_METRJ      ----------------------------------------------------------------------
ATPF_MESVI      EADQILAQSKKTASEIEVGLMNLIKEDTKKLLDMKQATISFEEEKAISEIRRQVIRLALQRA-----LEQ
ATPF_FLAPJ      DNQRILQEARLERDNMLREIKEKMIADSKTEAQAAKAAIESEKNAAMAELKSQVSNLSIEIAEKLLKDEL
ATPF_ALKOO      ERTQIIDEAQKRGDEIVSAAGVEARRT--IEKATAE--IEREKQKMMNELKGEISQLAIAAAQKVIEKDL
ATPF_ENTHR      DAADIIKNAKESGELSRQNILKETQEEVARLKSKAQTDIMLERDTALNSVKDDVADLSLQIAAKILNKEL
ATPF_AZOC5      ----------------------------------------------------------------------
ATPF_LEUMM      VVNDAKASAQKQSDLIVSAANDRAASVSQQAQTDAQKLKEDAISGAKNDVAALSVAIASKLMQKELSLND
ATPF_ANADE      EAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELVKAKAELKAQVVDLAIDAASRLVKANL
ATPF_BACWK      EAQELIERAKKQAVDQKDVIVAAAKEEAESIKTSAVQEIQREKEQAIAALQEQVASLSVHIASKVIEKEL
ATPF_ACIAD      QAAQLIEQANRRAAQLIEEARTQATAEGERIRQQSKETVDQEINAAREELRQQVAALAVDGAEKILNQQV
ATPF2_PSEA6     QAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDLRKQVAALAVAGAERILERQI
RRF_CHLAB       KDSDLTEDAVKGMEKKIQELTDKFCKQID--------KMSKQKEVDLSSI--------------------
ATPF_SHEHH      TANEIIEQANKRKAQIVDEA--KVEADTERAKIIAENERNRVKEDLRKQV----AALAIAGAEKILERSI
ATPF_LEGPL      HSADIIDKANXXXXXXXXXXXXXXXXXXXXXXXLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREV
ATPF_LEGPH      HSADIIDKANXXXXXXXXXXXXXXXXXXXXXXXLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREV
ATPF_LEGPC      HSADIIDKANXXXXXXXXXXXXXXXXXXXXXXXLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREV
ATPF_LEGPA      HSADIIDKANXXXXXXXXXXXXXXXXXXXXXXXLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREV
ATPF_BRASO      ----------------------------------------------------------------------
ATPF_ARCB4      LAAEIIESAKTDID--------------------------------------------------------
ATPF_NATTJ      XXXXXXXXXXXXXXXXXXXXXXXXXXXXDDMIARAREEINQEQKKAIESLRSEVSDLTIQITERVLNDTI
ATPF_BACHD      EAQEIVQKAKKLSEQQGQEIVEAARAEGERLKEAALAEIQREKEQAVASLREQVASLSVLIATKVI----
RRF_CHLCV       KDSDLTEDAVKGMEKKVQELTDKFCKQID--------EITKQKEAELSSI--------------------
LZTL1_HUMAN     LNKEILEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSLENTVAALKEFQKTLN
ATPF_SHEPA      TANEIIEQANKRKAQIVDEA--KVEADTERAKIIAENERNRVKEDLRKQV----AILAIAGAEKILERSI
ATPF_MYCGE      VSKEIVDQANYEALQLKSEIEKTANRQANLMIFQARQEIEKLKEQSIKESVELAMLAAQELILKKIDQKS
ATPF_MAGSA      XXXXXXXXXXXXXXRLAKQAAKDLEVSMKRREQMAMDRIXXXXXXXXXXXXNLAVDVAIGAAQKVIGESL
ATPF_CLOAB      QGKTIVENYKVKAEKVSEEITAEAKTEAQNILERAKRETQREKEKAEDEIKNQVVELAVLISSKALENSI
ATPF2_VIBHB     KAQAIINQGKQRQEQMVAEAVDLANQ--EKARIVAEGKVESERSKVRQELKDEMADLVIESASKLINRNL
LZTL1_PONAB     LNKEILEKLKSRLKTVEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSLENTVAALKEFQKTLN
LZTL1_MACFA     LNKEILEKLKSRLKTIEIQATSALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSLENTVAALKEFQKTLN
TEKT2_MACFA     IECLTLRESRRDIDVVKDPVEDELHKEVEVTKKALQQKVSQAFE-HLCLLQEVRQQLNSDHRGKMETLEI
ATPF_VIBFM      AATEIIEQANKRKSQILDEAREEALVERQKILTQGEAELESERNRARDELRKQVATLAVIGAEKILERSI
ATPF_VIBF1      AATEIIEQANKRKSQILDEAREEALVERQKILTQGEAELESERNRARDELRKQVATLAVIGAEKILERSI
ATPF_UNCTG      -KKNILAKAKSSADTLMVSIKETKEKAVIEAKQRSEQIIDEAKQKAATEFESMNKKIGKISVD--ISGKV
ATPF_BACA2      -SQSLIENAKKLGEKQKEDIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVLIASKVIEKEL
ATPF_ANEMR      KARNILSQMEKEKKDLIDGTNGDLRRLEDSKNATIRSEKQRAIEQVQQQVSRSALERTLETLKNCLDNEL
ATPF1_XANP2     XXXSIVTAAKAEAERLASEAKAKLEDFVTRRTKMAEDKIAQ-----------------------------
Y8CB_CAEEL      LSEDLIESLKKQFQASKIELKEEILSKNKVEKDYSNDKFLEREQYLLITMESMSGKLEHEQQTEIMNKDV
TFB3_CANGA      EEKNNMERSKKDLEN--FEQRQQFEKEMRMKKRMLERQIKMNKEWAKREIVNASSTNADDVIEGVKNT--
CIP2A_HUMAN     LNESLKEQNEKS----IAQLIEKEEQRKEVQNQLVEHKLANLHQ---------KTKVQEEKIKTLQKERE
ATPF_STRSV      EAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVADLTVTLASKILSQEL
ATPF_PARDP      ----------------------------------------------------------------------
ATPF_NOSP7      EAERIRQSAVENXXXXXXXXXXXXVQDVERLKQTAAADLNTETERAIAQLRQRVATLALQKVESQLKGGI
ATPF_ENTFA      EAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVADLSLQIAAKILNKEL
ATPF_DESDG      ERKAIIAEYQAQGEALKAAIISKAETSAEQAKKSAENEVKYAKDAMREELAD----MIVDATEKLLKERL
ATPF1_SYNP2     QAAKIREDAKVAAEKTKQDILAKGRDEVEKLKASAVKELSTEQAKVITELKRRVAELALAKVEAQLRSDL
SYS_GEOSW       VSQQILKREKKDADHLIAEMRD------------------------------------------------
ATPF_LEUCK      ATKDAKASAQKQSDALVAVAAERANTINQQAQTDAEKLKEDAIANAKNDVAALSVAIASKLMQKELSLND
ATPF_SHEON      TANEIIEQANKRKAQIVEEA--KTEADAERAKIIAQGKIEAERNRVKEDLRKQVATLAIMGAEKILERSI
ATPF_ANASK      EAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELGKAKTELKAQVVDLAIDAASRLVKANL
ATPF1_BEII9     XXXXLVAQARTEAEMIAKEAHERLAEFVQRRTQQAENKIA------------------------------
HOOK_CAEEL      VANQYQKEAE------LSKQQDK-----EIKELLSQNK-------ALKSRLDHHVKSA------------
ATPF_UREPA      QTLEIIAKAKSES---------------------------------------------------------
ATPF_UREP2      QTLEIIAKAKSES---------------------------------------------------------
ATPF_PETMO      KRREILSEADEQAKSIIKAAQGEAQEQRKFILDXXXXXXXXXXXXXXXXLQSRIVSLAVTISSMILKEQI
ATPF_MYCGA      QAREIINLATNQAYRLKNDLTDAKRKANRIIEN-AHAEIIKQESILKRELEGRIVDVALEATSTLIQKNV
VATE_FINM2      IINEILEDAKKESEHILNDANQE-------KEKIIETKIDQANQE-----KDTILKKAESEAKGVLSQVV
MIT1_SCHPO      VEEKIIQNAQKKLDHLIVESLDQNHNSEKDLESILRHGARALFEEAGDEYNEYSVELLISEAEKQEDTST
ATPF_STRSY      ESQKIIQDAAKLEKKRILEQADV-----EIQKQKAQLEIEAEKREAQENLRVQVAELAVDLASKIILEDL
ATPF_STRS2      ESQKIIQDAAKLEKKRILEQADV-----EIQKQKAQLEIEAEKREAQENLRVQVAELAVDLASKIILEDL
ATPF_RHOP5      ----------------------------------------------------------------------
ATPF_LACLS      EAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSL
ATPF_LACLM      EAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSL
ATPF_LACLA      EAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSL
ATPF1_METCA     QAAEIVNQAQKRANALVDESKEAAKIEGERILANARSEIDRELENAKEELRKQVSALAISAAEKILQREV
CIN8_ASHGO      LFQPIRDRWIASCDN--INQCDASHQNFEAKSTSGLDKLKELSDASLKSSED------------------
ATPF_PSYCK      KAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQASIDQEINQARESLRAQVAELAVLGAEKILQDKV
ATPF_CAMHC      KCVELIETAKKEA----IQLDEKIQQSAQIDIAQMQKSFAEQKEFEIRRLKKSVTAEILDELFNEKSVNL
ATPF_ANGEV      KADEILTQMEREKQDLINAADEDSRRLEDSKNSTIRFEEQRAIEQVRQQVSRLALERALESLNTRLNNEL
SLK19_YEAST     ---------ERESD---IAKVEKFKK--RIKELNTEIKVLNSNQKILQEKFDASI-TEVNHIKNTVNTLQ
ATPX_CYAPA      NASKLTNTTRSEIQRFVSEKLEEAQKKADSELASATNKLELQKDEALKSLESEVQTLSTKILEKLLGIQI
ATPF_ERWT9      SATDQLKKAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDXXXXXLAVAGAEKIIERSV
TEKT2_HUMAN     IECLTLRESRRDIDVVKDPVEDELHKEVEVTKKALQQKVSQ-----------------------------
SHOT1_PONAB     IS--MLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQCQKQIKELRDQI--VSVQEEKKILAIEL
SHOT1_HUMAN     IS--MLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQCQKQIKELRDQI--VSVQEEKKILAIEL
LON_BUCAI       VINDLMAIMESEIDLLQVEKRIRHRVKKQMEKSQREYYLNEQIKAIQKELGDMD---EIPDENKILKRKI
ATPF_SHEB5      KATDQLKEAKVTANEIIEQANKKTEANAERAKIIAQGKIEAERNRVKEDLRKQVATLAIMGAEKILERSI
ATPF_GUITH      VIEQIKKEAEKTAETILAQGKLDIERLTNNGKSSIEKAELQIKKQIQQHITDLAIK--------------
ATPF_GEOKA      EAQALIENARKQKEQIXXXXXXXXXXXXXXXXXXXXXXXXQAMAALREQVASLSVLIASKVIEKEL-TEQ
ATPF_ACIBY      QAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQV
ATPF_ACIBT      QAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQV
ATPF_ACIBC      QAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQV
ATPF_ACIB5      QAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQV
ATPF_ACIB3      QAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQV
ATPF2_BARQU     DAQEIIAAAKREVEAVVSEARTKAEEYVKNRNKLAEQKIAQAEADAIRXXXXXXXXXXXXXXRVLIEQEL
PF08_PLAF7      FKNDFINKEKEDWSRLKIKLVKDFHKAALLKEEMVEEGLIEEKEDSLRKYYDCEI----NNIKSIIQNEI
ATPF_SHEB9      KATDQLKEAKVTANEIIEQANKKTEADAERAKIIAQGKIEAERNRVKEDLRKQVATLAIMGAEKILERSI
ATPF_SHEB8      KATDQLKEAKVTANEIIEQANKKTEADAERAKIIAQGKIEAERNRVKEDLRKQVATLAIMGAEKILERSI
ATPF_RHOS5      ----------------------------------------------------------------------
ATPF_MANSM      RRNDILEEVKTEAENLKATIIAQGHAEVEAERKRVQEEL-RVKVASL----------AIAGAEKIVGRTV
ATPF_LISMF      ---SVLQQARVESQTMIEEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNL
ATPF_KLEP7      NATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDQVAI-LAVAGAEKIIERSV
ATPF_KLEP3      NATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDQVAI-LAVAGAEKIIERSV
ATPF_DEHE1      QGQLVIERAVKTGDXXXXXXXXXXXXXXXXMLSRARTEIRQERDEVVDQLRKEFAELTILAAGKVIDQSL
ATPF_BACP2      -SHTLIENAXXXXXXXXXXXXXAARQESERLKDSARTEIVKEKEQAVAALREQVASLSVLIASKVIEREL
ATPF_BACCN      EAQELIERAKKQAEEQKDGXXXXXXXXXXXXXXXXVQEIQREKEQAIATLQEQVASLSVQIASKVIEKEL
ATPF1_GLUOX     ----------------------------------------------------------------------
SYCP1_HUMAN     NCNNLRKQVENKNKYI--------EELQQENKALKKKGTAESKQLNVYEIKVNKLELELESAKQKFGEIT
RRF_CHLMU       KDDSLTEDAVKGLEKKIQELTDKFCKQIE--------ELAKQKEAELSSI--------------------
CC150_HUMAN     VQNE-KTQLQAHLDHLILEHNQCIQKAQDVQKELLESTIARLREASMQEKKSLL------EEKERFQREV
BRE1_DEBHA      EIKEIEQAFQETRENSLSKLMSVTDQENMVKKLTIEKTKADQKYFASMRLKD-----SLSSENKILKTQI
ATPF_TROWT      EASQIRQEARDDAQLILQQARETADETAERVMLHAREQIQAEKAAALLSLR-------------------
ATPF_TROW8      EASQIRQEARDDAQLILQQARETADETAERVMLHAREQIQAEKAAALLSLR-------------------
ATPF_RICTY      LRSQMIEESDKATQKIIQDKTKAMEEFLEQKKADAIQLIQNQKLIASKDLQD------------------
ATPF_LISW6      ---SVLQQARVESQTMIEEIVKTARRESERIKEEAKTDIAREKEDAISALREQVGSLSVLIASKVIEKNL
ATPF_ENT38      NATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDQVAI-LAVAGAEKIIERSV
ATPF_BACC7      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACC2      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACC1      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
YR555_MIMIV     FTG-----TKKEIDNLVQEKKLLKDKIVFLKEKISQNELAVQNQKSNDEIKKQEIESKIDQITCIINTS-
CN145_MOUSE     LENELKRQSKSQS-QIKAEKIHLEEEITELKKSQSQDKVKLLE--MQESIKDLS-AIRADLANKLXXXXX
CENPE_HUMAN     MNELELQSTTKDSTTLALRLNEKFQESQEEIKSLTKERLKTIKEAL--EVKHDQLKEHIETLAKIXXXXX
CCD46_MOUSE     EHENQIQESKKRDAQVIADMEAQVHKLREELISVNSQRKQQLIELGLEEEKQRAAKDHETAVKK-LKAES
ATPF_XANOR      KVNEVLKDARTKANEIIDQAHARANQXXXXQKELAQTEIDASATRAREELRKQVSVLAVSGAEKLLKREI
ATPF_XANOP      KVNEVLKDARTKANEIIDQAHARANQXXXXQKELAQTEIDASATRAREELRKQVSVLAVSGAEKLLKREI
ATPF_XANOM      KVNEVLKDARTKANEIIDQAHARANQXXXXQKELAQTEIDASATRAREELRKQVSVLAVSGAEKLLKREI
ATPF_CYTH3      TNEALLAEARIERDKILADAHKAMMEDAKVKASTEGNRLMEAKNAALHEVKNYAATLAVEIAEKILRKEL
ATPF_CAUSK      XXXXMLAAAKADVAQMEIEAKAKLEDQIKRRAEMAERKIAQ-----------------------------
ATPF_BACHK      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACCZ      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACCR      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACC4      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACC0      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACAN      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL
ATPF_BACAH      EAQELIERAKKQAVDQKDXXXXXXXXXXXXXXXXXXQEIQREKEQAIAALQEQVASLSVQIASKVIEKEL


                         +         .         .         .         .         *         .:210
query           DKSKLDGLFEKNLEETKIALKKISS
ATPF_RHORU      AKADQNRLID---------------
ATPF_RHORT      AKADQNRLID---------------
ATPF_CHLPB      DAEKQKNIVDSMIQE----------
ATPF2_RHILO     -------------------------
ATPF1_BARHE     SKESV--------------------
ATPF_MESFL      NKTKNKKIVDEFIE-----------
ATPF_LACS1      QKALVDSYIE---------------
ATPF_SINMW      DASAQETLFQKALGEVKSRL-----
ATPF_RICFE      QSAKFESNIAKNL------------
ATPF_PROVI      ----LDGEVQRKVVDSMIA------
ATPF_MYCMS      DKNTNKQLIEEFIKE----------
ATPF_RHOCA      -------------------------
ATPF_CHLTE      DADKQKAVVNDMIKE----------
ATPF_RHIME      DAGAQETLFKKAIGEVKARL-----
ATPF_BRAJA      KGQVADDLLAKSISEVR--------
ATPF_ILYTA      D-SKL--------------------
ATPF_RICCN      QSVKLESNIAKNL------------
ATPF2_MESSB     DTKTGSELFKASLQDVKTRL-----
ATPF_COXBU      DKASNDRLVDELVSE----------
ATPF_COXBR      DKASNDRLVDELVSE----------
ATPF_COXBN      DKASNDRLVDELVSE----------
ATPF_COXB2      DKASNDRLVDELVSE----------
ATPF_COXB1      DKASNDRLVDELVSE----------
ATPF_CALS8      NTEENRKIVENIFDEAGVA------
ATPF_RHOP2      KGQVADDLLGKGIQEVRSKL-----
ATPF_CLOD6      DKSKHEELIENFIKE----------
ATPF2_BART1     DSNRADELVKEALSKESLSKMK---
ATPF_LACPL      QQALINSYIE---------------
ATPF_STAES      SEQDQKELVEKYLKE----------
ATPF_STAEQ      SEQDQKELVEKYLKE----------
ATPF_SILPO      -------------------------
ATPF_MYCCT      DKNTNKKLIEEFIKD----------
ATPF_PROMO      D------------------------
ATPF_SPHAL      -------------------------
ATPF_CHLPD      D------------------------
ATPF_CHLL2      D------------------------
ATPF_STRP3      DKTAQSQLIDSYLDD----------
ATPF_ERYLH      -------------------------
ATPF_THELT      DE-----------------------
ATPF_STAHJ      SEQDQKELVDKYLKE----------
ATPF_LEPBP      KKEDYASFVEKEI------------
ATPF_LEPBA      KKEDYASFVEKEI------------
ATPF_LACF3      QQALIDTYIE---------------
ATPF_BACME      SEQDQEKLIHEYIQE----------
ATPF_SALRD      DADRHRQLVDDALDD----------
ATPF_BACFR      DKQEQMGMIDRMLDE----------
ATPF_BACFN      DKQEQMGMIDRMLDE----------
ATPF1_ACICJ     -------------------------
ATPF_CLOPH      DETKQKQLIDEALNE----------
ATPF_BAUCH      DKNLNSKIIDKIL------------
ATPF_STRGC      DKEAQSQLIDSYIDK----------
ATPF_RHIEC      DGKVQSELFGNAVGQVKTRL-----
ATPF_NITWN      -------------------------
ATPF_LACC3      QKGLIDDYIKR--------------
ATPF_STRTD      DAKAQSDLIDSYLDQ----------
ATPF_STRT2      DAKAQSDLIDSYLDQ----------
ATPF_STRT1      DAKAQSDLIDSYLDQ----------
ATPF_RHOPT      -------------------------
ATPF_RHOPA      -------------------------
ATPF_PEDPA      DENSQKDLIDSYIE-----------
ATPF_ELUMP      D-PKTDAALVDNI------------
ATPF_BRASB      -------------------------
ATPF_RICBR      HSTK-----NNNLSETDIA------
ATPF1_PARL1     -------------------------
ATPF_BACSK      DASEQDQLVQEYLKQ----------
ATPF_STRR6      DSHAHKALIDQYIDQ----------
ATPF_STRPS      DSHAHKALIDQYIDQ----------
ATPF_STRPN      DSHAHKALIDQYIDQ----------
ATPF_STRPI      DSHAHKALIDQYIDQ----------
ATPF_STRP4      DSHAHKALIDQYIDQ----------
ATPF_STRP2      DSHAHKALIDQYIDQ----------
ATPF_OENOB      TASKHKALIDDFISE----------
ATPF_BACPF      NEAEQEKLVQEYLKE----------
ATPF_GRAFK      SKNEQHQMIEKMIGDAKL-------
ATPF_FERNB      DEKAKREYLAKVIKE----------
ATPF2_OCHA4     DTKVAGNLFKDALSQVK--------
ATPF2_BARHE     DSHKANELIKESLVQESLTKMK---
ATPF_SULSY      -------------------------
ATPF_PSEAE      DANAHEQLVSK--------------
ATPF_PSEAB      DANAHEQLVSK--------------
ATPF_PSEA7      DANAHEQLVSK--------------
ATPF_MYCMO      DVKLEDSKFLENLLKNDI-------
ATPF_LACBA      QKALIDSYIE---------------
ATPF_CLOPS      DESKHRELINDFIEKVGI-------
ATPF_CAUCR      -------------------------
ATPF_RICPR      EKSIAKNLMDKS-------------
ATPF_NITHX      -------------------------
ATPF_LACCB      QKGLIDDYIKR--------------
ATPF_CLOBB      DESK---------------------
ATPF_CLOBA      DESK---------------------
ATPF_FRAP2      DEQSSKKILKDFVEK----------
ATPF_CAMC1      FSS--DSLKVDQKELVNIILKKVS-
RRF_CHLFF       -------------------------
PLPA_MYCGA      DESKLENKFESFADKTEITSKKIS-
MYSS_CYPCA      --ERRNSLMQAEIEELRAALEQ---
ATPF_RHOPS      -------------------------
ATPF_METRJ      -------------------------
ATPF_MESVI      SKSRLNRRLQKRVTRLNIGL-----
ATPF_FLAPJ      NKDAQTKLVEKMLGDVKL-------
ATPF_ALKOO      DQSAHQQMIQQFIDK----------
ATPF_ENTHR      SPEMHESLINQYIE-----------
ATPF_AZOC5      -------------------------
ATPF_LEUMM      QQALID-------------------
ATPF_ANADE      DEKSQRALVEEYIAQ----------
ATPF_BACWK      DQVKLIRDYIKEVGEAR--------
ATPF_ACIAD      DQQAHAAMLEQ--------------
ATPF2_PSEA6     DAAAQSDIVEKLVAE----------
RRF_CHLAB       -------------------------
ATPF_SHEHH      DEAAHSDIVNKLVAE----------
ATPF_LEGPL      DAKANSELLDNLIEE----------
ATPF_LEGPH      DAKANSELLDNLIEE----------
ATPF_LEGPC      DAKANSELLDNLIEE----------
ATPF_LEGPA      DAKANSELLDNLIEE----------
ATPF_BRASO      -------------------------
ATPF_ARCB4      -------------------------
ATPF_NATTJ      DKDQQKKLVQKYLKE----------
ATPF_BACHD      -------------------------
RRF_CHLCV       -------------------------
LZTL1_HUMAN     DKTENQKSLEENLATAKHDLLRV--
ATPF_SHEPA      DEAAHSDIVNKLVAE----------
ATPF_MYCGE      DREFID-KFIRDLE-----------
ATPF_MAGSA      SAAQTGSLVDNAIKD----------
ATPF_CLOAB      NEAEHRKLIE---------------
ATPF2_VIBHB     DSSANRDLVNRFINE----------
LZTL1_PONAB     DKTENQKSLEENLATAKHDLLRV--
LZTL1_MACFA     DKTENQKSLEENLATAKHDLLRV--
TEKT2_MACFA     DR----GCLSLNLRSPNISLK----
ATPF_VIBFM      DKDILDNITAK--------------
ATPF_VIBF1      DKDILDNITAK--------------
ATPF_UNCTG      MSKVLSDLFTET-EKQKLALEKI--
ATPF_BACA2      DEQAQEQLIQDYLKE----------
ATPF_ANEMR      HLRMID-------------------
ATPF1_XANP2     -------------------------
Y8CB_CAEEL      EELKIR---VKELEATDLSEKNI--
TFB3_CANGA      -------------------------
CIP2A_HUMAN     DKEETIDILRKELSRTEQIRKELS-
ATPF_STRSV      DKEAQSELIDRYIKQ----------
ATPF_PARDP      -------------------------
ATPF_NOSP7      ADDAQQSLIDRSIAQ----------
ATPF_ENTFA      TPDAHEALIDSYIE-----------
ATPF_DESDG      DGKEQEKLIDKYL--TKVVL-----
ATPF1_SYNP2     DESAQAKLVDRSIAQ----------
SYS_GEOSW       -------------------------
ATPF_LEUCK      QQALID-------------------
ATPF_SHEON      DPAAHSDIVNKLVAE----------
ATPF_ANASK      DEKAQRALVEEYIAQ----------
ATPF1_BEII9     -------------------------
HOOK_CAEEL      -------------------------
ATPF_UREPA      -------------------------
ATPF_UREP2      -------------------------
ATPF_PETMO      DKKKNEELIRRAINSLK--------
ATPF_MYCGA      AKEDHERLVNELL------------
VATE_FINM2      LKSRDNALFAKQLQKIKDKLKNMS-
MIT1_SCHPO      DESDI--------------------
ATPF_STRSY      DQQAHSNLIDRYLDK----------
ATPF_STRS2      DQQAHSNLIDRYLDK----------
ATPF_RHOP5      -------------------------
ATPF_LACLS      DASAQQELIDSYL------------
ATPF_LACLM      DASAQQELIDSYL------------
ATPF_LACLA      DASAQQELIDSYL------------
ATPF1_METCA     DQKK---------------------
CIN8_ASHGO      -------------------------
ATPF_PSYCK      DVQK---------------------
ATPF_CAMHC      SQNELINLVQKKV------------
ATPF_ANGEV      HSRMID-------------------
SLK19_YEAST     QNEKI--LNDKNLENMKAELK----
ATPX_CYAPA      -------------------------
ATPF_ERWT9      DEAANSDIVDKLVAE----------
TEKT2_HUMAN     -------------------------
SHOT1_PONAB     EKSKLVEVIEE--------------
SHOT1_HUMAN     EKSKLVEVIEE--------------
LON_BUCAI       KSSKMP---KEAREKTELELQKL--
ATPF_SHEB5      DPAAHSDIVNKLVAE----------
ATPF_GUITH      -------------------------
ATPF_GEOKA      DQRKLIEAYIKDVQE----------
ATPF_ACIBY      D------------------------
ATPF_ACIBT      D------------------------
ATPF_ACIBC      D------------------------
ATPF_ACIB5      D------------------------
ATPF_ACIB3      D------------------------
ATPF2_BARQU     DSNKANELIKESLFEESLTKMK---
PF08_PLAF7      SE-----------------------
ATPF_SHEB9      DPAAHSDIVNKLVAE----------
ATPF_SHEB8      DPAAHSDIVNKLVAE----------
ATPF_RHOS5      -------------------------
ATPF_MANSM      DEAANNDIIDKLVAE----------
ATPF_LISMF      DEKEQSNLIQDYIE-----------
ATPF_KLEP7      DEAANSDIVDKLVAE----------
ATPF_KLEP3      DEAANSDIVDKLVAE----------
ATPF_DEHE1      DKKAHQALIDSVLENS---------
ATPF_BACP2      DEQAQEKLIQEYLKE----------
ATPF_BACCN      DQVKLIRDYIKEVGEAR--------
ATPF1_GLUOX     -------------------------
SYCP1_HUMAN     D------TYQKEIEDKKIS------
RRF_CHLMU       -------------------------
CC150_HUMAN     NKTEKEIVQERCNLEKELAKNKV--
BRE1_DEBHA      NKSKLNDLEKSYLDKIEILTK----
ATPF_TROWT      -------------------------
ATPF_TROW8      -------------------------
ATPF_RICTY      -------------------------
ATPF_LISW6      DEKEQSNLIQDYIE-----------
ATPF_ENT38      DEAANSDIVDKLVAE----------
ATPF_BACC7      DQVKLIRDYIKEVGEAR--------
ATPF_BACC2      DQVKLIRDYIKEVGEAR--------
ATPF_BACC1      DQVKLIRDYIKEVGEAR--------
YR555_MIMIV     -------------------------
CN145_MOUSE     DLSELTAQVKSKEEETATAITQL--
CENPE_HUMAN     XXXXXLNMKEKDNETTKI-------
CCD46_MOUSE     ERVKME-LKKTHAAETEMTLEKANS
ATPF_XANOR      DANAHKALLDE--------------
ATPF_XANOP      DANAHKALLDE--------------
ATPF_XANOM      DANAHKALLDE--------------
ATPF_CYTH3      NNAE---------------------
ATPF_CAUSK      -------------------------
ATPF_BACHK      DQVKLIRDYIKEVGEAR--------
ATPF_BACCZ      DQVKLIRDYIKEVGEAR--------
ATPF_BACCR      DQVKLIRDYIKEVGEAR--------
ATPF_BACC4      DQVKLIRDYIKEVGEAR--------
ATPF_BACC0      DQVKLIRDYIKEVGEAR--------
ATPF_BACAN      DQVKLIRDYIKEVGEAR--------
ATPF_BACAH      DQVKLIRDYIKEVGEAR--------