[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ20988.1

[Show Plain Result]


## Summary of Sequence Search
    1::215
    4::175     2e-24  33%  218 aa  Y522_HAEIN RecName: Full=Uncharacterized protein HI0522;
   28::173     3e-10  31%  201 aa  YYAS_BACSU RecName: Full=Uncharacterized protein yyaS;
    1::215

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxKIKDIPKVYWSSEKPLNLKPKISTXXXXXXXXXXXXXXXXXXIVSFAGASPWSILAQGIALNVDLSI
Y522_HAEIN      ---KVRVIPRTSWAATSLWTAQYK--TISILLFALSILGIGDGLIVLSGLGSTPWTVLSQGIAIQTNFDI
YYAS_BACSU      ----------------------------------------------------SPFDALLVGLSKKIGLTV


                         .         .         *         .         .         .         .:140
query           GIITVLISIGVLFLWLPLKQKPGIGTILNAIIIGLMIDVCIKFIPTPENYLNQLILATIAVLTVGLGGGI
Y522_HAEIN      GWSSFLISCAVMLVWKPXXXXXXXXXXXNIIVIALFLGITTKILAPPTALFSRMIFCLIGILLYGFGTAL
YYAS_BACSU      GSWEVLISVILLICNAILRKKPILLGLITAFITGIGIDLWL-FVVKNTIYLNKLICFGIGLVLIGLGTAI


                         +         .         .         .         .         *         .:210
query           YLVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSIGWYLGGTVGIGTLLxxxxxxxxxxxxxxxx
Y522_HAEIN      YLTCHLGAGPRDGLMVGICQRFHLSINVVRSSLEISV---------------------------------
YYAS_BACSU      YLQTKFASTPIDHLTLIIRDLSKRTILFSRTLVYALFLVLAIIFKGPIGIGTLL----------------


                         .         .         .         +         .         .         .:280
query           xxxxx
Y522_HAEIN      -----
YYAS_BACSU      -----