[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21022.1

[Show Plain Result]


## Summary of Sequence Search
    1::924
    6::930       0.0  39%  930 aa  DPO1_HAEIN RecName: Full=DNA polymerase I;         Short=POL I;    
    9::922       0.0  43%  922 aa  DPO1_RICFE RecName: Full=DNA polymerase I;         Short=POL I;    
    9::875       0.0  44%  875 aa  DPO1_RICCN RecName: Full=DNA polymerase I;         Short=POL I;    
    8::913     e-178  40%  913 aa  DPO1_PSEAE RecName: Full=DNA polymerase I;         Short=POL I;    
    9::921     e-178  42%  921 aa  DPO1_RICHE RecName: Full=DNA polymerase I;         Short=POL I;    
   11::928     e-177  40%  928 aa  DPO1_ECOLI RecName: Full=DNA polymerase I;         Short=POL I;    
   11::928     e-173  38%  928 aa  DPO1_SALTY RecName: Full=DNA polymerase I;         Short=POL I;    
    3::867     e-171  42%  867 aa  DPO1_RICPR RecName: Full=DNA polymerase I;         Short=POL I;    
    3::872     e-168  42%  872 aa  DPO1_RICTY RecName: Full=DNA polymerase I;         Short=POL I;    
    5::846     e-162  42%  850 aa  DPO1_ANATD RecName: Full=DNA polymerase I;         Short=Pol I;    
    5::908     e-160  38%  908 aa  DPO1_BORBU RecName: Full=DNA polymerase I;         Short=POL I;    
   17::311     e-157  50% 1016 aa  DPO1_RHILE RecName: Full=DNA polymerase I;         Short=POL I;      
    7::873     e-155  38%  877 aa  DPO1_BACCA RecName: Full=DNA polymerase I;         Short=POL I;    
    9::876     e-155  37%  880 aa  DPO1_BACSU RecName: Full=DNA polymerase I;         Short=POL I;    
    7::872     e-153  38%  876 aa  DPO1_BACST RecName: Full=DNA polymerase I;         Short=POL I;    
    1::873     e-141  37%  877 aa  DPO1_LACLA RecName: Full=DNA polymerase I;         Short=POL I;    
    9::873     e-137  36%  877 aa  DPO1_LACLM RecName: Full=DNA polymerase I;         Short=POL I;    
    8::933     e-137  36%  942 aa  DPO1_CHLAA RecName: Full=DNA polymerase I;         Short=POL I;    
    1::873     e-135  37%  877 aa  DPO1_STRPN RecName: Full=DNA polymerase I;         Short=POL I;    
    6::982     e-135  38%  986 aa  DPO1_SYNY3 RecName: Full=DNA polymerase I;         Short=POL I;    
    1::873     e-134  37%  877 aa  DPO1_STRR6 RecName: Full=DNA polymerase I;         Short=POL I;    
    3::279     e-113  46%  871 aa  DPO1_RICBR RecName: Full=DNA polymerase I;         Short=POL I;    
    4::260     e-106  39%  997 aa  DPO1_TREPA RecName: Full=DNA polymerase I;         Short=POL I;    
   13::895     e-102  33%  897 aa  DPO1_HELPJ RecName: Full=DNA polymerase I;         Short=POL I;    
   13::889     e-101  33%  891 aa  DPO1_HELPY RecName: Full=DNA polymerase I;         Short=POL I;    
   45::304     9e-94  42%  956 aa  DPO1_DEIRA RecName: Full=DNA polymerase I;         Short=POL I;    
   16::255     7e-89  40%  832 aa  DPO1_THEAQ RecName: Full=DNA polymerase I, thermostable;       
   16::284     3e-87  39%  833 aa  DPO1_THEFI RecName: Full=DNA polymerase I, thermostable;       
   16::284     8e-87  38%  834 aa  DPO1_THECA RecName: Full=DNA polymerase I, thermostable;       
   15::281     1e-84  39%  831 aa  DPO1F_THETH RecName: Full=DNA polymerase I, thermostable;       
   16::284     3e-83  39%  834 aa  DPO1T_THET8 RecName: Full=DNA polymerase I, thermostable;       
   11::308     9e-78  40%  904 aa  DPO1_MYCTU RecName: Full=DNA polymerase I;         Short=POL I;    
   11::308     9e-78  40%  904 aa  DPO1_MYCBO RecName: Full=DNA polymerase I;         Short=POL I;    
   20::308     3e-77  37%  911 aa  DPO1_MYCLE RecName: Full=DNA polymerase I;         Short=POL I;    
  347::854     8e-56  32%  864 aa  DPOLN_MOUSE RecName: Full=DNA polymerase nu;         EC=2.7.7.7;
    5::258     5e-55  43%  289 aa  EX53_AQUAE RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
  348::855     2e-53  30%  900 aa  DPOLN_HUMAN RecName: Full=DNA polymerase nu;         EC=2.7.7.7;
  238::868     2e-52  30%  924 aa  DPOL_BPSP1 RecName: Full=DNA polymerase;         EC=2.7.7.7;
  110::726     1e-47  30%  829 aa  DPOL_BPT5 RecName: Full=DNA polymerase;         EC=2.7.7.7;
    2::526     7e-46  31%  574 aa  DPO1_AQUAE RecName: Full=DNA polymerase I;         Short=POL I;    
 1137::1666    1e-39  28% 1762 aa  DPOLQ_HUMAN RecName: Full=DNA polymerase theta;         Short=DNA
    8::250     3e-38  38%  296 aa  EX53_BACSU RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
    5::292     3e-36  34%  302 aa  EX53_BUCBP RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
    6::284     9e-36  33%  289 aa  EX53_UREPA RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
   11::286     1e-34  32%  287 aa  EX53_BUCAP RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
    5::250     5e-34  37%  286 aa  EX53_BUCAI RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
    6::254     4e-32  36%  256 aa  XNI_SHEPA RecName: Full=Uncharacterized exonuclease xni;       
    4::252     1e-31  33%  255 aa  XNI_SHEPW RecName: Full=Uncharacterized exonuclease xni;       
   64::269     1e-31  33%  290 aa  XNI_COLP3 RecName: Full=Uncharacterized exonuclease xni;       
    4::250     1e-31  36%  255 aa  XNI_SHESH RecName: Full=Uncharacterized exonuclease xni;       
    8::256     2e-31  36%  303 aa  EX53_BACHD RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
   41::249     3e-31  35%  251 aa  XNI_SERP5 RecName: Full=Uncharacterized exonuclease xni;       
    4::252     4e-31  34%  252 aa  XNI_SHEHH RecName: Full=Uncharacterized exonuclease xni;       
    6::253     1e-30  33%  255 aa  XNI_SHEFN RecName: Full=Uncharacterized exonuclease xni;       
   45::252     3e-30  34%  252 aa  XNI_SHEDO RecName: Full=Uncharacterized exonuclease xni;       
    4::250     3e-30  32%  262 aa  XNI_SHEB9 RecName: Full=Uncharacterized exonuclease xni;       
    2::262     7e-30  36%  301 aa  EX53_STRCO RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
    4::250     1e-29  31%  262 aa  XNI_SHEB8 RecName: Full=Uncharacterized exonuclease xni;       
    4::250     1e-29  32%  262 aa  XNI_SHEB5 RecName: Full=Uncharacterized exonuclease xni;       
    4::250     1e-29  31%  262 aa  XNI_SHEB2 RecName: Full=Uncharacterized exonuclease xni;       
   52::253     1e-29  32%  260 aa  XNI_TOLAT RecName: Full=Uncharacterized exonuclease xni;       
    4::250     2e-29  32%  260 aa  XNI_SHESA RecName: Full=Uncharacterized exonuclease xni;       
    4::248     2e-29  31%  262 aa  XNI_SHEPC RecName: Full=Uncharacterized exonuclease xni;       
    4::248     3e-29  31%  262 aa  XNI_SHESW RecName: Full=Uncharacterized exonuclease xni;       
   41::249     5e-29  33%  251 aa  XNI_ENTS8 RecName: Full=Uncharacterized exonuclease xni;       
    4::250     8e-29  32%  252 aa  XNI_SHEWM RecName: Full=Uncharacterized exonuclease xni;       
   41::248     1e-28  35%  252 aa  XNI_PHOLL RecName: Full=Uncharacterized exonuclease xni;       
   71::281     5e-28  33%  281 aa  XNI_ESCF3 RecName: Full=Uncharacterized exonuclease xni;       
   42::250     1e-27  32%  250 aa  XNI_SODGM RecName: Full=Uncharacterized exonuclease xni;       
   41::251     1e-27  33%  251 aa  XNI_KLEP7 RecName: Full=Uncharacterized exonuclease xni;       
   41::251     1e-27  33%  251 aa  XNI_KLEP3 RecName: Full=Uncharacterized exonuclease xni;       
    7::260     1e-27  30%  297 aa  EX53_MYCPU RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
   49::254     2e-27  31%  262 aa  XNI_PSYIN RecName: Full=Uncharacterized exonuclease xni;       
    4::256     2e-27  32%  257 aa  XNI_PSEHT RecName: Full=Uncharacterized exonuclease xni;       
   71::279     6e-27  32%  281 aa  XNI_SHIFL RecName: Full=Uncharacterized exonuclease xni;       
   71::279     6e-27  32%  281 aa  XNI_SHIF8 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_SHISS RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_SHIDS RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_SHIBS RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_SHIB3 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECOSE RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECOLU RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECOLI RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECOL5 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECOHS RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECODH RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECOBW RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECO8A RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECO57 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECO55 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECO27 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-27  32%  281 aa  XNI_ECO24 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     1e-26  32%  281 aa  XNI_ECOUT RecName: Full=Uncharacterized exonuclease xni;       
   71::279     1e-26  32%  281 aa  XNI_ECOL6 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     1e-26  32%  281 aa  XNI_ECOK1 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     1e-26  32%  281 aa  XNI_ECO81 RecName: Full=Uncharacterized exonuclease xni;       
   71::279     1e-26  32%  281 aa  XNI_ECO45 RecName: Full=Uncharacterized exonuclease xni;       
   41::249     2e-26  31%  260 aa  XNI_PECCP RecName: Full=Uncharacterized exonuclease xni;       
    7::241     2e-26  35%  318 aa  EX53_MYCTU RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
   38::574     3e-26  27%  595 aa  DPOL_BPML5 RecName: Full=DNA polymerase;         EC=2.7.7.7;
   38::586     3e-26  26%  607 aa  DPOL_BPMD2 RecName: Full=DNA polymerase;         EC=2.7.7.7;
   41::249     6e-26  31%  260 aa  XNI_ERWCT RecName: Full=Uncharacterized exonuclease xni;       
   46::250     8e-26  34%  260 aa  XNI_VIBPA RecName: Full=Uncharacterized exonuclease xni;       
   71::279     8e-26  32%  281 aa  XNI_ECO7I RecName: Full=Uncharacterized exonuclease xni;       
   54::258     8e-26  31%  267 aa  XNI_AERHH RecName: Full=Uncharacterized exonuclease xni;       
    4::255     1e-25  31%  257 aa  XNI_ALISL RecName: Full=Uncharacterized exonuclease xni;       
   61::271     1e-25  33%  271 aa  XNI_SALG2 RecName: Full=Uncharacterized exonuclease xni;       
   61::271     1e-25  33%  271 aa  XNI_SALEP RecName: Full=Uncharacterized exonuclease xni;       
   41::251     1e-25  33%  251 aa  XNI_SALDC RecName: Full=Uncharacterized exonuclease xni;       
   61::271     2e-25  33%  271 aa  XNI_SALTY RecName: Full=Uncharacterized exonuclease xni;       
   41::251     2e-25  33%  251 aa  XNI_SALPB RecName: Full=Uncharacterized exonuclease xni;       
   41::251     2e-25  33%  251 aa  XNI_SALNS RecName: Full=Uncharacterized exonuclease xni;       
   41::251     2e-25  33%  251 aa  XNI_SALHS RecName: Full=Uncharacterized exonuclease xni;       
   41::251     2e-25  33%  251 aa  XNI_SALA4 RecName: Full=Uncharacterized exonuclease xni;       
   50::221     2e-25  34%  265 aa  XNI_AERS4 RecName: Full=Uncharacterized exonuclease xni;       
   61::269     2e-25  33%  271 aa  XNI_SALTI RecName: Full=Uncharacterized exonuclease xni;       
   41::251     2e-25  33%  251 aa  XNI_SALSV RecName: Full=Uncharacterized exonuclease xni;       
   41::249     2e-25  33%  251 aa  XNI_SALPK RecName: Full=Uncharacterized exonuclease xni;       
   61::269     2e-25  33%  271 aa  XNI_SALPA RecName: Full=Uncharacterized exonuclease xni;       
   41::251     2e-25  33%  251 aa  XNI_CITK8 RecName: Full=Uncharacterized exonuclease xni;       
   46::250     3e-25  33%  260 aa  XNI_VIBHB RecName: Full=Uncharacterized exonuclease xni;       
    6::276     3e-25  30%  291 aa  EX53_MYCPN RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
   41::251     4e-25  33%  251 aa  XNI_YERE8 RecName: Full=Uncharacterized exonuclease xni;       
    4::250     4e-25  29%  260 aa  XNI_SHESR RecName: Full=Uncharacterized exonuclease xni;       
    4::250     4e-25  29%  260 aa  XNI_SHESM RecName: Full=Uncharacterized exonuclease xni;       
    4::255     5e-25  29%  262 aa  XNI_VIBFM RecName: Full=Uncharacterized exonuclease xni;       
   41::251     5e-25  33%  251 aa  XNI_SALPC RecName: Full=Uncharacterized exonuclease xni;       
   61::271     5e-25  33%  271 aa  XNI_SALCH RecName: Full=Uncharacterized exonuclease xni;       
    4::255     7e-25  29%  259 aa  XNI_VIBF1 RecName: Full=Uncharacterized exonuclease xni;       
   41::237     9e-25  34%  251 aa  XNI_YERPY RecName: Full=Uncharacterized exonuclease xni;       
   41::237     9e-25  34%  251 aa  XNI_YERPS RecName: Full=Uncharacterized exonuclease xni;       
   41::237     9e-25  34%  251 aa  XNI_YERPB RecName: Full=Uncharacterized exonuclease xni;       
   41::237     9e-25  34%  251 aa  XNI_YERP3 RecName: Full=Uncharacterized exonuclease xni;       
   41::237     1e-24  33%  251 aa  XNI_YERPP RecName: Full=Uncharacterized exonuclease xni;       
   41::237     1e-24  33%  251 aa  XNI_YERPN RecName: Full=Uncharacterized exonuclease xni;       
   41::237     1e-24  33%  251 aa  XNI_YERPE RecName: Full=Uncharacterized exonuclease xni;       
   46::256     2e-24  32%  257 aa  XNI_VIBSL RecName: Full=Uncharacterized exonuclease xni;       
   45::250     5e-24  30%  253 aa  XNI_SHEAM RecName: Full=Uncharacterized exonuclease xni;       
   42::249     8e-24  30%  253 aa  XNI_EDWI9 RecName: Full=Uncharacterized exonuclease xni;       
    4::207     1e-23  33%  259 aa  XNI_VIBVY RecName: Full=Uncharacterized exonuclease xni;       
   43::250     2e-23  33%  259 aa  XNI_VIBCH RecName: Full=Uncharacterized exonuclease xni;       
   41::216     5e-23  34%  230 aa  XNI_YERPA RecName: Full=Uncharacterized exonuclease xni;       
    4::207     1e-22  32%  259 aa  XNI_VIBVU RecName: Full=Uncharacterized exonuclease xni;       
    6::285     1e-21  28%  291 aa  EX53_MYCGE RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;
    2::251     3e-20  27%  256 aa  XNI_SHELP RecName: Full=Uncharacterized exonuclease xni;       
    4::255     7e-20  27%  261 aa  XNI_SHEON RecName: Full=Uncharacterized exonuclease xni;       
    2::250     4e-15  25%  258 aa  XNI_PHOPR RecName: Full=Uncharacterized exonuclease xni;       
  415::704     1e-10  24%  704 aa  DPOL_BPT3 RecName: Full=DNA polymerase;         EC=2.7.7.7;
  415::704     2e-10  24%  704 aa  DPOL_BPT7 RecName: Full=DNA polymerase;         EC=2.7.7.7;AltName:
   65::232     5e-10  29%  291 aa  EXO5_BPT5 RecName: Full=Exodeoxyribonuclease;       
   64::205     6e-08  34%  305 aa  RNH_BPT4 RecName: Full=Ribonuclease H;         Short=RNase H;      
  203::320     2e-07  34%  351 aa  FEN_SULTO RecName: Full=Flap structure-specific endonuclease;      
  202::315     2e-06  36%  348 aa  FEN_METKA RecName: Full=Flap structure-specific endonuclease;      
   26::259     3e-06  25%  328 aa  FEN_METST RecName: Full=Flap structure-specific endonuclease;      
  751::919     1e-05  26% 1031 aa  RAD2_YEAST RecName: Full=DNA repair protein RAD2;       
  195::272     1e-05  41%  336 aa  FEN_METTP RecName: Full=Flap structure-specific endonuclease;      
  201::267     2e-05  42%  350 aa  FEN_IGNH4 RecName: Full=Flap structure-specific endonuclease;      
  225::312     3e-05  34%  349 aa  FEN_THENV RecName: Full=Flap structure-specific endonuclease;      
  344::515     6e-05  29%  572 aa  MUTL_DICTD RecName: Full=DNA mismatch repair protein mutL;
  130::276     6e-05  33%  338 aa  FEN_PICTO RecName: Full=Flap structure-specific endonuclease;      
  224::296     1e-04  41%  349 aa  FEN_SULAC RecName: Full=Flap structure-specific endonuclease;      
  227::268     1e-04  52%  346 aa  FEN_PYRAR RecName: Full=Flap structure-specific endonuclease;      
  225::317     1e-04  38%  346 aa  FEN_PYRCJ RecName: Full=Flap structure-specific endonuclease;      
  202::336     1e-04  33%  339 aa  FEN_NANEQ RecName: Full=Flap structure-specific endonuclease;      
  149::310     2e-04  27%  702 aa  EXO1_YEAST RecName: Full=Exodeoxyribonuclease 1;       
   53::306     2e-04  24%  361 aa  PP1R7_MOUSE RecName: Full=Protein phosphatase 1 regulatory subunit
  227::327     2e-04  36%  346 aa  FEN_PYRIL RecName: Full=Flap structure-specific endonuclease;      
  349::496     3e-04  31% 1588 aa  YR327_MIMIV RecName: Full=Uncharacterized protein R327;
  227::268     4e-04  48%  346 aa  FEN_PYRAE RecName: Full=Flap structure-specific endonuclease;      
  202::264     4e-04  35%  342 aa  FEN_KORCO RecName: Full=Flap structure-specific endonuclease;      
  195::336     4e-04  31%  380 aa  FEN1A_ORYSJ RecName: Full=Flap endonuclease 1a;       
  199::360     4e-04  24%  681 aa  EFG_CARRP RecName: Full=Elongation factor G;         Short=EF-G;
  259::374     5e-04  31%  455 aa  MNME_FUSNN RecName: Full=tRNA modification GTPase mnmE;       
  222::334     5e-04  26%  368 aa  HEM1_THEM4 RecName: Full=Glutamyl-tRNA reductase;       
  200::272     5e-04  31%  340 aa  FEN_UNCMA RecName: Full=Flap structure-specific endonuclease;      
   98::198     7e-04  33%  588 aa  SYP_HELHP RecName: Full=Prolyl-tRNA synthetase;       
   26::245     7e-04  24%  432 aa  SEP14_HUMAN RecName: Full=Septin-14;
  200::276     7e-04  34%  336 aa  FEN_ARCFU RecName: Full=Flap structure-specific endonuclease;      
 1097::1212    9e-04  29% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
  230::336     9e-04  35%  350 aa  FEN_CALMQ RecName: Full=Flap structure-specific endonuclease;      
    1::924

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDKIKKTDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
DPO1_HAEIN      ------TNPLVLVDGSSYLYRAFHAFPSLTNAA-GEPTSAMYGVLNMLKSLISQVQ-------PTHIAVV
DPO1_RICFE      -----------LIDGYGFVFRAYYAQQPLTSPK-GEPVGALYGFASMLLKLLSDFK-------PKHVAVV
DPO1_RICCN      -----------LIDGYGFVFRAYYAQQPLTSPK-GEPVGALYGFTSMLLKLLSDFK-------PKHVAVV
DPO1_PSEAE      -----------LVDGSSYLYRAFHALPPLTT-STGKPTGAVKGVLNMLLSLRKQYPDSP-------FAVV
DPO1_RICHE      -----------LIDGYGFVFRAYYAQQPLTSPK-GEPVGALYGFTSMLLKLLSDFK-------PKHVAVV
DPO1_ECOLI      -----------LVDGSSYLYRAYHAFPPLTN-SAGEPTGAMYGVLNMLRSLIMQ-------YKPTHAAVV
DPO1_SALTY      -----------LVDGSSYLYRAYHAFPPLTN-SAGEPTGAMYGVLNMLRSLIMQ-------YQPTHAAVV
DPO1_RICPR      -----KKNTLLLIDGYGFVFRAYYAQKSLS-SAKGEPVGALYGFTSMLLKLLSDFK-------PQYVAIV
DPO1_RICTY      -----KKNTLLLIDGYGFVFRAYYAQQSLS-SAKGEPVGALYGFTSMLLKLLSDFK-------PQYGAIV
DPO1_ANATD      -----------IFDGNSILYRAFFALPELTT-SNNIPTNAIYGFVNVILKYLEQ-------EKPDYVAVA
DPO1_BORBU      ----------YLIDALNIIFRNYHVMKPLLN-TQGENVNAFIGFFKTLFFIIKE-------KNPEHLIIT
DPO1_RHILE      --RMKKGDHLFLVDGSGFIFRAFHALPPLTRKTDGLPIGAVSGFCNMLWKLLRDARNTDVGVTPTHLAVI
DPO1_BACCA      -----------LIDGSSVAYRAFFALP-LLHNDKGIHTNAVYGFTMMLNKILAE-------EEPTHMLVA
DPO1_BACSU      -----------LVDGNSLAYRAFFALPLLSNDK-GVHTNAVYGFAMILMKMLED-------EKPTHMLVA
DPO1_BACST      -----------LIDGNSVAYRAFFALP-LLHNDKGIHTNAVYGFTMMLNKILAE-------EQPTHILVA
DPO1_LACLA      ---MENKDRLLLIDGSSVAFRAFFALYNQIKAPNGLHTNAIFAFHTMLSSLMERIE-------PTHVLIA
DPO1_LACLM      -----------LIDGSSVAFRAFFALYNQLKAPNGLHTNAIFAFHTMLSSLMERIQ-------PTHVLIA
DPO1_CHLAA      -----------LVDGHALAYRAFFALRESLRSSRGEPTYAVFGFAQILLTALAE-------YRPDYAAVA
DPO1_STRPN      MDKKK----LLLIDGSSVAFRAFFALQQLDRFKNGLHTNAIYGFQLMLSHLLERVE-------PSHILVA
DPO1_SYNY3      -----KSPLLLLVDGHSLAFRAYYAFGPL-RTTAGIPTSVCFGFLNSLMQVMES-------QKPAAIAIA
DPO1_STRR6      MDKKK----LLLIDGSSVAFRAFFALYQQLKNAAGLHTNAIYGFQLMLSHLLERVE-------PSHILVA
DPO1_RICBR      -----KKNTLLLIDGYGFVFRAYYAQQPLTSPK-GEPVGALYGFTSMLLKLLNDFK-------PKHAAVV
DPO1_TREPA      ----KKT--LYLLDAYGLIYRSYHAFAPLINDS-GANVSAVYGFFRSLHTLLCH-------YRPRYFVAV
DPO1_HELPJ      -----------LIDTFAYLFRSYYMSAPLTNDK-GFPTGLLTGLVGMVKKFYKDRKNMPFIV----FAL-
DPO1_HELPY      -----------LIDTFAYLFRSYYMSAPLTNDK-GFPTGLLTGLVGMVKKFYKDRKNMPFIV----FAL-
DPO1_DEIRA      -----KPDTLVLIDGHALAFRSYFALPPLNN-SKGEMTHAIVGFMKLLLRLAR--------QKSNQVIVV
DPO1_THEAQ      -----------LVDGHHLAYRTFHALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGDA--------VIVV
DPO1_THEFI      -----------LVDGHHLAYRTFYALSLTT--SRGEPVQMVYGFARSLLKALEDGQA---------VVVV
DPO1_THECA      -----------LVDGHHLAYRTFFALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGYKAVF-------VV
DPO1F_THETH     -----------LVDGHHLAYRTFFALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGDV--------VVVV
DPO1T_THET8     -----------LVDGHHLAYRTFFALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGYKAVF-------VV
DPO1_MYCTU      -DRAKPT--LMLLDGNSLAFRAFYALPAENFKTGGLTTNAVYGFTAMLINLLRD-------EAPTHIAAA
DPO1_MYCBO      -DRAKPT--LMLLDGNSLAFRAFYALPAENFKTGGLTTNAVYGFTAMLINLLRD-------EAPTHIAAA
DPO1_MYCLE      -----------LLDGNSLAFRAFYALPTENFKTGGLTTNAVYGFTAMLINLLRE-------EAPTHIAAA
DPOLN_MOUSE     ----------------------------------------------------------------------
EX53_AQUAE      ----------YILDGSSFVYRSFFALPPLST-SKGFPTNAIYGFLRMLFSLIKK-------ERPQYLVVV
DPOLN_HUMAN     ----------------------------------------------------------------------
DPOL_BPSP1      ----------------------------------------------------------------------
DPOL_BPT5       ----------------------------------------------------------------------
DPO1_AQUAE      ----------------------------------------------------------------------
DPOLQ_HUMAN     ----------------------------------------------------------------------
EX53_BACSU      -----------LVDGMALLFRAFFATAVHRNNDSGVPTNGVNGFLKHLITAVETFQ-------PTHVVCC
EX53_BUCBP      ----KKNVNYLLIDGTSYLYRAYYAFLKF-KNNFNKPCGAIYGMLNMLRSML--------LKYPSNIVVI
EX53_UREPA      -----------VIDGNSLIYRAFHATYKQAEEKQLMPTNAIKLVASMIFKIL-------NQEQFTYGLIA
EX53_BUCAP      -----------IVDGSLYLYRSYFTFQNFNSNEEN-PSGAIYGMLKTI------QXXXXXXXXXXXXXXX
EX53_BUCAI      -----KNNPVIIIDGSLYLYASYYAFCNLENTS-GKPCGAIYGMLKII------DXXXXXXXXXXXXXXX
XNI_SHEPA       -----------IIDGMNLVRRIHAAQP---NESDGLKE-RVHGACRKLLKY----------HIPTHAAIV
XNI_SHEPW       ---------FLILDGMNLV-RRIHAAQPNEADISGLKE-RVHGACKKLLKF----------HQPSHVAIV
XNI_COLP3       --------------------------------------------------------------QPTHALTV
XNI_SHESH       ---------FLIIDGMNLV-RRMHAAQPNENDVNGLDI-RVGSACKKLVKY----------HQPTHVAVV
EX53_BACHD      -----------LIDGFNLLSRGYFATSQLPRNEAGYYINALRVFFPKLFQLIRE-------HNVTHVAVA
XNI_SERP5       --------------------------------------------------------------RPTHAVAV
XNI_SHEHH       ---------FLIIDGMNLVRRIHAAQP---NESDGLKE-RVNGACRKLLKF----------HQPSHAAIV
XNI_SHEFN       -----------IIDGLNLVRRIHAVLPD------------ENDIASVQERVLAASKKMLLQHQPTHCMVV
XNI_SHEDO       --------------------------------------------------------------QPSHVIVV
XNI_SHEB9       ---------FLIIDGLNLVRRIYAAIPDETDMQS--LTERVSSACTKLLRV----------HRPTHVAIV
EX53_STRCO      -----------LLDTASLYFRAYFGVPDSVKAPDGTPVNAVRGLLDFIDRLVKD-------HRPEHLVAC
XNI_SHEB8       ---------FLIIDGLNLVRRIYAAIPDETDMQS--LTERVSSACTKLLRV----------HRPSHVAIV
XNI_SHEB5       ---------FLIIDGLNLVRRIYAAIPDET-DMQSLTERVISA-CTKLLRV----------HRPTHVAIV
XNI_SHEB2       ---------FLIIDGLNLVRRIYAAIPDETDMQS--LTERVSSACTKLLRV----------HRPTHVAIV
XNI_TOLAT       ---------------------------------------------------------------PSHVIAV
XNI_SHESA       ---------FLIIDGLNLVRRIYAAIPD-ENDMDSL-TERVSVACTKLLRI----------HHPTHVTIV
XNI_SHEPC       ---------FLIIDGLNLVRRIYAAIPD-ENDMESLKERVTSA-CTKLLRV----------HHPSHIAIV
XNI_SHESW       ---------FLIIDGLNLVRRIYAAIPN-ENDMESLKERVTSA-CTKLLRV----------HHPSHIAIV
XNI_ENTS8       --------------------------------------------------------------QPTHAVAV
XNI_SHEWM       ---------FLIIDGLNLV-RRIHAAQPNENDVNGLDARVASA-CKKLLKY----------HQPSHVAIV
XNI_PHOLL       ---------------------------------------------------------------PTHAVAV
XNI_ESCF3       --------------------------------------------------------------QPTHVVAV
XNI_SODGM       ---------------------------------------------------------------PSHAVAV
XNI_KLEP7       --------------------------------------------------------------QPTHAVAV
XNI_KLEP3       --------------------------------------------------------------QPTHAVAV
EX53_MYCPU      -----KSEKFLLIDGNYLVHRSYY----VSFKFKNNFRSTIYLFFQTIIKIIKNLN-------PENIFIA
XNI_PSYIN       ------------------------------------------------------------IHQPTHAICV
XNI_PSEHT       --------HLLLIDALNLIRRIYAVDANQKHHSDEQMLKAVAHACS---KLLSSTKA-------THAIAV
XNI_SHIFL       --------------------------------------------------------------QPTHAVAV
XNI_SHIF8       --------------------------------------------------------------QPTHAVAV
XNI_SHISS       --------------------------------------------------------------QPTHAVAV
XNI_SHIDS       --------------------------------------------------------------QPTHAVAV
XNI_SHIBS       --------------------------------------------------------------QPTHAVAV
XNI_SHIB3       --------------------------------------------------------------QPTHAVAV
XNI_ECOSE       --------------------------------------------------------------QPTHAVAV
XNI_ECOLU       --------------------------------------------------------------QPTHAVAV
XNI_ECOLI       --------------------------------------------------------------QPTHAVAV
XNI_ECOL5       --------------------------------------------------------------QPTHAVAV
XNI_ECOHS       --------------------------------------------------------------QPTHAVAV
XNI_ECODH       --------------------------------------------------------------QPTHAVAV
XNI_ECOBW       --------------------------------------------------------------QPTHAVAV
XNI_ECO8A       --------------------------------------------------------------QPTHAVAV
XNI_ECO57       --------------------------------------------------------------QPTHAVAV
XNI_ECO55       --------------------------------------------------------------QPTHAVAV
XNI_ECO27       --------------------------------------------------------------QPTHAVAV
XNI_ECO24       --------------------------------------------------------------QPTHAVAV
XNI_ECOUT       --------------------------------------------------------------QPTHAVAV
XNI_ECOL6       --------------------------------------------------------------QPTHAVAV
XNI_ECOK1       --------------------------------------------------------------QPTHAVAV
XNI_ECO81       --------------------------------------------------------------QPTHAVAV
XNI_ECO45       --------------------------------------------------------------QPTHAVAV
XNI_PECCP       --------------------------------------------------------------QPTHAVAV
EX53_MYCTU      -----------LLDGASMWFRSFFGVPSSITAPDGRPVNAVRGFIDSMAVVITQ-------QRPNRLAVC
DPOL_BPML5      ----------------------------------------------------------------------
DPOL_BPMD2      ----------------------------------------------------------------------
XNI_ERWCT       --------------------------------------------------------------QPTHAVAV
XNI_VIBPA       --------------------------------------------------------------KPTHIIAV
XNI_ECO7I       --------------------------------------------------------------QPTHAVAV
XNI_AERHH       --------------------------------------------------------------EPTHVIAV
XNI_ALISL       --------HLVIIDALNLIRRVHSAQP---NQDDIQAVVTTTG--RTINRILKETE-------PTHIIAV
XNI_SALG2       --------------------------------------------------------------QPTHAVAV
XNI_SALEP       --------------------------------------------------------------QPTHAVAV
XNI_SALDC       --------------------------------------------------------------QPTHAVAV
XNI_SALTY       --------------------------------------------------------------QPTHAVAV
XNI_SALPB       --------------------------------------------------------------QPTHAVAV
XNI_SALNS       --------------------------------------------------------------QPTHAVAV
XNI_SALHS       --------------------------------------------------------------QPTHAVAV
XNI_SALA4       --------------------------------------------------------------QPTHAVAV
XNI_AERS4       --------------------------------------------------------------EPTHVIAV
XNI_SALTI       --------------------------------------------------------------QPTHAVAV
XNI_SALSV       --------------------------------------------------------------QPTHAVAV
XNI_SALPK       --------------------------------------------------------------QPTHAVAV
XNI_SALPA       --------------------------------------------------------------QPTHAVAV
XNI_CITK8       --------------------------------------------------------------QPTHAVAV
XNI_VIBHB       --------------------------------------------------------------QPTHIIAV
EX53_MYCPN      -----------LIDGNSLAYRAYFATWQQVEKLHNLPFNAIRTMLMMCWNLLQSKQYDYGV-------IS
XNI_YERE8       --------------------------------------------------------------QPTHAVAV
XNI_SHESR       ---------FLIIDGLNLVRRIYAAIPD-ENDMDSL-TDRVSVACTKLLRI----------HHPTHVAIV
XNI_SHESM       ---------FLIIDGLNLVRRIYAAIPD-ENDMDSL-TDRVSVACTKLLRI----------HHPTHVAIV
XNI_VIBFM       --------HLVIIDALNLIRRVHSAQP----NQDDIQA-VITTTTRTINKILKETE-------PTHIIAV
XNI_SALPC       --------------------------------------------------------------QPTHAVAV
XNI_SALCH       --------------------------------------------------------------QPTHAVAV
XNI_VIBF1       --------HLVIIDALNLIRRVHSAQP----NQDDIQA-VITTTTRTINKILKETE-------PTHIIAV
XNI_YERPY       --------------------------------------------------------------QPSHAVAV
XNI_YERPS       --------------------------------------------------------------QPSHAVAV
XNI_YERPB       --------------------------------------------------------------QPSHAVAV
XNI_YERP3       --------------------------------------------------------------QPSHAVAV
XNI_YERPP       --------------------------------------------------------------QPSHAVAV
XNI_YERPN       --------------------------------------------------------------QPSHAVAV
XNI_YERPE       --------------------------------------------------------------QPSHAVAV
XNI_VIBSL       --------------------------------------------------------------KPTHIIAV
XNI_SHEAM       --------------------------------------------------------------QPTHCAIV
XNI_EDWI9       ---------------------------------------------------------------PSHAVAV
XNI_VIBVY       --------HLVIIDALNLIRRVHSAQPDPTDIAN-----TIQNTCRTLQRIISESH-------PTHIVAV
XNI_VIBCH       -----------------------------------------------------------NEAQPSHMIAV
XNI_YERPA       --------------------------------------------------------------QPSHAVAV
XNI_VIBVU       --------HLVIIDALNLIRRVHSAQPDPTDIAN-----TIQNTRRTLQRIISESH-------PTHIVAV
EX53_MYCGE      -----------LIDGNSLAYRAYFATWKQVEKQNNLPFNAIRTMLLMCWNLIKANVYQYGI-------VS
XNI_SHELP       -------NRFLIIDGLNLV-RRIHAAQPNENDVNGLPERVTSACRKLLSK-----------HNPSHVTLV
XNI_SHEON       ---------FLIIDGLNLVRRIYAAIPD-ENDMESL-TERVSVACTKLLRI----------HHPTHVAVV
XNI_PHOPR       ------TIHLVVIDALNLIRRVHAAQPGEPDVKNTARV-----CCQALSKIIKFSE-------PSHIVAV
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       --------------------------------------------------------------------VL
RNH_BPT4        ----------------------------------------------------------------TKIVLC
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ------------VDASNVIYKFLSSM----RQTDGTPLRDLNGHITSHLNMFQTSTLIEKDIKPVY---V
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       -----------------------------------------------------DRKENEFVLGPTHEEVI
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
DPO1_HAEIN      FDAKGKTFRDEMFEQYKSHRPPMPDDLRKQIQPLHDMIRALGIPLLVVEGIEADDVIGTLALQASSLGKK
DPO1_RICFE      FDSGGKNFRHHIYPEYKANRPPPPEDLVVQLPLVRDVASNLNFPILEKNGYEADDIIATFAAKTAALGED
DPO1_RICCN      FDSGGKNFRHQIYPDYKANRPPPPEDLIIQLPLVRDVASNLNFPILEKNGYEADDIIATFATKTAALGAH
DPO1_PSEAE      FDAKGPTFRDELFAEYKANRPSMPDDLRVQVEPLHASVRALGLPLLCVEGVEADDVIGTLARSSAAADRP
DPO1_RICHE      FDSGGKNFRHYIYPEYKANRPPPPEDLIVQLPLVRDVASNLNFPILEKNGYEADDIIATFATKTAALGEN
DPO1_ECOLI      FDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGLPLLAVSGVEADDVIGTLAREAEKAGRP
DPO1_SALTY      FDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGLPLLAVSGVEADDVIGTLAREAEKVGRP
DPO1_RICPR      FDSGGKNFRHKIYQNYKANRPLPPKDLIAQLPLVRDVASNFKFAILEKNGYEADDIIATFATKTVSLGEE
DPO1_RICTY      FDSGGKNFRHKIYQNYKANRPTPPEDLIGQLPLIRDVASHLNFAILEKNGYEADDIIATFATKTITLGKE
DPO1_ANATD      FDKRGREARKSEYEEYKANRKPMPDNLQVQIPYVREILYAFNIPIIEFEGYEADDVIGSLVNQFKNTGLD
DPO1_BORBU      FDSEVPTFRKQKYPSYKATRDLPPDDLIPQIGWIKEGLLKAKIPIFEMEGYEADDLLASFAKKAAKNNYL
DPO1_RHILE      FDYSAKTFRKDLYDAYKANRSAPPEELIPQFGLIREATRAFNLPCIETEGFEADDIIATYARQAEATGAD
DPO1_BACCA      FDAGKTTFRHEAFQEYKGGRQQTPPELSEQFPLLRELLRAYRIPAYELENYEADDIIGTLAARAEQEGFE
DPO1_BACSU      FDAGKTTFRHGTFKEYKGGRQKTPPELSEQMPFIRELLDAYQISRYELEQYEADDIIGTLAKSAEKDGFE
DPO1_BACST      FDAGKTTFRHETFQDYKGGRQQTPPELSEQFPLLRELLKAYRIPAYELDHYEADDIIGTMAARAEREGFA
DPO1_LACLA      FDAGKTTFRTEMFADYKGGRSKTPDEFREQLPFIKEMIEKLGIRHYELANYEADDIIGTLDKMAEAPNVN
DPO1_LACLM      FDAGKTTFRTEMFADYKGGRSKTPDEFREQLPFIKEMIEKLGIRHYELANYEADDIIGTLDKMAEAPDVN
DPO1_CHLAA      FDVGR-TFRDDLYAEYKAGRAETPEEFYPQFERIKQLVQALNIPIYTAEGYEADDVIGTLARQATERGVD
DPO1_STRPN      FDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMGIRHYDLAQYEADDIIGTLDKLAEQDGFD
DPO1_SYNY3      FDRREPTFRHEADGAYKSNRQETPEDFAEDLSYLQQLLEALNLQTITYAGYEADDILGTLACQGSDAGYQ
DPO1_STRR6      FDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDHMGIRHYELAQYEADDIIGTLDKLAEQDGFD
DPO1_RICBR      FDSGGKNFRHEIYPEYKANRPPPPEDLIAQLPLVRDVARNLNFPILEKNGFEADDIIATFAAKTASIGEE
DPO1_TREPA      FDSLTPTFRHVQYPAYKAKRDKTSAELYAQIPLIEEILCALGITVLRHDGFEADDLIATLAKRVAAEHCH
DPO1_HELPJ      -ESQTKTKRAEKLGEYKQNRKDAPKEMLLQIPIALEWLQKMGFTCVEVGGFEADDVIASLAT---LSPYK
DPO1_HELPY      -ESQTKTKRAEKLGEYKQNRKDAPKEMLLQIPIALEWLQKMGFVCVEVNGFEADDVIASLAT---LSPYK
DPO1_DEIRA      FDPPVKTFRHEQYEGYKSGRAQTPEDLPGQINRIRALVDALGFPRLEEPGYEADDVIASLTRMAEGKGYE
DPO1_THEAQ      FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
DPO1_THEFI      FDAKAPSFRHEAYEAYKAGRAPTPEDFPRQLALVKRLVDLLGLVRLEAPGYEADDVLGTLAKKAEREGME
DPO1_THECA      FDAKAPSFRHEAYEAYKAGRAPTPEDFPRQLALIKELVDLLGFTRLEVPGYEADDVLATLAKNPEKEGYE
DPO1F_THETH     FDAKAPSFRHEAYEAYKAGRAPTPEDFPRQLALIKELVDLLGLVRLEVPGFEADDVLATLAKRAEKEGYE
DPO1T_THET8     FDAKAPSFRHEAYEAYKAGRAPTPEDFPRQLALIKELVDLLGFTRLEVPGYEADDVLATLAKKAEKEGYE
DPO1_MYCTU      FDVSRQTFRLQRYPEYKANRSSTPDEFAGQIDITKEVLGALGITVLSEPGFEADDLIATLATQAENEGYR
DPO1_MYCBO      FDVSRQTFRLQRYPEYKANRSSTPDEFAGQIDITKEVLGALGITVLSEPGFEADDLIATLATQAENEGYR
DPO1_MYCLE      FDVSRKTFRSECYAGYKANRSSIPAEFHGQIDITKEVLGALGITVFAEAGFEADDLIATLATQAENEGYR
DPOLN_MOUSE     ----------------------------------------------------------------------
EX53_AQUAE      FDAPAKTKREKIYADYKKQRPKAPDPLKVQIPVIKEILKLAGIPLLELPGYEADDVIAYLAEKFSQKGFK
DPOLN_HUMAN     ----------------------------------------------------------------------
DPOL_BPSP1      ----------------------------------------------------------------------
DPOL_BPT5       ----------------------------------------------------------------------
DPO1_AQUAE      ----------------------------------------------------------------------
DPOLQ_HUMAN     ----------------------------------------------------------------------
EX53_BACSU      WDMGSKTYRNDLFQDYKANRSAPPVELIPQFDLAKEAAAELGIMNIGFAGYEADDCIGTLAD-LFANEAD
EX53_BUCBP      FDSPQKTFRNELFIPYKKNRPKMPNDLKEQXXXXXXXXXXXXXXXXXXXXVEADDIIGTLATKLYKKKYF
EX53_UREPA      MDASKQTFRAQEYAAYKATRKPMDAKLIVQLPYLKKLFVAMGFRIISQPGIEADDFVGSFSNLMNKFDVD
EX53_BUCAP      XXXXXXNFRNTIFKEYKSNRSAMPNKLYVQIQPLFKILEEIGIKTLSILGIEADDIIGSLAYKLEQKGEQ
EX53_BUCAI      XDSSRKTFRNKLFKEYKKNRSSMPDLLVMQIQPLFEXXXXXXXXXXXXXXXEADDVIGSLSYQLEKQGEK
XNI_SHEPA       WDGDAISWRKTLFPDYKKGRKPMPEALANGLNDIKAYLAEHHIHSVDADS-EADDVIATLATKLVNIDGE
XNI_SHEPW       WDGNAISWRKALYEDYKKGRKPMPEALSNGLGDIKSYLAEHHIASLEADS-EADDVIATLATKLVSIGGE
XNI_COLP3       FDSQEPCWRYQLFEGYKKGRKKMPDHLANKLIDIQDAFMEQGVDSLTSDEDEADDLIATLAVKMALHGQK
XNI_SHESH       WDGDDISWRKHLFEDYKKGRKPMPEALSNTLPALKSYLAEQGVNSIDAAS-EADDVIATLASKLVANGGK
EX53_BACHD      WDVKRESHRRQAFAFYKASRGELPEALIEQYETATSLLEEIGVAQVTIPPYEADDTIGAFACR-WAKEEK
XNI_SERP5       FDERSESWRHQILPDYKAGRSPMPDNLQQEMPQLRQAFESLGVACWHSPGNEADDLAATLTAKVAGGGHQ
XNI_SHEHH       WDGDAISWRKALFEDYKKGRKPMPEALANGLVELKAYLAEHQLNSINADS-EADDVIATLATKLTSINGE
XNI_SHEFN       WDGNEPSWRKTLYSDYKKGRKPMPTALSDGLVNIKATLAEHDINSFDAQS-EADDVIATIAMKMISNKGE
XNI_SHEDO       WDGDEESWRKKLYSDYKKGRKPMPEALKIALVGIRNTLSEAGIHSLEAES-EADDVIATLATKMVENSGA
XNI_SHEB9       WDGDEISWRKQLYPDYKKGRKPMPEPLAQGLVALQDHLTAMHIGSI-YAAAEADDVIATLAIKTAKAQGE
EX53_STRCO      MDADRPHWRVELIPSYKAHREEVPDTLSPQVPVIEAVLDALGIARVGVAGYEADDVIGTYTARATGP---
XNI_SHEB8       WDGDEISWRKQLYPDYKKGRKPMPEPLAQGLVALQDHLTAMHIGSI-YAAAEADDVIATLAIKTAKAQGE
XNI_SHEB5       WDGHEISWRKQLYPDYKKGRKPMPEPLAQGLVALQDHLTAMHIGSI-YAAAEADDVIATLAIKTAKAQGE
XNI_SHEB2       WDGDEISWRKQLYPNYKKGRKPMPEPLAQGLVALQDHLTAMHIGSI-YAAAEADDVIATLAIKTAKAQGE
XNI_TOLAT       FDSEAPGWRKAKYAAYKEGRTAMPDALRQGLGQLQDSLLRLGIDSLVSETDEADDLIATLVKPLVANDHQ
XNI_SHESA       WDGDEMSWRKQLYPDYKKGRKPMPEPLAAGLPALQEHLKSVQIQSI-YAAAEADDVIATLAMKTAKAQGE
XNI_SHEPC       WDGDEISWRKQLYPDYKKGRKPMPEPLAQGLRALQEHLATLNIASI-YAAAEADDVIATLAVKTAKAQGE
XNI_SHESW       WDGDEISWRKQLYPDYKKGRKPMPEPLAQGLRALQEHLATLNIASI-YAAAEADDVIATLAVKTAKAQGE
XNI_ENTS8       FDARAQGWRHQLLPDYKAGRPPMPDDLHQEMPALRDAFTRRGVPCWHVEGNEXXXXXXXXXXXXXXXGHE
XNI_SHEWM       WDGDATSWRKTLYEDYKKGRKPMPEALAKSLPALKTHLSELNVNSIXXXXXXXX-VIATLATKLVNNQGK
XNI_PHOLL       FDEENRSWRHQILPDYKAGRSPMPDNLQQEMPQIRASFEQQGVTCWHAKGHEADDXXXXXXXXXXXXGHN
XNI_ESCF3       FDDENRNWRHQRLPDYKAGRPPMPDELHNEMPTLRAAFEQRGVPCWSATGNEADDLAATLAVKVTQAGHQ
XNI_SODGM       FDERHESWRHQQLPQYKSGRAPIPEDLQALMPAIRAEFNRQSVTCWHASGFEADDIAATLAIKVAAGGHR
XNI_KLEP7       FDDEDRAWRHQRLPEYKAGRAPMPETLVAEMPALRAAFEQRGIRCWASPGSEADDLAATLAVKVAQAGHQ
XNI_KLEP3       FDDEDRAWRHQRLPEYKAGRAPMPETLVAEMPALRAAFEQRGIRCWASPGSEADDLAATLAVKVAQAGHQ
EX53_MYCPU      FDEEGGTWRHDLCKEYKSQRSKMEDEFWNIFKAIREILDSINLNSGGFRGHEADDVIATITSKFKDEN-Q
XNI_PSYIN       FDSHAPSWRHQIYPEYKQGRKPIPELLKQGLPAIQEQFFDLGIDSLVTEEDEADDLIACLADKIAKQQQK
XNI_PSEHT       FDGD-KSWRYHFYKDYKHSRAPMPQILKDALVQFKAAIEETGIVVFEPINDEADDIIATLANKASHNNIS
XNI_SHIFL       FDDENRSWRHQRLPDYKADRPPMPEELHDEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_SHIF8       FDDENRSWRHQRLPDYKADRPPMPEELHDEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_SHISS       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_SHIDS       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_SHIBS       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_SHIB3       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECOSE       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECOLU       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRTAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECOLI       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECOL5       FDDENRSWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECOHS       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECODH       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECOBW       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECO8A       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECO57       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECO55       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECO27       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECO24       FDDENRSWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
XNI_ECOUT       FDDENRSWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECOL6       FDDENRSWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECOK1       FDDENRSWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECO81       FDDENRSWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_ECO45       FDDENRSWRHQRLPDYKAGRPPMPEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_PECCP       FDDEDRSWRHQLLPDYKAGRTPMPDNLKQELPQIKAAFAAAGVASWHSPGNEXXXXXXXXXXXXXXXGHQ
EX53_MYCTU      LDLDRPQFRVDLIPSYKAHREEVPDELTPQVDMIMELLDAFGIAMAGAPGFEADDVLGTLATR--ERRDP
DPOL_BPML5      ----------------------------------------------------------------------
DPOL_BPMD2      ----------------------------------------------------------------------
XNI_ERWCT       FDDEDRSWRHQLLPDYKAGRTPMPDNLKQELPQIKTAFAAVGVESWHSPGNEXXXXXXXXXXXXXXXGHQ
XNI_VIBPA       FDHHEQDWRAEILPDYKQNRKPMPEPLMQGLDAIQQAWWEQGIDSLLSEGDEADDLVATLATKVASHGEK
XNI_ECO7I       FDDENRSWRHQRLPDYKAGRPPMQEELHNEMPALRAAFEQRGVPCWSASGNEADDLAATLAVKVTQAGHQ
XNI_AERHH       FDGEVHSWRKEVYPAYKEGRTPMPTELREGLNELQDAFWECGVDALLSQTDEADDLIATLATGIAQHGAR
XNI_ALISL       FDLQDRGWRAEVLPKYKEDRKPMPEALQKGMDAIQESWWKLGIDSLLSDGDEADDLVATLANKVASRNEQ
XNI_SALG2       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGIRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALEP       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGIRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALDC       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGIRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALTY       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALPB       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALNS       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALHS       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALA4       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_AERS4       FDGEIHSWRKEVYPAYKEGRTPMPVELREGLNTLQDAFWECGVDALLSQTDEADDLIATLASGIAQHGAR
XNI_SALTI       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALSV       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALPK       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALPA       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_CITK8       FDARNSGWRHQRLPDYKAGRPPMPDELHNEMPAIRAAFEQRGVQCWVSSGNEADDLAATLAVKVTQAGHQ
XNI_VIBHB       FDHHEQDWRAEILPDYKQNRKPMPEPLIKGLDALQQAWWEQGIDSLLSEGDEADDLVATLATKVASHGEK
EX53_MYCPN      FDTKAPTFRDQLYSEYKSKRSKTPSELLVQIPVVKESLRHLGFLVCEQDGFEADDLIGSYARLMTQNNVA
XNI_YERE8       FDEDDRSWRHQSLPDYKAGRSPMSDNLQQEMPLIREAFNSLGVNCWSSPGNEADDLAATLAVKIGGAGHQ
XNI_SHESR       WDGDEISWRKQLYPDYKKGRKPMPEPLAAGLSALQEHLKSLPIQSI-YAAAEADDVIATLAMKTAKAQGE
XNI_SHESM       WDGDEISWRKQLYPDYKKGRKPMPEPLAAGLSALQEHLKSLPIQSI-YAAAEADDVIATLAMKTAKAQGE
XNI_VIBFM       FDLQDRGWRAEILPQYKEDRKPMPEALQKGMDDIQEAWWKLGIDSLLSDGDEADDLVATLANKVAVHNEQ
XNI_SALPC       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_SALCH       FDARSSGWRHQRLPDYKAGRPPMPDDLHNEMPALRAAFEQRGVRCWASDGNEADDLAATLALKVTEAGHQ
XNI_VIBF1       FDLQDRGWRAEILPQYKEDRKPMPEALQKGMDDIQEAWWKLGIDSLLSDGDEADDLVATLANKVAMHNEQ
XNI_YERPY       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_YERPS       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_YERPB       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_YERP3       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_YERPP       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_YERPN       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_YERPE       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_VIBSL       FDLQDRGWRAEVLPAYKQNRKPMPEPLMKGLDAIQQAWWELGIDSLLSDGDEADDLVATLAKKVADHGET
XNI_SHEAM       WDGDAISWRKHLYEDYKKGRKPMPEALAKGLPALKTKLETLDVHSVNADS-EADDIIATLACKLAATGGE
XNI_EDWI9       FDQRAESWRHRLLPGYKAGRQAMPDALAQEMESLRAAFTAQGVACWHSPGNEADDLAATLAYKVAQGGHR
XNI_VIBVY       FDGSDRGWRAEILPEYKQGRKPMPEPLLNGLEKIQDAWWQLGIDSLLSEGDEADDLVATLACKVAQHGEK
XNI_VIBCH       FDLSDRGWRAELLPTYKANRKPMPDVLQQGIDAIQDAWWQLGIDSLLSEGDEADDLVATLACKVAAHQEK
XNI_YERPA       FDEDDRSWRHQCLPDYKAGRSPMPDNLQQEMPLIRQAFNELGVACWHSPGNEADDLAATLVVKVAGAGHQ
XNI_VIBVU       FDGSDRGWRAEILPEYKQGRKPMPEPLLNGLEKIQEAWWQLGIDSLLSEGDEADDLVATLACKVAQHGEK
EX53_MYCGE      FDTKAPTFRDQIYEGYKQKRVKTPVELLVQIPLIKQALVYLGFLVCEKDGFEADDLIGSYANLFTKQEIT
XNI_SHELP       WDGDAISWRKKLYDDYKKGRKPMPEALSQALPALKQHLAERGFHSXXXXXXXXXXXXTLASKMVQAKGEA
XNI_SHEON       WDGDEISWRKQLYPDYKKGRKPMPEPLAAGLIALQEHLQNLQIQSI-YAAAEADDVIATLATKTAKAQGE
XNI_PHOPR       FDGDDRGWRAKLLPHYKEGRKPMPPELQAGMEIIQDAFMXXXXXXXXXXXXEADDLVATLALKVASRHQQ
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       GDKGKSVFRLEHLPEYKGNRDEKYAQRTEEFEYLKDALCKTTFPTFTIRGVEADDMAAYIVKLIGHLYDH
RNH_BPT4        IDNAKSGYRRDFAYYYKKNRGKAREESTWDWEYFESSHKVIDMPYIDIDKYEADDHIAVLVKKFSLEGHK
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       FDGKAPDLKKETQEERINIKKEAARKYAARTTHLNKEIIKSSKKLLDLPYVQARTEGEAQASYMVSQNDA
RAD2_YEAST      ---------DELFEQQMKDKRDSDEVTMDMIKEVQELLSRFGIPYITAP-MEAEAQCAELLQLNLVDG--
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       -------------------------------DIVNESKTLLNL--MGLPYVQAPSEGEAQASYMTLKGDV
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      --------------------------------------------------FEADSQMV-YLEQ---KNIV
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       THIAKNTIKSQLPLHLYQIHSKFRDELRPRFEFIMKDGYSFHSNYADL-NREFDVMEATYKRILQRMGLE
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
DPO1_HAEIN      VLISTGDKDMAQLVDDNIMLINTMNNSLLDRKGVIEKYGIPPELIIDYLALMGDSADNIPGVAGVGEKTA
DPO1_RICFE      VVVISSDKDLLQLMGENIKIYDPLKGKYITEDDVVKKFGTTSDKLREVMALIGDRSDNIPGVPSIGPKTA
DPO1_RICCN      VVIISSDKDLLQLMTENIKIYDPLKGKYITEDDVVKKFGTTSDKLREVMALIGDRSDNIPGVPSIGPKTA
DPO1_PSEAE      VVISTGDKDMAQLVDGHITLVNTMTGSRLDVDGVKEKFGVGPELIIDFLALMGDKVDNIPGVPGVGEKTA
DPO1_RICHE      VVIISSDKDLLQLMSENIKIYDPLRGKYITEDDVVKKFGTTSDKLREVMALIGDRSDNIPGVPSIGPKTA
DPO1_ECOLI      VLISTGDKDMAQLVXXXXXXXXXXXXXXLGPEEVVNKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTX
DPO1_SALTY      VLISTGDKDMAQLVXXXXXXXXXXXXXXLGPDEVVNKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTX
DPO1_RICPR      VIIISSDKDLLQLMSKNIKIYDPIKCKYITEDNVVTKFGTTPDKLREVMALIGDRSDNIPGVPSIGPKTA
DPO1_RICTY      VIIISSDKDLLQLMSKNIKIYDPIKCKYITEDDVIIKFGTTPDKLREVMALIGDRSDNIPGVPSIGPKTA
DPO1_ANATD      IVIITGDRDTLQLLDKNVVVFDKTVEDLYTVENVKEKYGVWANQVPDYKALVGDQSDNIPGVKGIGEKSA
DPO1_BORBU      TYIISPDKDLLQTMSEYVKILKIENNSFIEMDNVTKKFGVNSFQIKDYLAIVGDRSDNIPXXXXXXXXXX
DPO1_RHILE      VTIVSSDKDLMQLVSPNVHMYDSMKDKQIGIPDVIEKWGVPPEKMIDLQAMTGDSVDNVPGIPGIGPKTA
DPO1_BACCA      VKVISGDRDLTQLASPHVTVDITKKGEPYTPEAVREKYGLTPEQIVDLKGLMGDKSDNIPGVPGIGEKTA
DPO1_BACSU      VKVFSGDKDLTQLATDKTTVAITRKGEFYTPEHVKEKYGLTPEQIIDMKGLMGDSSDNIPGVPGVGEKTA
DPO1_BACST      VKVISGDRDLTQLASPQVTVEITKKGESYTPETVVEKYGLTPEQIVDLKGLMGDKSDNIPGVPGIGEKTA
DPO1_LACLA      VTIVTGDKDMIQLVDGNTRVEISKKGEEFTPDYLLEKMGLTPAQFIDLKALMGDSSDNYPGVTKVGEKTG
DPO1_LACLM      VTIVTGDKDMIQLVDGNTRVEISKKGEEFTPDYLLEKMGLTPSQFIDLKALMGDSSDNYPGVTKVGEKTG
DPO1_CHLAA      TIILTGDSDVLQLVNDHVRVANPYGGKTSVTEQVRKRYGLEPDQLADLRGLKGDTSDNIPGVRGIGEKGA
DPO1_STRPN      ITIVSGDKDLIQLTDEHTVVEISKKGEAFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTG
DPO1_SYNY3      VKILSGDRDLFQLVEKNISVLYLTRNPFSSNQGVVDKMGVTPAQIVDFKALCGDKSDCIPGINGIGEKTA
DPO1_STRR6      ITIVSGDKDLIQLTDEHTVVEISKKGEAFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTG
DPO1_RICBR      VVVISSDKDLLQLMNDNVKIYDPLKAKYITEDNVVEKFGVTSDKLREVMALIGDKSDNIPGVPSIGPKTA
DPO1_TREPA      VVIISSDKDVLQLVCDTVQVLRDIDHKWTCCDAVQQRWTVMPTQLLDLFSLMGDSSDNVPGVRGIGPKTA
DPO1_HELPJ      TRIYSKDKDFNQLLSDKIALFDG-KTEFLA-KDCVEKYGILPSQFTDYQGIVGDSSDNYKGVKGIGSKNA
DPO1_HELPY      TRIYSKDKDFNQLLSDKIALFDG-KTEFLA-KDCVEKYGILPSQFTDYQGIVGDSSDNYKGVKGIGSKNA
DPO1_DEIRA      VRIVTSDRDAYQLLDEHVKV---IANDFIGPAQVEEKYGVTVRQWVDYRALTGDASDNIPGAKGIGPKTA
DPO1_THEAQ      VRILTADKDLYQLLSDRIHVLHP-EGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
DPO1_THEFI      VRILTGDRDFFQLLSEKVSVLLP-DGTLVTPKDVQEKYGVPPERWVDFRALTGDRSDNIPGVAGIGEKTA
DPO1_THECA      VRILTADRDLDQLVSDRVAVLHP-EGHLITPEWLWQKYGLKPEQWVDFRALVGDPSDNLPGVKGIGEKTA
DPO1F_THETH     VRILTADRDLYQLLSERIAILHP-EGYLITPAWLYEKYGLRPEQWVDYRALAGDPSDNIPGVKGIGEKTA
DPO1T_THET8     VRILTADRDLYQLVSDRVAVLHP-EGHLITPEWLWEKYGLRPEQWVDFRALVGDPSDNLPGVKGIGEKTA
DPO1_MYCTU      VLVVTGDRDALQLVSDDVTVLYPRKGTRFTPEAVVEKYGLTPRQYPDFAALRGDPSDNLPGIPGVGEKTA
DPO1_MYCBO      VLVVTGDRDALQLVSDDVTVLYPRKGTRFTPEAVVEKYGLTPRQYPDFAALRGDPSDNLPGIPGVGEKTA
DPO1_MYCLE      VLVVTGDRDALQLVSNDVTVLYPRKGTRFTPEAVIEKYGVTPAQYPDLAALRGDPSDNLPGIPGVGEKTA
DPOLN_MOUSE     ----------------------------------------------------------------------
EX53_AQUAE      VKIYSPDKDLLQLVSENVLVINPMNDEVFTKERVIKKFGVEPQKIPDYLALVGDKVDNVPGIEGVGPKTA
DPOLN_HUMAN     ----------------------------------------------------------------------
DPOL_BPSP1      ----------------------------------------------------------------------
DPOL_BPT5       ----------------------------------------------------------------------
DPO1_AQUAE      ----------------------------------------------------------------------
DPOLQ_HUMAN     ----------------------------------------------------------------------
EX53_BACSU      ITVVTGDRDLLQLLTDKVSVALLQKGKVYTKETFYEETGVMPKALIDIKALMGDSSDNYPGVKGIGEKTA
EX53_BUCBP      ILISTNDKDLAQLVNIHIHVLIGTSNIVLDESKVKKKYGIIPKLIPDLLGLMGDNSDNIPGVPTVGKKTA
EX53_UREPA      TTIYSSDRDMLQXXXXXXXXXXXXXGTSVMQEINLTNFGILPYQIIEYKGLVGDSSDNLIGVKGIGPKTA
EX53_BUCAP      VLIVSHDKDMIQLITDNINVLNISKNSILTPEKIQEKYGIYPKEFIDLLALMGDSSDNIPGVPKIGIKTA
EX53_BUCAI      ILILSHDKDMLQLVTENINIFHKKNNCIITSEIIQEKYGIKPKEFIDFLALMGDATDNIPGVPKIGIKTA
XNI_SHEPA       AIIVSTDKGFSQLNHPKIKLWDHFNQTYLTIEEMEKKLGIERSQLIDYLALAGDSGNKIPGVPGIGPKSA
XNI_SHEPW       AIIVSTDKGFCQLKHPNIKQWDHFNQTYMTVEAMEQKLGVEHKQFIDYLALAGDSGNKIPGVPGIGPKSA
XNI_COLP3       VTIISTDKGFLPLLSPNIHIYDYFNRRYLDEEHVQSKFSVKTSQLIDFWTLTGDNTNKIEGVSGIGQVTA
XNI_SHESH       AIIVSTDKGFTQLSDPYIQRWDHFNQHYMTIEEREEKLGVEHSQFIDYLALAGDSGNKIPGVPGIGPKSA
EX53_BACHD      CFIYSNDRDLLQLLSKSTSQIISSKGKDLTEENFRNDYNISPAQWVDVKALLGDKSDNIPGCPGVGEKSA
XNI_SERP5       VTIVSTDKGYCQLLAPSVQIRDYFQKRWLDMPFVQQEFGVSPQQLSDYWGLAGISSSKIPGVAGIGPKTA
XNI_SHEHH       AIIVSTDKGFCQLSHPNIKRWDHFNQGYLTIEEMEKKLGVESTQFIDYLALAGDSGNKIPGVPGIGPKSA
XNI_SHEFN       VIIVSTDKGFSQLPTKNLTLWDHFNQQVFDVEQYEKKLGIEQYQMLDFIALAGDSGNKIPGIMGIGPKSA
XNI_SHEDO       AIIVSTDKGFSQLVKKNIQIWDHFKQLFLDISAHEKKLAVEQYQFLDFIALAGDSGNKIPGIAGIGPKSA
XNI_SHEB9       AIIVSTDKGFSQLNHRQISQWDHFNQQYLDIAALEQKLGVERSQFLDLMALAGDSGNKIPGIAGIGPKSA
EX53_STRCO      VDIVTGDRDLYQLVARGVRVLYPVKGNLVDEAALREKYGVDGAGYADLALLRGDPSDGLPGVPGIGEKTA
XNI_SHEB8       AIIVSTDKGFSQLNHRHISQWDHFNQQYLDIAALEQKLGVERSQFLDLMALAGDSGNKIPGIAGIGPKSA
XNI_SHEB5       AIIVSTDKGFSQLNHRHISQWDHFNQQYLDIAALEQKLGVERSQFLDLMALAGDSGNKIPGIAGIGPKSA
XNI_SHEB2       AIIVSTDKGFSQLNHRQISQWDHFNQQYLDIAALEQKLGVERSQFLDLMALAGDSGNKIPGIAGIGPKSA
XNI_TOLAT       VTLISTDKGFCQLLDSGLQIRDYFNKRWLDHAFVQQQYGLQPSQLVDFWALTGISGMNIKGVPGIGEKTA
XNI_SHESA       AVIVSTDKGFSQLNHPRISQWDHFNQQYLNITELEQKLGVDRSQFLDLLALAGDSGNKIPGIAGIGPKSA
XNI_SHEPC       AIIVSTDKGFSQLNHPRITQWDHFNQQYLDIAALEQKLGVDRSQFLDLMALAGDSGNKIPGIAGIGPKSA
XNI_SHESW       AIIVSTDKGFSQLNHPRITQWDHFNQQYLDIAALEQKLGVDRSQFLDLMALAGDSGNKIPGIAGIGPKSA
XNI_ENTS8       ATIVSTDKGYCQLLRPEIRIRDYFQKRWLDAPFIESEFGVSPGQLADFWGLAGISSSKIPGVPGIGPKSA
XNI_SHEWM       AIIVSTDKGFTQLTHTNIERWDHFNQAYITIEQREEKLGVERTQFIDYLALAGDSGNKIPGVPGIGPKSA
XNI_PHOLL       VTIVSTDKGYCQLLSPNIRIRDYFQKRWLDMPFVQQEFGVLPEQLPDYWGLAGISSSKIPGIQGIGPKTA
XNI_ESCF3       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SODGM       VTLVSTDKGYCQLLSPSIQIRDYFQKRWLDMPFVMRHFGVQPQQLTDFWGLAGVSSSKIPGVAGIGPKSA
XNI_KLEP7       ATIVSTDKGYCQLLSPTIRIRDYFQKRWLDAPFIASEFGVTPEQLADYWGLAGISSSKVPGVAGIGPKSA
XNI_KLEP3       ATIVSTDKGYCQLLSPTIRIRDYFQKRWLDAPFIASEFGVTPEQLADYWGLAGISSSKVPGVAGIGPKSA
EX53_MYCPU      IYIFSRDKDLLQLIDKNVYIHDNELKNLISIENFYQNFQLEPDQIVDFKAIAGDSSDNLXXXXXXXXXXX
XNI_PSYIN       CIIVSTDKGFYQLLNESIQLYDYFQNSFVIRQQVHQKMGISIQQLNDYWAITGISSSAIKGVEGIGSKGA
XNI_PSEHT       SVIVSTDKGFLPFLNEHIAVYDYFKKHYLDQDSIKQRFGVEQKKLVEFWAFAGDKTNDIPGVKGIGTKSA
XNI_SHIFL       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SHIF8       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SHISS       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SHIDS       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SHIBS       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SHIB3       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOSE       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOLU       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOLI       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOL5       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOHS       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECODH       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOBW       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO8A       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO57       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO55       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO27       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO24       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOUT       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOL6       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECOK1       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO81       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_ECO45       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_PECCP       ATIVSTDKGYCQLLAPHIQIRDYFQKRWLDLPFVEQEFGVSPQQLTDYWGLAGISSSKIPGVAGIGPKSA
EX53_MYCTU      VIVVSGDRDLLQVVADDVRVLGLAKATLFGPAEVAERYGLPAHRAAELALLRGDPSDGLPGVPGVGEKTA
DPOL_BPML5      ----------------------------------------------------------------------
DPOL_BPMD2      ----------------------------------------------------------------------
XNI_ERWCT       ATIISTDKGYCQLLAPHIQIRDYFQKRWLDLPFIEQEFSVSPQQLTDYWGLAGISSSKIPGVAGIGPKSA
XNI_VIBPA       VTIVSTDKGYCQLLSPTLQIRDYFQHRWLDEPFIEKEFGVKPSQLADYWGLTGISSSQVPGVPGIGPKAA
XNI_ECO7I       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_AERHH       ATIISTDKGFCQLICPQIQIRDYFNKRWLDAAFVEQQYGVAPAQLVDFWALTGIGGSNIKGVPGIGPKTA
XNI_ALISL       VTIVSTDKGYCQLLSPTLRIRDYFQHRWLDEPFIEKEFGLKPEQLADYWGLAGISSSKITGIPGIGPKAA
XNI_SALG2       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALEP       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALDC       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALTY       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALPB       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALNS       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALHS       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALA4       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_AERS4       ATIISTDKGFCQLICPQIQIRDYFNKRWLDAAFVEQQYGVVPAQLVDFWALTGISGSNIKGVPGIGPKTA
XNI_SALTI       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALSV       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALPK       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALPA       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_CITK8       ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIEKEFGVLPQQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_VIBHB       VTIVSTDKGYCQLLSPTLQIRDYFQHRWLDEPFIEKEFGVKPSQLADYWGLTGISSSQVPGVPGVGPKAA
EX53_MYCPN      VDIYSSDRDLLQLVDSMTSVWLCVKKEYNTDNFAEQFFGLTPKQVIEYKGLVGDNSDNLTXXXXXXXXXX
XNI_YERE8       VTIVSTDKGYCQLLAPNVQIRDYFQKRWLDMPFVKQEFGVLPHQLPDYWGLAGISSSKIPGVAGIGAKTX
XNI_SHESR       AVIVSTDKGFSQLNHPRISQWDHFNQQYLNIAELEQKLGVDRNQFLDLMALAGDSGNKIPGIAGIGPKSX
XNI_SHESM       AVIVSTDKGFSQLNHPRISQWDHFNQQYLNIAELEQKLGVDRNQFLDLMALAGDSGNKIPGIAGIGPKSX
XNI_VIBFM       VTIISTDKGYCQLLSPTLRIRDYFQHRWLDAPFVEKEFGLKPEQLADYWGLAGISSSKITGIPGVGPKAA
XNI_SALPC       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_SALCH       ATIVSTDKGYCQLLSPGLRIRDYFQKRWLDAPFIEKEFGVLPRQLPDYWGLAGISSSKVPGVAGIGPKSA
XNI_VIBF1       VTIISTDKGYCQLLSPTLRIRDYFQHRWLDAPFVEKEFGLKPEQLADYWGLAGISSSKITGIPGVGPKAA
XNI_YERPY       VTIVSTDKGYCQLLAPNVQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_YERPS       VTIVSTDKGYCQLLAPNVQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_YERPB       VTIVSTDKGYCQLLAPNVQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_YERP3       VTIVSTDKGYCQLLAPNVQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_YERPP       VTIVSTDKGYCQLLAPNIQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_YERPN       VTIVSTDKGYCQLLAPNIQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_YERPE       VTIVSTDKGYCQLLAPNIQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_VIBSL       VTIISTDKGYCQLLSPTLQIRDYFQHRWLDKPFIEAEFGVKPEQLADYWGLTGVSSSQVPGIPGIGPKAA
XNI_SHEAM       AIIVSTDKGLLQLMSPHIRQWDHFAGQFFDIEAFEAKLGIERHQLLDYIALCGDSGNKXXXXXXXXXKSA
XNI_EDWI9       VTIVSTDKGYCQLLSPQIQIRDYFQKRWLDLPFVQREFGVAPQQLTDFWGLAXXXXXXXXXXXXXXAKTA
XNI_VIBVY       VTIISTDKGYCQLLSPTLQIRDYFQHRWLDQPFIEQEFGVKPQQLSDYWGLTGISSSQVTGIPGIGPKAA
XNI_VIBCH       VTIISTDKGYCQLLSPTLQIRDYFQQRWLDEPFIAQEFGVTPAQLTDYWGLTGVSSSQIPGVAGIGPKAA
XNI_YERPA       VTIVSTDKGYCQLLAPNIQIRDYFQKRWLDMPFVKQEFGVLPRQLPDYWGLAGISSSKIPGVAGVGAKXX
XNI_VIBVU       VTIISTDKGYCQLLSPTLQIRDYFQHRWLDQPFIEQEFGVKPQQLSDYWGLTGISSSQVTGIPGIGPKAA
EX53_MYCGE      VDIYSSDRDMLQLVNAFTNVFLCIKG---TKEMVMYNYGLAPYQVVEYKGLVGDNSDNLAXXXXXXXXXX
XNI_SHELP       I-IVSTDKGFTQLLSPQIQLWDHFNQQAITIEDRERQLGVDRSQFIDFLAMAGDSGNKXXXXXXXXXKSA
XNI_SHEON       ALIVSTDKGFSQLNHPRISQWDHFNQQYLNIAELEQKLGVDRSQFLDLMALAGDSGNKXXXXXXXXXKSX
XNI_PHOPR       VTIISTDKGYCQLLSPTLRVRDYFQQRWLDSPFVEKEYGVKPEQLPDYWGLXXXXXXXXXXXXXXXXXXX
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDMYEHHNVDDEQFISLKAIMGDLGDNIRGVEGIGAKRG
RNH_BPT4        ILIISSDGDFTQLHKPNVKQWSPMHKKWV-------KIKSGSAEICMTKILKGDKKDNVASV--------
FEN_SULTO       -------------------VYVEIKPELIELDTLLKKLGLTREQLIDIGIIVG-TDYNPDGIKGYGVKTA
FEN_METKA       -----------------------VKPEIMRLEDVLDQLGLSREQLVDLAILLG-TDYNPDGVPGIGPKRA
FEN_METST       WAVVSQDYDCLQIRXXXXXXXXXXXXELISLEKTLKELNLTREQLVDVAMLVG--TDFNKGVYGIGAKKG
RAD2_YEAST      --IITDDSDVFLF--GGTKIYKNMKNEFYDAESILKLLGLDRKNMIELAQLLG--SDYTNGLKGMGPVSS
FEN_METTP       ----------------------PRKNIYIDPEVIITRLGISREQLIDIGIMCG--TDYNRGLPKVGPKRA
FEN_IGNH4       ----------------------PNKNVYVEPEEITLKLGITREQLVAIAVLIG--TDYTPGVKGVGPKTA
FEN_THENV       ----------------------------------------GREQLIDVAILLG-TDYNPDGVPGVGPQKA
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       NAVVSQDYDCLLFGAKRIRIAGTSRTINVNPEIILSNLGISREQLIYIGILTG--TDFNPGVKGIGAKTA
FEN_SULAC       ------------------------------------------EQLIDIAILIG-TDYNPDGVKGIGVKTA
FEN_PYRAR       ------------------------------------------EQLIDLAILLG-TDYNPDGVPGIGPQRA
FEN_PYRCJ       ----------------------------------------GREQLIDLAILLG-TDYNPEGVPGVGPQKA
FEN_NANEQ       -------------------IYVEVKPEVIELEAVLNYWKITREQLIAIAMLLG--TDYNEKVPGIGPKTA
EXO1_YEAST      QGIISEDSDLLVFRRLITKLNDYGECLEICRDNFIKKFPLGSEEIITMVCLSG--CDYTNGIPKVGLITA
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ------------------------------------------EQLIDLAILLG-TDYNPDGVPGVGPQKA
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ------------------------------------------EQLIDLAILLG-TDYNPDGVPGVGPQKA
FEN_KORCO       -------------------VYVDINPELIELESVLKRNGISREQLIMIGILVG-TDYNLGGVKGIGVKRA
FEN1A_ORYSJ     -------------------LMDPSSKKIPVMEFEVAKLELTMDQFIDLCILSG--CDYCDSIKGIGGQTA
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      -------------------------------EEVININGI-PLLLVDTAGIR--NTDDI--VENIGVEKS
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       -------------------IYMDVKPEVIELQEVLATLGLTREELIDMAILVG--TDYNPGIFKVGPKTA
SYP_HELHP       FKVVEAD---------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       -------------------VYVDVKPEIIILESNLKRLGLTREQLIDIAILVG--TDYNEGVKGVGVKKA
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       -------------------------------------------QLIDLAILLG-TDYNPEGIPGIGPQRA


                         .         .         .         +         .         .         .:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKNKLYK
DPO1_HAEIN      LGLLQGIGSMAEIYANLEKVAELPIRXXXXXXXXXADLSYTLATIKTDVELNVTTDQLLLGESQKDQLIE
DPO1_RICFE      SSLITQFGSVENIFNSLEQVSSLKQRETLQNSKEAALISWQLIGLDSNVDLDFQLNNLEWSPPNSDKLTG
DPO1_RICCN      SSLITQFGSVENIFNSLDQVSSVKQRETLQNSREAALISWQLIGLNSNVDLDFQLNNLEWSPPNSDKLTG
DPO1_PSEAE      XXXXXXYASLDKVPE--LPIRGAKGLPALEENREQAFLSYQLATIKTDVELDVEIDKLYPGEPQREALIA
DPO1_RICHE      SSLITQFGSVENIFNSLDQVSSVKQRETLQNSREAALISWQLIGLDSNVDLDFQLNNLEWSPPNSDKLTG
DPO1_ECOLI      XXXXXXXXXXDTLYAEPEKIAGLSFRGALEQNKEVAYLSYQLATIKTDVELELTCEQLEVQQPAAEELLG
DPO1_SALTY      XXXXXXXXXXDTLYAEPEKIAGLTFRGALAQNKDVAYLSYKLATIKTDVELELTCEQLEVQQPIADELLG
DPO1_RICPR      SSLITKFGSVENIFNSLDQISSIKQRKTLQNAREAALISWKLIGLDSNVDLDFDLNNLKWSPPNSKKLTG
DPO1_RICTY      SSLITQFGSVENIFNSLDQISSIKQRKTLQNSREAALISWRLIGLDSNVDLDFNLNNLEWSHPNSEKLIG
DPO1_ANATD      QKXXXXXXXXXXIYQNLDKIKSSIR-EKLEAGKDMAFLSKRLATIVCDLPLNVKLEDLRTKEWNKERLYE
DPO1_BORBU      XNLLREFKTLDGIYSNL-EIINKKHRELLIKEKENAFLSYELVSLEENLKIP-EIENFALKNFSEEIISL
DPO1_RHILE      AQLLEEYGDLDTLLERATEIKQVKRRETILANIDMARLSRDLVRLRTXXXXXXXXXXXXXEPQNGPKLIG
DPO1_BACCA      VKLLRQFGTVENVLASIDEIKGEKLKETLRQHREMALLSKKLAAIRRDAPVELSLDDIAYQGEDREKVVA
DPO1_BACSU      IKLLKQFDSVEKLLESIDEVSGXXXXXXXXXXXDQALMSKELATIMTDAPIEVSVSGLEYQGFNREQVIA
DPO1_BACST      VKLLKQFGTVENVLASIDEIKGEKLKENLRQYRDLALLSKQLAAICRDAPVELTLDDIVYKGEDREKVVA
DPO1_LACLA      LKLLQEFGSLENLYENVDSLKASKMKENLIADKEMAFLSQQLATINTKAPIEIGLDDTLLKGKKVDELSQ
DPO1_LACLM      LKLLQEFGSLENLYENVETLKASKMKDNLIADKEMAFLSQQLATINTKAPLEIGLEDTLLKEKNVAELGQ
DPO1_CHLAA      IALLKQFRSLDALLEQIDAAP--KRYQTLLEQAEAARFSRQLATIVTDVPVQLDLEAARIGVYDRSAVMA
DPO1_STRPN      IKLLLEHGSLEGIYENIDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGK
DPO1_SYNY3      IKLLAEYETLEKVYENLAQIK-GALKTRLDNGKDDAMHSQMLARIVVDVPLPVTWEDLQLTGLEKLELRT
DPO1_STRR6      IKLLLEHGSLEGIYENIDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGK
DPO1_RICBR      SSLITQFGTVENIFNSLEQVSSIKQRETLQNSKEAALISWQLIGLDYNVDMDFKLDALEWSPPDHNKLTE
DPO1_TREPA      AHLLHCFGTLDGIYRHTYSLKEALRTKIVCGKKD-AFFSRSLIELRDDVPCVFSLED-------------
DPO1_HELPJ      KELLQRLGSLEKIYENAKNLLSPKMYQALIQDKGSAFLSKELATLERGCIKEFDFENPLLKIKDELKEYG
DPO1_HELPY      KELLQRLGSLEKIYENAKNLLSPKMYRALIHDKASAFLSKELATLERGC-----IKEFDFLSCSENPLLK
DPO1_DEIRA      AKLLQEYGTLEKVYEHAGTLKPDGTRKKLLDSEENVKFSHDLSCMVTDLPLD---IEFGVRRLPDN----
DPO1_THEAQ      RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLE------------------
DPO1_THEFI      LRLLAEWGSVENLLKNLDRVKPDSLRRKIEAHLEDLHLSLDLARIRTDLPLEVDFKALRRRTPDLEGLRA
DPO1_THECA      LKLLKEWGSLENLLKNLDRVKPENVREKIKAHXXXXXXXXXXXXVRTDLPLEVDLAQG--REPDREGLRA
DPO1F_THETH     QRLIREWGSLENLFQHLDQVKPS-LREKLQAGMEALALSRKLSQVHTDLPLEVDFGRRRTPNLE--GLRA
DPO1T_THET8     LKLLKEWGSLENLLKNLDRVKPENVREKIKAHXXXXXXXXXXXXVRTDLPLEVDLAQG--REPDREGLRA
DPO1_MYCTU      AKWIAEYGSLRSLVDNVDAVR-GKVGDALRANLASVVRNRELTDLVRDVPLAQTPDTLRLQPWDRDHIHR
DPO1_MYCBO      AKWIAEYGSLRSLVDNVDAVR-GKVGDALRANLASVVRNRELTDLVRDVPLAQTPDTLRLQPWDRDHIHR
DPO1_MYCLE      AKWIVDYGSLQGLVDNVESVR-GKVGEALRTHLASVVRNRELTELVKDVPLVQTSDTLRLQPWDRDRIHR
DPOLN_MOUSE     ----------------------------------------------------------------------
EX53_AQUAE      INILKKYGSVENILKNWEKF----QREFPRAKKEDLELSYKLVKLYTDLDIELSEEDLKIKRPDLN----
DPOLN_HUMAN     ----------------------------------------------------------------------
DPOL_BPSP1      ----------------------------------------------------------------------
DPOL_BPT5       ----------------------------------------------------------------------
DPO1_AQUAE      ----------------------------------------------------------------------
DPOLQ_HUMAN     ----------------------------------------------------------------------
EX53_BACSU      YKLIREYETIDRLLENLSLLPKGQQ--------------GKIQQGLSDLEMSRKLAEIH-----------
EX53_BUCBP      LILLKTFGSLENIYNNIEKIPKIKKAKTIYNNKKLAFLSQKLATIKTDINVNITTKKIKMLPPCTTEISN
EX53_UREPA      INLLLKYDNIENIYTNLEKIAPSVKNK-LIEHKDMAFLSKKLAAIQTDLLFDEKLENFVLKPYNTQELDE
EX53_BUCAP      LFLLKKFSXXXXXXXQSLPFRNAKNAAIQLKNKKTAFLSYQLAKIKLDVPINITSEEITLKKTCFKKLSN
EX53_BUCAI      LFLINKFSXXXXXLRNAKNISIQ-----LKNNKERALLSYKL----------------------------
XNI_SHEPA       VELLRIYRSLASIYNSIDKVKQAKKLEA---GKQMARLSYKLVQLKTDMPLSVNLKQFRIKKPD------
XNI_SHEPW       VELLKIFRSLANIYSSIEQV-GSKQAKKLEAGKHLARLSYKLVQLQLDMPLNANLKQFRLPK--------
XNI_COLP3       AKLLNQYGSLKAILE-ATDLK-DSLAEKLTQSLEQMDLARKLLTLKQDIPLGFNLKDIRL----------
XNI_SHESH       IELLRTFRSLANIYASLDKIKQAKKLEA---GKQMARLSYKLVQLQTDIPLNINLSQFRL----------
EX53_BACHD      LPLIQQYGTIETLYEQIEDLKYKRYHKKLVAGEESVIISKELATI-------------------------
XNI_SERP5       VLLLQQAGSLDGLYQDLEQVPE-KWRGKLEQHREMAYVSKRVATLRTDLALTGNLQQLRL----------
XNI_SHEHH       VELLKIFRSLANIYNSIDKV-GSKQAKKLEEGKQMARLSYKLVQLQTDLPLNVNLKQFRIEQ--------
XNI_SHEFN       ADLLNKFRTLANLYRSLDNLGA-KQALKLAEGKEIARISYKLAQLQCDIPLNINLKQFRINPI-------
XNI_SHEDO       ADLLNKFRTLANIYNSLDNLGA-KQAQKLAEGREMARISYKLGQLQCHMPLEINLKQFRVKK--------
XNI_SHEB9       AELLKTFRSLPTLFSSLSNLGA-KQAKKLAEGKEMARLSYKLAQLQTDLPLNINLKDFRV----------
EX53_STRCO      AKLLAEFGDLQAAVDDPKARLTPTQRKRLTEAGPYLAVAPKVVRVAADVPL-------------------
XNI_SHEB8       AELLKTFRSLPTLFSSLSNLGA-KQAKKLAEGKEMARLSYKLAQLQTDLPLNINLKDFRV----------
XNI_SHEB5       AELLKTFRSLPTLFSSLSNLGA-KQAKKLAEGKEMARLSYKLAQLQTDLPLNINLKDFRV----------
XNI_SHEB2       AELLKTFRSLPTLFSSLSNLGA-KQAKKLAEGKEMARLSYKLAQLQTDLPLNINLKDFRV----------
XNI_TOLAT       QQLLSEYGTLTQLLD--ADATDNKKLQLVQQHREVCLLAQELVRLKDDIPLGFNLKD-------------
XNI_SHESA       AELLRTFRTLAALFSSLPNLGA-KQAKKLAEGRDMARLSYKLAQLQIDLPLNINLKDFRV----------
XNI_SHEPC       AELLKTFRTLSTLFSSLPNLGA-KQAKKLAEGKEMARLSYKLAQLQTDLPLNINLKDF------------
XNI_SHESW       AELLKTFRTLSTLFSSLPNLGA-KQAKKLAEGKEMARLSYKLAQLQTDLPLNINLKDF------------
XNI_ENTS8       TQLINDFGTLEALYERLDDV-PDKWRKKLEAHRESAFVCRAVATLKTDLQLDGNLQQLRL----------
XNI_SHEWM       SELLKIFRSLSNLYGSLEQVGA-KQAKKLEEGKQMARLSYKLVQLQTEIPLNANLSQFRL----------
XNI_PHOLL       ATLLQQAGTLDNLFQHLDQ-QPEKWRNKLESNQEIAFISREVASLRTDLALKGNLQQLRL----------
XNI_ESCF3       TQLLVEFQSLEGIYENLDAVAE-KWRKKLEMHKEMAFLCRDIARLQTDVHIDGNLQQLRLKR--------
XNI_SODGM       AQLISEAGTLEALYQRLAQLPE-KWRHRLEHDRDLAFLCRRIVTLDTAVTLQGNLQQLRLR---------
XNI_KLEP7       AQLLNEFQDLEGLYARLAEVPE-KWRKKLAAHQEMAFTCREVARLQTDLQLDGNLQQLRLTR--------
XNI_KLEP3       AQLLNEFQDLEGLYARLAEVPE-KWRKKLAAHQEMAFTCREVARLQTDLQLDGNLQQLRLTR--------
EX53_MYCPU      XNLLNNFKSLEKIFDSLENLISKAQKQKIRDGKEQALFLKKIVTLNKEVPMKLEKELF------------
XNI_PSYIN       LSLLQQYGSLNNIFQQAED-SNNKLLTKIKSQQSNAILAKQLVTLKTDIKLGFNLKD-------------
XNI_PSEHT       QLLVNNYSSVEDALND--DALSASLRKKLTENMDMYVISKQLVSLRTDINLGFSLKQLRL----------
XNI_SHIFL       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SHIF8       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SHISS       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SHIDS       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SHIBS       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SHIB3       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOSE       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOLU       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOLI       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOL5       TQLLVEFQSLEGIYENLDAVAE-KWRKKLENHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOHS       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECODH       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOBW       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECO8A       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECO57       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECO55       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECO27       TQLLVEFKSLEGIYENLNAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECO24       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOUT       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOL6       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECOK1       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_ECO81       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDMHIDGNLQQLRL----------
XNI_ECO45       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_PECCP       AQLLQQAGSLEALYQQLDGVPE-KWRKKLEQHKEMALVSRQIATLRTDLTLNGNLQQLRL----------
EX53_MYCTU      ATLLARHGSLDQIMAAADDRK-------------------------------------------------
DPOL_BPML5      ----------------------------------------------------------------------
DPOL_BPMD2      ----------------------------------------------------------------------
XNI_ERWCT       AQLLQQAGNLEALYQQLDAVPE-KWRKKLEQHKEMALISRQVATLRTDLTLNGNLQQLRL----------
XNI_VIBPA       KEILTQFEDIEAAY--ASDELAPKYRKKLDEHIESARLCKRVAALKCDIELGFNLQD-------------
XNI_ECO7I       TQLLVEFQSLEGIYENLDAVAE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_AERHH       TQLLQQYGDLASLLAACQQEDAAKALLKLRQHQDEXXXXXXXXXXXXDIPLGFNLRE-------------
XNI_ALISL       LEILTQFPTIEAA--NESDELPKKYRKKFDEYYNTAILCRKVAGLRTDIELGFNLQDIRYEK--------
XNI_SALG2       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALEP       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALDC       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALTY       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALPB       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALNS       TQLLIQFQNLEGIYAHPDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALHS       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALA4       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_AERS4       TQLLQQYGSLSALLAACQQEEASK----------------------------------------------
XNI_SALTI       TQLLVQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SALSV       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLEMHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALPK       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_SALPA       TQLLIQFQNLEGIYAHLDEVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRL----------
XNI_CITK8       TQLLVQFQTLEGIYAHLDEVAE-KWCKKLEAHKEMAFLCRDIARLQTDLHIDGNLQQLRLTR--------
XNI_VIBHB       KEILTQFEDIEAAY--ASEELVPKYRKKLDEHIESARLCKRVAALKCDIDLGFNLQD-------------
EX53_MYCPN      XDLLKQYGTIDNIFANFD--KLSKALQTILQGQDTAKKFSFLASIKTDIKLNDDIVHAALKPIDKQALLE
XNI_YERE8       XXXXXXXXXXXXXXXXXDSVPE-KWRKKLQQHQEMAFICKQIATLKTDLPLSGNLQQLRLNR--------
XNI_SHESR       XXXXXXXXXXXXXXSSLSNLGA-KQAKKLAEGRDMARLSYKLAQLQTDLPLNINLRDFRV----------
XNI_SHESM       XXXXXXXXXXXXXXSSLSNLGA-KQAKKLAEGRDMARLSYKLAQLQTDLPLNINLRDFRV----------
XNI_VIBFM       LEILTQFPTIEAA--NESEDLPKKYRKKFDEHYETAILCRQVAGLRTDIELGFNLQDIRYEK--------
XNI_SALPC       TQLLIQFQNLEGIYAHLDKVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_SALCH       TQLLIQFQNLEGIYAHLDKVPE-KWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLAR--------
XNI_VIBF1       LEILTQFPTIEAA--NESEDLPKKYRKKFDEHYETAILCRQVAGLRTDIELGFNLQDIRYEK--------
XNI_YERPY       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_YERPS       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_YERPB       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_YERP3       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_YERPP       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_YERPN       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_YERPE       XXXXXXXXXXEVLYQNLESIPE-KWRKKLQQHQQMAFTCKQIATLKTD----------------------
XNI_VIBSL       KEILTTYPDIETAF--LAEDLPKKYRKKFDEHIESARVCKLVSALKTDIDLGFNLQDIRYEAV-------
XNI_SHEAM       SELLRTYRSLANLYHSLGTL-GSRQANKLREGRDMARLSYKLAKLQTELPLHLKLSDLRV----------
XNI_EDWI9       AALLKEFGSLEALYQHLAQVPE-RWRQRLTEQREMAEICRRVATLQTDLALHGNLQQLRL----------
XNI_VIBVY       KEILSQFDDIEQ----------------------------------------------------------
XNI_VIBCH       KEILNQFSSIEEAY--ASPELPAKYRKKLDPHIEMARICKQVSALKTDIELGFNLQD-------------
XNI_YERPA       XXXXXXXXXXEVLYQNLESIPECQRR--------------------------------------------
XNI_VIBVU       KEILSQFDDIEQ----------------------------------------------------------
EX53_MYCGE      XELLQQYGTIDNIY-TXXXXXXXXXXXXXXXXKEIAKTFSFLAKIKTDIELDQNIDLTGLKPIQKQALIQ
XNI_SHELP       CELLKTFRTLANVYASLDKIGA-KQAKKLEEGRALARLSYKLVQLQTDIPLNTRLANFRVE---------
XNI_SHEON       XXXXXXXXXXXXXXSSLPNLGA-KQAKKLAEGRDMARLSYKLVQLQTDLPLNINLRDFRVNSPTK-----
XNI_PHOPR       LELLSLYPDLDTILQ--AEDLPTKWQKKITKHRESAEASKKVASLKTDLTLGFNLQD-------------
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       YNIIREFGNVLDIID-------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       YRIIKKYGSLEKAIEKGEKIKVNFNVEEIRS------------LFLKPQVVEPK-ENLELVDCDSNKILD
FEN_METKA       LQLIRKYGSLDELKDT--DIWPKIERHLPVEEKLRRLFLEPEVTLDWDEPDEEGLVEFLVEERD------
FEN_METST       IKLIHKYGTLEKALESLNE---------------------------------------------------
RAD2_YEAST      IEVIAEFGNLKNFKDWYNNGQFDKRKQE-TENKFEKDLRKKLV---------------------------
FEN_METTP       LKLIREHGCLEAVLDALGESIENFR---------------------------------------------
FEN_IGNH4       LRYVKSYGDLERVL--------------------------------------------------------
FEN_THENV       LKLVLEFGSLEKMLD------------TVLRGVSFPVDPLEIKRFFLNPPVTEEY-ALELKNVDERGLVN
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       LSLIKKYNDIYSVIDNLDEI--------------------------------------------------
FEN_SULAC       LRIIKKYNNIENAIEKG-EIQLSK------INFDIREIRKLFITPEVKKPTER-----------------
FEN_PYRAR       LKLIWEFGSLEKLLD-------------------------------------------------------
FEN_PYRCJ       LKLIWEFGSLEKLLQTVLKVDPLKIREFFLNPPVTDQYSTELST-----PDERKIVELLVEEHD------
FEN_NANEQ       IEIVKRFGDPIKVIENGKEIFEFFLNPPVIDKPNKELIFKILVEEHDFNPVERAIEEKALNKINQKTLFS
EXO1_YEAST      MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVF--CPIRKKI-------VSLNEIPL
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       LKLVWEFGGLEKML------------ETVLRGVYFPVDPLEIKKFFLNPPVTDEYST-DIKKPDEQKLID
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       LKLIWEFGSLEKLLE-------------------------------------------------------
FEN_KORCO       LELVKKYKRPEDL---------------------------------------------------------
FEN1A_ORYSJ     LKLIRQHGSIESILENI-----NKDRYQIPEDEARRLFKEPNVTLKWNAPDEEGLVEFLVKEFNQDRVTK
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      KELINSADLILYVIDTSREIDEEDFRIYDIINTDKVIDIKKEINLSKFPKIEKWIEISALSKLGENEIYK
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       LKLVKKHGNMPAILDELGQTIEN-----------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       LNYIKTYGDIFRALDHVEEIR-------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       LRLIQEYGSLDKLLKNAQPVDPFKIREFFLNPPVTQEVNVKFKEPNEDEVVRLLVEEFSQDRV-KNALER


                         .         *         .         .         .         .         +:350
query           FLREMEFNRLLSSVISAYGEPLLXXXXXXXXXXXXHQNISKKNYHLITNEKEIDEWINEAEEAGELAIDT
DPO1_HAEIN      YFARYEFKRWLNEVMNGADQPVMNQYKATSQDQSAVENIDRTKYETLLTQADLTRWIEKLNAAKLIAVDT
DPO1_RICFE      FLQEYGFKSLYKRA-----ENLFDIKINDHKEIVENKVTEAKE---ISNASELADFAKKAEKIGIFGI--
DPO1_RICCN      FLQEYGFRSLYKRV-----ENLLDIKINDHKEIADSKVTEIKE---LNNANELADFAKEATKIGIFGI--
DPO1_PSEAE      LYRELEFKNWLDDLLRXXXXXXXXXXXXTPIQ-------AEVDYDVVLDQAGFDAWLKKLEEAELIAFDT
DPO1_RICHE      FLQEYGFRSLYKRAENLFDIKI-----------NDHKDIVDNKVKEISNKLELENFAKDAEKIGIFGI--
DPO1_ECOLI      LFKKYEFKRWTADVEAGKWLQXXXXXXXXXXQETSVADISYDNYVTILDEETLKAWIAKLEKAPVFAFDT
DPO1_SALTY      LFKKYEFKRWTADVESGXXXXXQETVVIDESPSEPAAALSYENYVTILDDVTLESWIEKLKKAPVFAFDT
DPO1_RICPR      FLQEYGFKSLYKRV-----ENLFDIKINDHEEIVDNKVTEAKE---ISNASELANFAKEAERIGIFGI--
DPO1_RICTY      FLQKYGFKSLYKRVENLF--------------------YIKINDH----EEIVDNKVTEAKEISN-ASEL
DPO1_ANATD      ILVQLEFK----SIIKRLG----------------------------LSEVVQFEFVQQRTDIP----DV
DPO1_BORBU      FEKHSAI-----ALIKTYKKDILKQEKENADQKSLFKQEPTTNYRSITTKIELDDLIESLKKAKYISIDT
DPO1_RHILE      FLKTMEFTTLTRRVAEA--------------------------YVTIRDLVTLDRWIADARATGLVAFDT
DPO1_BACCA      LFKELGFQSFLXXXXXXXXXXXXX--------------LAKMAFTLADR-------VTEEMLADKAALVV
DPO1_BACSU      IFKDLGFNTLLERLGEDSAEA---------EQDQSLEDINVKTVTDVTSDILVSPSAFVVEQIGD-----
DPO1_BACST      LFQELGFQSFLDKMAVQTDEG---------------------EKPLAGMDFAIADSVTDEMLADKAALVV
DPO1_LACLA      FYDEMGFAQFKSKLLAEAGGE-------------------------VTDEKVVDEIDFEIVTDG--SISE
DPO1_LACLM      FYDEMGFSQFKSKLLADGGGEVTD------------ETVSEEKFEIVTDKSSV------ASVNADDFFYL
DPO1_CHLAA      LFQELEFGKKLPSVVQXXXXXXXXXXXXXXXXXXXQPTAEPPPVTIVRDATALADLVSRLRNAPAFAFDT
DPO1_STRPN      FYDEMGFKQLKQAL-----------------------NVSSADVSESLDFTIVDQ-ISQDMLSEESIFHF
DPO1_SYNY3      FIDKIQFHRNFSDNQSPVGEPXXXXXXXXXXXXVNSQQLSLFDGVPVVNQEDVEELKKHTDADFPVAWDT
DPO1_STRR6      FYDEMGFKQLKQALNMSSADVA--------------EGLDFTIVDQISQDMLSEESIFHFELFGE-----
DPO1_RICBR      FLHEYGFKSL------------------------------------------------------------
DPO1_TREPA      ---------------------------------------SAGHYRGVTDPVELKRIIDCACANGVVAFDC
DPO1_HELPJ      FISTLR--DLENSPFIVENVPILNSTPILDNTPALDNAPKKSRMIVLESAEPLSMFLEKLENPNRLVLDK
DPO1_HELPY      IKDELKEYGFISTLLENSPTPLILDNAPLLDNTPALDNTPKKSCMIVLESAALSAFLEKLEKTNRLVLDK
DPO1_DEIRA      ----------------------------------------------------------------------
DPO1_THEAQ      ----------------------------------------------------------------------
DPO1_THEFI      FLEELEFGSLL-----------------------------------------------------------
DPO1_THECA      FLERLEFGSLL-----------------------------------------------------------
DPO1F_THETH     FLERLEFGSLL-----------------------------------------------------------
DPO1T_THET8     FLERLEFGSLL-----------------------------------------------------------
DPO1_MYCTU      LFDDLEFRVLLFDTLAAAGGP-------------------------------------------------
DPO1_MYCBO      LFDDLEFRVLLFDTLAAAGGP-------------------------------------------------
DPO1_MYCLE      LFDNLEFRVLLFEALAAAGE--------------------------------------------------
DPOLN_MOUSE     ----------------------------------------------------------------------
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     ----------------------------------------------------------------------
DPOL_BPSP1      ----------------------------------------------------------------------
DPOL_BPT5       ------------------------------------------DYRPITDPDEAEEYIKMVYNMGPVAFDS
DPO1_AQUAE      ------------------------------------------DFEYVTGEEGLKKAIKRLENSPYLYLDT
DPOLQ_HUMAN     ----------------------------------------------------------------------
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      FFLHYKFNKLL-----------------------------------------------------------
EX53_UREPA      LFTSLKINNM------------------------------------------------------------
EX53_BUCAP      LIRWYSFN--------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      -----------------------------------------------------------------LAVDT
DPOL_BPMD2      -----------------------------------------------------------------LAVDT
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      LL--------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      LLSENKINTLV-----------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ILKTHDFN--------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       FL--------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       F---------------------------------------------------------------------
EXO1_YEAST      YLKDTESKR-------------------------------------------------------------
PP1R7_MOUSE     ----------------------------------------------------VDRGAEDPEEEHELAVDM
FEN_PYRIL       FLREHDFDRVLKAV--------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     AIEKIKFAKNKSS---------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      YI--------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       LRKSM-----------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
DPO1_HAEIN      ETDSLDYMSANLVGISFALENGEAAYLPLQLDYLDALEKSTALAAIKPILENPNIHKIGQNIKFDESIFA
DPO1_RICFE      ---YLLQHKGDNVALILSLQ-NQSYIIKISNTSHDLFSYNTKNNNIFNLLTDKSIRKITYSLKPLLKFYA
DPO1_RICCN      ---YLLQHKGANLAFILSLQ-NQSYIIKISNTSHDLFSYNTKSNNIFNLLTDKSIKKITYSLKPLLKFYA
DPO1_PSEAE      ETTSIDAQQAQVVGVSFAVKEGEAAYVPLAHSYMGVLDRDAVLRAXXXXXXXXXXXXVGQHAKYDINVLA
DPO1_RICHE      ---YLLQHKGDNLAFILSLQ-NQSYIIKISNSYNAKNNNDWFSDIIFNLLADKSIKKITYSLKPLLKFYA
DPO1_ECOLI      ETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERAXXXXXXXXXXXXXXXVGQNLKYDRGILA
DPO1_SALTY      ETDSLDNIAANLVGLSFAIEPGVAAYVPVAHDYLDAISRQRAXXXXXXXXXXXXVRKVGQNLKYDRGVLQ
DPO1_RICPR      ---YLLQQKGENRALILSLQNQSXXXXXXXXXXXXXXXXDWFSHIILNLLTNKSIKKITYSLKHLLKFYA
DPO1_RICTY      ENFAKEAEKIGIFGIYLLQQKGNNCALILSLQNQSYIIKITNIKNILNLLTNKSIKKITYSLKHLLKFYA
DPO1_ANATD      EQKELESSQIRSKEIPLMFVQGEKCFYLYDQE------SNTVFITSNKLLIEEILKSDTVKIMYDLKNIF
DPO1_BORBU      ETSSLDTYTAKLIGISISFKEFEGYYIPIEAKGKIYIEKNYIIQKFNNLFESNP-KIIGQNYKFDYKILK
DPO1_RHILE      ETTSLDAMQAELVGFSLATKI-RAAYVPLVHKNXXXIPMRDALPRLKALLEDESVLKVAQNLKYDYLLLK
DPO1_BACCA      EVVEENYHDAPIVGIAVVNEHGRFF-----------LRPETALAQFVAWLGDETKKKSMFDSKRAAVALK
DPO1_BACSU      -----NYHEEPILGFSIVNETG-AYFIPKDIAVESEVFKEWV--------ENDEQKKWVFDSKRAVVALR
DPO1_BACST      EVVGDNYHHAPIVGIALANERGRFF-----------LRPETALADPKFLLGDETKKKTMFDSKRAAVALK
DPO1_LACLA      KVNADDFFYLETLGENYHRE--QIVAFAWGNAEK------IYVSKNIDLLTKMKFPENTYDFKKNRVLLS
DPO1_LACLM      ETLGENYHREQIVAFAWGNS------------------EKIYVSKNLDLLTEMKFPENTYDFKKNRVLLS
DPO1_CHLAA      ECTSLQPVASDLVGISIAIAPDTVCYIPVGHQSETQVPCGEVVTALAPFFANPQQPKFAHNAKFDMEVLA
DPO1_STRPN      ELFGENYHTDNLVGFVWSC----------GDKLYATDKLELLQDPIKDFLEKTSLRVY--DFKKVKVLLQ
DPO1_SYNY3      ETDSLDPLVANLVGIGCAQEPNQVAYIPLKHHQGEQLSLGIIKDLLGEILGNAIYPKVLQNAKFDRRVLA
DPO1_STRR6      -----NYHTDNLVGFAWSC----------GDQLYATDKLELLQDPIKDFLEKTSLRVY--DFKKVKVLLQ
DPO1_RICBR      ------------------------------------------------LLTDQSIKKITYSLKPLLKFYA
DPO1_TREPA      ETDGLHPHDTRLVGFSICFQEAEAFYVPLVETEKECTEQQAVMHQLRRLWNDETLTLVMHNGKFDYHVMH
DPO1_HELPJ      DKKIL-ALAFLLQDQGYFLPLEEALFSPFSNAFSQMLQHACIIHDLKPLLSFLKAK-------------Y
DPO1_HELPY      EKKVLAAFLYEDQGYFLPLE--EALFSPFSLEFKMLQHAQIIGHDLKPLLSFLKAK-------------Y
DPO1_DEIRA      ----------------------------------------------------------------------
DPO1_THEAQ      ----------------------------------------------------------------------
DPO1_THEFI      ----------------------------------------------------------------------
DPO1_THECA      -----------------------------------------------PLAGLKDLKEVRGLLAKDLAVLA
DPO1F_THETH     ----------------------------------------------------------------------
DPO1T_THET8     ----------------------------------------------------------------------
DPO1_MYCTU      ----------------------------------------------------------------------
DPO1_MYCBO      ----------------------------------------------------------------------
DPO1_MYCLE      ----------------------------------------------------------------------
DPOLN_MOUSE     ----------------------------------------------------------------------
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     ----------------------------------------------------------------------
DPOL_BPSP1      ------SQQPKIVGIGLSDRSGYGCAIPLYHR-ENLMKGNTIVKFLRKLLEREDLEFIAHNGKFDIRWLR
DPOL_BPT5       ETSALYCRDGYLLGVSISHQEYQGVYID-----SDCLT-EVAVYYLQKILDSENHTIVFHNLKFDMFYKY
DPO1_AQUAE      ETTG-DRIRLVQIGDEENTYVID-------------LYEIQDIEPLRKLINERGI--VGHNLKFDLKYLY
DPOLQ_HUMAN     ---------------------------------------------------------------YDFIQSY
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      ETTGLDIYSDTFECVQFGTQ-DEAWVVPVELGDVFIEDVRIAIGALK--------RMVLQNASFDLQVLD
DPOL_BPMD2      ETTGLDIYSADLVQFGTQT---ESWVLPI--EDLEMLGREEVHEAL-----DVLNKIVMQNASYDLQVLD
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ------------------------------HKNHVGIKTEKELLSLPMEFEHKSENKLSEDIS-EYISL-
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     ETINLDAEDVDLT----HYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELD---------LY
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ------------------------------------------------------------NKNFDISNKY
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ------------------------CLTTIGHFGFECLPNQLVSRSIR------------QGFTFNILCVG
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
DPO1_HAEIN      RHGIELQGVEDTMLLSYTLNS-TGRHNMDDLAKRYLGHETIAFESLAGKGKSQLTFNQIPLEQATEYAAE
DPO1_RICFE      EQSHEITAIEDLELMQYALSAGLSQKNLEALKEDHLSKPAYSVREDASTGSTSKLPLETKFGKMSNVINE
DPO1_RICCN      NQSHDITAIEDLELMQYALSAGLSQKNLEVLKETWIENIIIESAKIV------INF--------------
DPO1_PSEAE      NASTPIGVAYDTMLESYVLDSTATRHDMDSLALKYLGHSTIRFEDIAGKGAKQLTFDQIAIEQAGPYAAE
DPO1_RICHE      NQSHEITAIEDLELMQYALSAGLSQKNLEALKEDNTERSTAAYKSVASTGSTSKLPLEVEFGKRPIVINE
DPO1_ECOLI      NYGIELRGIADTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
DPO1_SALTY      NYGIELRGIADTMLESYILNSVAGRHDMDSLSDRWLKHKTITFEDIAGKGKNQLTFNQIALEEAGRYAAE
DPO1_RICPR      NQSHQITAIEDLELMQYALSAGLVQKNLFT--------KTLTKDNIINESARVINFIS------------
DPO1_RICTY      NQSHKITAIEDLELMQYTLSAGLVQKNLETLTKDNIINES---------AKIVINFIS------------
DPO1_ANATD      HQTNNIKNCEDVMIASYVLDSTRSSYELETLFVSYLNTDI----EAVKKDKKIVSVVXXXXXXXXXXXXI
DPO1_BORBU      NNGFNIPPYFDTMIAAYLIDTN-SKVSLDFLAEKYLMHKNIKYEDVI---QKNDNFANISLEMATSYSSE
DPO1_RHILE      RYGIETRSFDDTMLISYVLDAGTGAHGMDPLSEKFLGHTPIPYKDVAGSGKANVTFDLVDIDRATHYAAE
DPO1_BACCA      WKGIELCGVSFXXXXXXXXXXPAQGVDDVAAAAKMKQYEAVRPDEAVGKGAKRAVPDEPVL---AEHLVR
DPO1_BACSU      WQGIELKGAEDTLLAAYIINPGNSYDDVASVAKDYGLHIVSSDESVYGKGKRAVPSEDVLSEHLGRKALA
DPO1_BACST      WKGIELRGVVDXXXXXXXXXXXXXXXXXXXXXKMHQYEAVRSDEAVYGKGAKRTVPDEPTL---AEHLVR
DPO1_LACLA      HLDIELPLVKDAMLAKYLISTTED-NKISTIARLFNSGHLATDEEIFGKGTKIALPDDAVL---FEHLAR
DPO1_LACLM      HLNIELPLVKDAMLAKYLISTTED-NKISTIARLFDVGHLATDEEIFGKGTK-LALPDDEI--LFDHLAR
DPO1_CHLAA      GAGIKVSGLADTMIAAAML--GKRQGLKDAFYELKLPEPPTTIEDLIGRGNKQISFXXXXXXXXXXXXXX
DPO1_STRPN      RFGVDLQAPADIRLAKYLLSTVED-NEIATIASLYGQTYLVDDETFYGKGVKK---AIPEREKFLEHLAC
DPO1_SYNY3      HHGIELGGVVDTMLASYVLQPEETHNLTDLCRRYNLGLVALSYKDL--GLKKDQTIADLPLETAGQYCGL
DPO1_STRR6      RFGVDLQAPADIRLAKYLLSTVED-NEIATIASLYGQTYLVDDETFYGKGVKK---AIPEREKFLEHLAC
DPO1_RICBR      SRAQQITAIEDLELMNYALSAG--------LPQKNLFXXXXXXXXXXXXXXXXXGFID------------
DPO1_TREPA      RAGVFEHNIFDTMVAAWLLDPDRGTYGMDVLAASFFQIRTITFEEVVAKGQ---TFAHVPYECAVRYAAE
DPO1_HELPJ      QVPLENIRIQDTQILAFLKNPEKV--GFDEVLKEYLKEDLIPHEKIK-------DFKTKSKAEKSELLSM
DPO1_HELPY      QVPLENIRIQDTQILAFLKNPEKV--GFDEVLKEYLKEELIPHEKIKDFKTKA---------EKLELLSV
DPO1_DEIRA      ----------------------------------------------------------------------
DPO1_THEAQ      ----------------------------------------------------------------------
DPO1_THEFI      -----------------------------------------------------------------EDAAE
DPO1_THECA      REGLDLVPGDDPMLLAYLLDPS------NTTPE--------------GVARRYGG-------EWTEDAAH
DPO1F_THETH     ----------------------------------------------------------------------
DPO1T_THET8     ----------------------------------------------------------------------
DPO1_MYCTU      ----------------------------------------------------------------------
DPO1_MYCBO      ----------------------------------------------------------------------
DPO1_MYCLE      ----------DTALAAYLVRPGQRSFTLDDLSLRYLR------RELRAETPEQEQFSLLEVDKAIQTXXX
DPOLN_MOUSE     ----------DPRVAAWLIDPSDTAPSFEDLVAKHLE-KSI-------TVKPSSTFREASRNTLSQNVFM
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     ----------DPRIAAWLIDPSDATPSFEDLVEKYCEKSTVKVNSTYGNSSRNIVNQNVR---------E
DPOL_BPSP1      ASDIYLDSIWDTMLI-HIIDYRGERYSWSAWLETDMGGYDDALDGEKPKGEDEGNYDLIPWDILKVYLAD
DPOL_BPT5       HLGLTFDKLHDTMLQHYVLDERRGTHGLKSLADFELDKFKDDYCKAHKIKKEDFTYDLIPFDIMWPYAAK
DPO1_AQUAE      RYGIFPSATFDTMIASYLL--GYERHSLNHIVSNLLGYSMDKSYQTSDWGASVLS------DAQLKYAAN
DPOLQ_HUMAN     KIGISLESYEDPKVACWLLDPDSQEPTLHSIVTSFLPHELPLLEGMTSQGIQSLGLNAGSEHSGRYRASV
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      QCGIEMEGLWDTQILAKLVDAGGFGHSLEELAKFISEDQAENVKKLMATTKAKI-WSTIDLPEYLLYAGM
DPOL_BPMD2      RCGIKMESLWDTQILAKLVDAGGFGHSLEELAEFISKEQAENVKGLMAKLAKEHKWSTIDLPEYLTYAGM
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      KSGFRIVGQ---IFDNYIIVETKDRVY---IIDQHAAHERIRYEEL----KKELSLGEILFPLVIEVSEE
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     DNQINLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVXXXXXXXXXXXXLHQLQMLELGSNRIRAIE
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       RNILTLSEYDDIFLEKYINSNFSIKDIIESIRKLVILNKIIPIACGSSLKNKGIEFL---LDSIVNFLPS
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ------------------------------ISATNAPHYVVEEKKV--NSQKNIIFIDLSMPRNIEPSIK
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ETGIGKSTLIDTLFNTNLKD-NKSSH---FYSNVGLQIQTYELQELKLTVVETVGYGD-QIDKEASYQPI
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------RNQLTLDFALLRKVQHNTQTNRVQLNTQIKEFLLEKKNFQKASDEAAL
FEN_CALMQ       ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVF
DPO1_HAEIN      DADVTMKLQQALWLKLQEEPLVELYKTMELPLLHVLSRMERTGVLIDSDALFMQSNEIASRLTALEKQAY
DPO1_RICFE      SARIVAEFTSLYKQNLKDNKAFRLYSNIDLPICFILDKMEKIGIKVDANYLNQLSAEFGAEILKLEEEIF
DPO1_RICCN      -----IALYKQTIWELKDNKTFRLYSNIDLPICFILDKMEKVGITVDANYLKQLSAEFGTEILKLEEEIF
DPO1_PSEAE      DADVTLRLHQALWQKLEIPSLARVLTDIEMPLVPVLARIERNGALVDANLLGIQSRELGEKMVALERQAY
DPO1_RICHE      SARIVANFISLYKQNLKDNKAFRLYSDIDLPICFILDKMEKVGIKVDANYLKQLSTEFGAEILKLEEEIF
DPO1_ECOLI      DADVTLQLHKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
DPO1_SALTY      DADVTLQLHLKMWPELQQHKPLNVFENIEMPLVPVLSRVERNGVKIDPAVLHKHSEEITLRLAELEKKAH
DPO1_RICPR      -------LYKQTLLELQKNKAFRLYREIDLPTCFILDKMEKVGIKVDANYLNRLSDEFGTEILKIEEEIF
DPO1_RICTY      -------LYKQTLLALQKNKAFRLYREIDLPTCFILDKMEKIGIKVDANYLHQLSDEFGTEILKIEEEIF
DPO1_ANATD      D----------------LNSCQFLYENIERPLIPVLYEMEKTGFKVDRDALIQYTKEIENKILKLETQIY
DPO1_BORBU      DADITFRLFNIFTXXXXXXXXXXXMHEIEMPFNKVIIEMEENGIXXXXXXXXXXXXXXXXXXXAIENEII
DPO1_RHILE      DADVTLRLWLVLKPRLAAAGLTSVYERLERPLLPVLARMEARGITVDRQILSRLSGELAQGAARLEDEIY
DPO1_BACCA      KAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIY
DPO1_BACSU      IQSLREKLVQELENNDQLE----LFEELEMPLALILGEMESTGVKVDVDRLKRMGEELGAKLKEYEEKIH
DPO1_BACST      KAAAIWALEEPLMDELRRNEQDRLLTELEQPLAGILANMEFTGVKVDTKRLEQMGAELTEQLQAVERRIY
DPO1_LACLA      KIKVLALAKEKMMAELLENEQEHLLSDMELPLAEVLAKMEITGIAVSQNTLEEIGAENEEKLASLTREIY
DPO1_LACLM      KIRVLARAKEKMMAELIENEQEHLLSDMELPLAEVLAKMEITGISVSQNTLEEIGAENEEKLASLTREIY
DPO1_CHLAA      XXLYXXXXXXXXXXXXXAEPLHDLYYRVELPLIEVLTDMELTGIRLDQEYLRELGRHFAQRIADLVERIY
DPO1_STRPN      KLAVLVETEPILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAENELVIEKLTQEIY
DPO1_SYNY3      DCYATYLLASKLQKELQYPELKEILKEIEQPLEKILAAMEDRGIRIDCDYLQTLSQQLAENLLTIETAAY
DPO1_STRR6      KLAVLVETEPILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIVVKKETLLEMQAENELVIEKLTQEIY
DPO1_RICBR      -------LYQQTILELKDNKAFRIYKEIDLPVCFVIDKMEKAGIKVDANYLNQLSSEFGAEILKLEEEIF
DPO1_TREPA      DADITFRLYHYLKLRLETAGLLSVFETIEMPLLPILARMEEVGIFLRKDVVQQLTRSFSDLIQQYEHDIF
DPO1_HELPJ      ELNALKRLCEYFEKGGLEEDLLTLARDIETPFVKVLMGMEFQGFKIDAPYFKRLEQEFKNELNVLERQIL
DPO1_HELPY      ELNALKRLCEYFEKGGLEENLLSLAREIETPFMKVLMGMEFQGFKIDAPYFKRLEQEFKNELHVLERQIL
DPO1_DEIRA      -----------------------MYDEMEKPLSGVLGRMEVRGVQVDSDFLQTLSIQAGVRLADLESQIH
DPO1_THEAQ      ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
DPO1_THEFI      RALLSERLFQNLFPRLS-EKLLWLYQEVERPLSRVLAHMEARGVRLDVPLLEALSFXXXXXXXXXXXXVF
DPO1_THECA      RALLSERLHRNLLKRLQEEKLLWLYHEVEKPLSRVLAHMEATGVRLDVAYLQAXXXXXXXXXXXXXXXXX
DPO1F_THETH     ------------------------YEEVEKPLSRVLARMEATGVRLDVAYLQALSLXXXXXXXXXXXXXF
DPO1T_THET8     ------------------------YHEVEKPLSRVLAHMEATGVRLDVAYLQAXXXXXXXXXXXXXXXXX
DPO1_MYCTU      ----------------------------ELPVQRVLAKMESAGIAVDLPMLTELQSQFGDQIRDAAEAAY
DPO1_MYCBO      ----------------------------ELPVQRVLAKMESAGIAVDLPMLTELQSQFGDQIRDAAEAAY
DPO1_MYCLE      XXXXXXXXXXXXXXXXXXXXSTSLLGEMELPVQQVLADMEKAGIAADLRLLTELQSQFGDQIRDAAEAAY
DPOLN_MOUSE     NLKILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVMENHKIPVDKEEMERTSALLGARLKELEQEAH
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     NLKTLYRLTMDLCSKLKDYGLWQLFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAH
DPOL_BPSP1      DCDVTFRLSKYIPXXXXXXXXXXXXXXIMVPGYYTLLDIEMDGIHVDREWLEVLRVSYEKEISRLEDKMR
DPOL_BPT5       DTDATIRLHNFFLPKIKNEKLCSLYYDVLMPGCVFLQRVEDRGVPISIDRLKEAQYQLTHNLNKAREKLY
DPO1_AQUAE      DVIVLRELFPLKTRTAKIFDLKSPVAIVEMAFVREVAKLEINGFPVDVEELTNKLKAVERETQKRIQEFY
DPOLQ_HUMAN     ESILIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHIMQAKLDAIETQAY
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      DTIFTARVCK--SLTPLVPDVSRSLVPYEHKISEICSYIDRQGFLLDVEYSRSLAEKW-----LADQEVW
DPOL_BPMD2      DTVFTARICSALAP--LVPDVSRPLVPYEHKISEICSYIDRRGFLLDVEYSQQLADKWLG-----EQQVW
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      EKELLNK-----HKDL-LEKFAFSWEDFGPYHIRIIRFLKFDSKSIENLFQEIISDISEKDLSKLEDKII
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     NIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSLAKIEGLQLSNNGIEVIEGENNNKLTMLDIASN
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       PIDIGIKNVSNYSVNIKSKFLALLFKVFNDPYLGLLSFIRIYSGKIEGQIIFNNSKNIKEKIFRIIR-MF
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      EYHTLYTLEDLISKKLRQEKISTIQNLIETRIKKFLTWYKLQTVKDDILYIQNLAEKLYEEIEKLSKKI-
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     VDYIDAQFEAYLQEELKIKR--SLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKNIIPLIAKAD
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      QKALLIKRLRSFASKLQLQR-------------EALAIQKLEFDKRDEQ------QKSEINNAKLQLEQF
FEN_CALMQ       ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
DPO1_HAEIN      ALAGQPFNLASTKQLQEILFDKLELPVLQKTPKGAPSTNEEVLEELSYS-HELPKILVKHRGLSKLKSTY
DPO1_RICFE      ALSGTKFNIGSPKQLGEILFEKMQLPFGKASAKASYSTGAEILEKLSEHGYNIADLLLRWRQLTKLKNTY
DPO1_RICCN      ALSGTKFNIGSPKQLGEILFEKMQLPFGKASAKASYSTGAEILEKLSEHGYNIADLLLRWRQLTKLKNTY
DPO1_PSEAE      DLAGQEFNLGSPKQLGAILYDKLGLPVLSKTATGQPSTAEAVLAELAEQDFELPKVIMQYRSMSKLKSTY
DPO1_RICHE      ALSGTKFNIGSLKQLGEILFEKMQLPFGKASAKASYSTGAEILEKLSEHGYNIADLLLRWRQLTKLKNTY
DPO1_ECOLI      EIAGEEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALD-YPLPKVILEYRGLAKLKSTY
DPO1_SALTY      DIAGEAFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALD-YPLPKVILEYRGLAKLKSTY
DPO1_RICPR      ALSGTKFNIGSQKQLGEILFKKMQLPTLAKT--SSYSTRAGILKKLSEDGYHIATLLLRWRQLTKLKNTY
DPO1_RICTY      ALSGTKFNIASQKQLSEILFKKMQLPTLAKT--SSYSTKAGILKKLSEDGYHIATLLLRWRQLTKLKNTY
DPO1_ANATD      QIAGEWFNINSPKQLSYILFEKLKLPVIKKTKTG-YSTDAEVLEEL-FDKHEIVPLILDYRMYTKILTTY
DPO1_BORBU      KSIGIDFNLNSPKQMHEILFEKLNLKLPEKMKKDS--TDIKVLESLR-EQHESIENLIKYRQIAKLKSTY
DPO1_RHILE      VLAGERFNIGSPKQLGDILFGKMGLSGGSKTKTGQWSTSAQVLEDLAAAGFELPRKIVDWRQVTKLKSTY
DPO1_BACCA      ELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTG-YSTSADVLEKLA-PYHEIVENILQYRQLGKLQSTY
DPO1_BACSU      EIAGEPFNINSPKQLGVILFEKIGLPVVKKTKTG-YSTSADVLEKLADK-HDIVDYILQYRQIGKLQSTY
DPO1_BACST      ELAGQEFNINSPKQLGTVLFDKLQLPVLKKTKTG-YSTSADVLEKLA-PHHEIVEHILHYRQLGKLQSTY
DPO1_LACLA      DLAGEEFNINSPKQLGVILFEKLQLPVGKKTKTG-YSTAVDVLEDLAALSPVVAK-ILEYRQINKVQSTY
DPO1_LACLM      DLAGEEFNINSPKQLGVILFEKLQLPVGKKTKTG-YSTAVDVLEDLAALSPVVAK-ILEYRQINKVQSTY
DPO1_CHLAA      QQAGGPFNINSGQQLNDVLFGRLGIDPLSKLKSGGYSITAEVLEELS-QLYPIAADILTYRQLTKLKSTY
DPO1_STRPN      ELAGEEFNVNSPKQLGVLLFEKLGLPLTKKTKTG-YSTAVDVLERLAPIA-PIVKKILDYRQIAKIQSTY
DPO1_SYNY3      EAAGESFNLSSPKQLGTILFDKLGLDRKKSRKKTGYSTDHATLEKLQ-GDHPIIDAILEHRTLAKLKSTY
DPO1_STRR6      ELAGEEFNVNSPKQLGVLLFEKLGLPLTKKTKTG-YSTAVDVLERLAPIA-PIVKKILDYRQIAKIQSTY
DPO1_RICBR      VLSGMKFNIGSPKQLGEILFEKMQLPFGKTSAKASYSTGADILEKLSEQGYPIADLLLRWRQLTKLKNTY
DPO1_TREPA      SLAGHEFNIGSPKQLQTVLFQELHLPPGKKNTQG-YSTDHSVLKKLARK-HPIAEKILLFRDLSKLRSTY
DPO1_HELPJ      DLIGVDFNLNSPKQLGEVLYDKLGL-----PKNKSHSTDEKNLLKILDKHPSIP-LILEYRELNKLFNTY
DPO1_HELPY      ELIGVDFNLNSPKQLSEVLYDKLGL-----PKNKSHSTDEKSLLKILDK-HPSIALILEYRELNKLFNTY
DPO1_DEIRA      EYAGEEFHIRSPKQLETVLYDKLELASSKKTKTGQRSTAVSALEPLR-DAHPIIPLVLEFRELDKLRGTY
DPO1_THEAQ      RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
DPO1_THEFI      RLAGHPFNLNSRDQLERVLFDELGLTPVGRTEKGKRSTAQGALEALR-GAHPIVELILQYRELSKLKSTY
DPO1_THECA      XXAGHPFNLNSRDQLERVLFDELRLPALGKTQKGKRSTSAAVLEALR-EAHPIVEKILQHRELTKLKNTY
DPO1F_THETH     RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVDRILQYRELTKLKNTY
DPO1T_THET8     XXAGHPFNLNSRDQLERVLFDELRLPALGKTQKGKRSTSAAVLEALR-EAHPIVEKILQHRELTKLKNTY
DPO1_MYCTU      GVIGKQINLGSPKQLQVVLFDELGMPKTKRTKTG-YTTDADALQSLFDKGHPFLQHLLAHRDVTRLKVTV
DPO1_MYCBO      GVIGKQINLGSPKQLQVVLFDELGMPKTKRTKTG-YTTDADALQSLFDKGHPFLQHLLAHRDVTRLKVTV
DPO1_MYCLE      AVIGKQINLSSPKQLQVVLFEELGMPKTKRTKTG-YTTDADALQSLFCKTHPFLQHLLTHRDVTRLKVTV
DPOLN_MOUSE     FVAGEQFLIMSNNQLREILFGKLKLHLLSQRKQNQLSTSEAMLNSLQDL-HPLPKLILEYRQVHKIKSTF
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     FVAGERFLITSNNQLREILFGKLKLHLLSRTGLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHKIKSTF
DPOL_BPSP1      EFPEKEINFGSTKQLGELLFERMGLETVIFTDKGAPSTNDDSLKFMGSQS-DFVKVLMEFRKANHLYNNF
DPOL_BPT5       TYPEEAFNPNSVKQLRVLLFDYVGLTPTGKTDTGADSTDAEALNELATQ-HPIAKTLLEIRKLTKLISTY
DPO1_AQUAE      --IKYRVDPLSPKQLASLLTKKFKLN-LPKTPKGNVSTDDKALT--SYQDVEPVKLVLEIRKLKKIADKL
DPOLQ_HUMAN     QLAGHSFSFTSSDDIAEVLFLELKLPTLGSTRRGQFSTSKDVLNKLKAL-HPLPGLILEWRRITNAKVVF
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      EIAFTEYGVESTEDLAEGL-EEMGVKITGRTETGKRQVNAALLDKLVEDGNELAAIAQEAKKLGKWRKTW
DPOL_BPMD2      EVLLNEYGIEKVNATEDVAFEELGHKFTAFTDSGKRKVDKGFYADMIAAGGELAEMVQEAKKLGKWRTSW
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       ----------------------------------------------------------------------
DPOL_BPT7       ----------------------------------------------------------------------
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      K---------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     RIKKIE-NISHLTELQEFWMND------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ANSKKDLNIAS-----------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     TISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPF----------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      KLEKQNFDEAKQKQLIE-----------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
DPO1_HAEIN      TDKLPQMVNSQTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRNEEGRHIRQAFIAREGYSIVAADYSQIE
DPO1_RICFE      TDSLPKQIDNITHRVHTTFLQTSTTTGRLSSQEPNLQNVPIRSSEGNKIRQAFIAEEGYKLISADYSQIE
DPO1_RICCN      TDSLPKQIDNITHRVHTTFLQTSTTTGRLSSQEPNLQNVPIRSSEGNQIRKAFIAEEGYKLISADYSQIE
DPO1_PSEAE      TDRLPEQINPRTGRIHTSYHQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFVAPQGYKLLAADYSQIE
DPO1_RICHE      TDSLPKQIDNITHRVHTTFLQTSTTTGRLSSQEPNLQNVPIRSSEGNKIRQAFIAEEGYKLISADYSQIE
DPO1_ECOLI      TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
DPO1_SALTY      TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYLIVSADYSQIE
DPO1_RICPR      TDSLPKQINNITKRIHTTFLQTSTTTGRLSSQEPNLQNVPIRSSDGNKIREAFIAEEGYKLISADYSQIE
DPO1_RICTY      TDSLPKQINNITKRIHTTFLQTSTTTGRLSSQEPNLQNIPTRSSDGNKIRQAFIAEDGYKLISADYSQIE
DPO1_ANATD      CQGLLQAINPSSGRVHTTFIQTGTATGRLASSDPNLQNIPVKYDEGKLIRKVFVPEGGHVLIDADYSQIE
DPO1_BORBU      TDNLIELINYKTNRLHTSFIQTKTATGRITSINPNLQNIPIKDEKGRKIRKAFKPENGNIFISADYSQIE
DPO1_RHILE      TDALPGYVHPETKRVHTSYSLASTTTGRLSSSEPNLQNIPVRTAEGRKIRTAFISTPGHKLISADYSQIE
DPO1_BACCA      IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
DPO1_BACSU      IEGLLKVTRPDSHKVHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGRKIRQAFVSEKDWLIFAADYSQIE
DPO1_BACST      IEGLLKVVHPVTGKVHTMFNQALTQTGRLSSVEPNLQNIPIRLEEGRKIRQAFVSEPDWLIFAADYSQIE
DPO1_LACLA      VKGLIPQIADDGK-IHTRYVQDLTQTGRLSSVDPNLQNIPVRLEEGRKIRKAFVPSKDXXXXXXDYSQIE
DPO1_LACLM      VKGLIPQIADDGK-IHTRYVQDLTQTGRLSSVDPNLQNIPVRLEEGRKIRKAFVPXXXXXXXXXXXXXIE
DPO1_CHLAA      IDALPDLVNPRTGRIHTSYNQLGAATGRLSSNNPNLQNIPVRTEEGREIRRAFVAEPGWRFVAADYSQIE
DPO1_STRPN      VIGLQDWILADGK-IHTRYVQDLTQTGRLSSVDPNLQNIPARLEQGRLIRKAFVPEEDSVLLSSDYSQIE
DPO1_SYNY3      VDALPELVNGQTQRIHTDFNQAVTSTGRLSSSNPNLQNIPIRSDFSRQIRRAFLPQKDWLLVSADYSQIE
DPO1_STRR6      VIGLQDWILADGK-IHTRYVQDLTQTGRLSSVDPNLQNIPARLEQGRLIRKAFVPEEDSVLLSSDYSQIE
DPO1_RICBR      TDSLPKQIDNITRRIHTTFLQTSTTTGRLSSQEPNLQNVPIRSGEGNKIRQAFVAEQGYKLISADYSQIE
DPO1_TREPA      TESLAK-LADQTGRVHTSFVQIGTATGRLSSRNPNLQNIPIKSTEGRKIRQAFQATVGHELISADYTQIE
DPO1_HELPJ      TTPL-LRLKDKDDKIHTTFIQTGTATGRLSSHSPNLQNIPVRSPKGLLIRKGFIASKEYCLLGVDYSQIE
DPO1_HELPY      TTPL-LRLKDKDDKIHTTFIQTGTATGRLSSHSPNLQNIPVRSPKGLLIRKGFIASKEYCLLGVDYSQIE
DPO1_DEIRA      LDPIPNLVNPHTGRLHTTFAQTAVATGRLSSLNPNLQNIPIRSELGREIRKGFIAEDGFTLIAADYSQIE
DPO1_THEAQ      IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
DPO1_THEFI      LDPLPRLVHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRKAFVAEEGWLLLAADYSQIE
DPO1_THECA      VDPLPSLVHPNTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFVAEAGWALVALDYSQIE
DPO1F_THETH     IDPLPALVHPKTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFVAEEGWVLVVLDYSQIE
DPO1T_THET8     VDPLPSLVHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFVAEAGWALVALDYSQIE
DPO1_MYCTU      -DGLLQAVAADG-RIHTTFNQTIAATGRLSSTEPNLQNIPIRTDAGRRIRDAFVVGDGYALMTADYSQIE
DPO1_MYCBO      -DGLLQAVAADG-RIHTTFNQTIAATGRLSSTEPNLQNIPIRTDAGRRIRDAFVVGDGYALMTADYSQIE
DPO1_MYCLE      DGLL--NAVAADGRIHTTFNQTIATTGRLSSTEPNLQNIPIRTNAGRQIRDAFVVNNGYTLMTADYSQIE
DPOLN_MOUSE     IDGLLAYMKKGS--ISSTWNQTGTVTGRLSAKHPNIQGIPIKISKGKEERTLFVSSEGHTFLAADFSQIE
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     VDGLLACMKKGS--ISSTWNQTGTVTGRLSAKHPNIQGIPIQITTPKNFRAMFVSSKGHTFLAADFSQIE
DPOL_BPSP1      VSKLSLMIDPDNI-VHPSYNIHGTVTGRLSSNEPNAQQFPRKVNTPTEIKKMFNSRDGGVIVQFDYSQLE
DPOL_BPT5       VEKILLSIDADGC-IRTGFHEHMTTSGRLSSSGKNLQQLP---RDESIIKGCVVAPPGYRVIAWDLTTAE
DPO1_AQUAE      KE-LKEHLKNG--RVYPEFKQIGAVTGRMSSAHPNIQNIH------RDMRGIFKAEEGNTFVISDFSQIE
DPOLQ_HUMAN     PLQREKCLNPGMERIYP-VSQSHTATGRITFTEPNIQNVPPSQAVGKGLRHAFVPFPGGSILAADYSQLE
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      VQKFID-TRDSEDRCHTFINPLQARTSRMSITGIPAQTLP--SSDWI-VRRCFIAEPGDVMASVDYQAQE
DPOL_BPMD2      VQTFLD-TRDSEDRCHTFVNPLQARTSRMSITGIPAQTLPASDWT---VRRCFLADPGHVMASIDYQAQE
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
DPOL_BPT7       -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     ----------------------------------------------------------------------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
DPO1_HAEIN      LRIMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIYGMSAFGLSRQLGIS
DPO1_RICFE      LRILSHIANIDALKQAFINKDDIHTQTACQIFNLQKHELTSEHRRKAKAINFGIIYGISAFGLAKQLNVS
DPO1_RICCN      LRILSHIANIDALKQAFINKDDIHTQTACQIFNLQKHELTSEHRRKAKAINFGIIYGISAFGLAKQLNVT
DPO1_PSEAE      LRIMAHLAKDDGLLDAFRHDLDVHRATAAEVFGVPLEDVSGDQRRSAKAINFGLIYGMSAFGLAKQIGVE
DPO1_RICHE      LRILSHIANIDALKQAFINKDDIHTQTACQIFNLQKHELTNEHRRKAKAINFGIIYGISAFGLAKQLNVT
DPO1_ECOLI      LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
DPO1_SALTY      LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINFGLIYGMSAFGLSRQLNIP
DPO1_RICPR      LRILSHIANIDVLKQAFINKEDIHTQTACQIFNLKKHELTSEHRRKAKAINFGIIYGISAFGLAKQLNVS
DPO1_RICTY      LRILSHIANVDVLKQAFINKEDIHTQTACQIFNLQKHELTSEHRRKAKAINFGIIYGISAFGLAKQLNVS
DPO1_ANATD      LRILAHISEDERLISAFKNNVDIHSQTAAEVFGVDIADVTPEMRSQAKAVNFGIVYGISDYGLARDIKIS
DPO1_BORBU      LAILAHLSQDEVLIKAFENNKDIHTETASKLFKIEEKEITPNLRRIAKSINFGIIYRMSDFRLAKELGIT
DPO1_RHILE      LRVLAHVAEIPQLTKAFEDGVDIHAMTASEMFGVPVEGMPGEVRRRAKAINFGIIYGISAFGLANQLSIE
DPO1_BACCA      LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
DPO1_BACSU      LRVLAHISKDENLIEAFTNDMDIHTKTAMDVFHVAKDEVTSAMRRQAKAVNFGIVYGISDYGLSQNLGIT
DPO1_BACST      LRVLAHIAEDDNLIEAFRRGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYGLAQNLNIT
DPO1_LACLA      LRVLAHISGDEHLIDAFKHGADIHTSTAMRVFGIEAEDVTANDRRNAKAVNFGVVYGISDFGLARNLGIT
DPO1_LACLM      LRVLAHISADEHLIDAFKHGADIHTSTAMRVFGIEAEDVTANDRRNAKAVNFGVVYGISDFGLARNLGIT
DPO1_CHLAA      LRVLAHMSGDENLIAAFQQGLDIHAATASRLFGVEPTAVDKNQRRVAKTVVFGVIYGISAFGLAQRLGIE
DPO1_STRPN      LRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIERPDVTANDRRNAKAVNFGVVYGISDFGLSNNLGIS
DPO1_SYNY3      LRILAHLSQEPVLLQAYGDRQDVHGVTAKLLFGKE--DITPAERNLGKTINFGVIYGMGAQRFARETGIS
DPO1_STRR6      LRVLAHISKDEHLIKAFQEGADIHTSTAMRVFGIERPNVTANDRRNAKAVNFGVVYGISDFGLSNNLGIS
DPO1_RICBR      LRILSHIADIKALKQAFINKDDIHTQTACQIFNLQKEELTSEHRRKAKAINFGIIYGISAFGLAKQLNVS
DPO1_TREPA      LVVLAHLSQDRNLLNAFRQHIDIHALTAAYIFNVSIDDVQPAMRRIAKTINFGIVYGMSAFRLSDELKIS
DPO1_HELPJ      LRLLAHFSQDKDLMEAFLKGRDIHLETSKALFGEDLAK---EKRSIAKSINFGLVYGMGSKKLSETLSIP
DPO1_HELPY      LRLLAHFSQDKDLMEAFLKGRDIHLETSKALFGEYLAK---EKRSIAKSINFGLVYGMGSKKLSETLNIS
DPO1_DEIRA      LRLLAHIADDPLMQQAFVEGADIHRRTAAQVLGLDEATVDANQRRAAKTVNFGVLYGMSAHRLSNDLGIP
DPO1_THEAQ      LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
DPO1_THEFI      LRVLAHLSGDENLKRVFREGKDIHTETAAWMFGLDPALVDPKMRRAAKTVNFGVLYGMSAHRLSQELGID
DPO1_THECA      LRVLAHLSGDENLIRVFQEGKDIHTQTASWMFGVPPEAVDPLMRRAAKTVNFGVLYGMSAHRLSQELAIP
DPO1F_THETH     LRVLAHLSGDENLIRVFQEGRDIHTQTASWMFGVSPEGVDPLMRRAAKTINFGVLYGMSAHRLSGELSIP
DPO1T_THET8     LRVLAHLSGDENLIRVFQEGKDIHTQTASWMFGVPPEAVDPLMRRAAKTVNFGVLYGMSAHRLSQELAIP
DPO1_MYCTU      MRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGLAYGLSAYGLSQQLKIS
DPO1_MYCBO      MRIMAHLSGDEGLIEAFNTGEDLHSFVASRAFGVPIDEVTGELRRRVKAMSYGLAYGLSAYGLSQQLKIS
DPO1_MYCLE      MRIMAHLSRDEGLIEAFHTGEDLHSFVASRAFGIPIEDITPELRRRVKAMSYGLAYGLSAYGLATQLKIS
DPOLN_MOUSE     LRILAHLSGDPELLKLFQESEDVFSTLTSQWKDIPIERVTHMDREQTKKVVYSVVYGAGKERLAACLGVT
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     LRILTHLSGDPELLKLFQESEDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVP
DPOL_BPSP1      LRILVCYYSRPYTIDLYRSGADLHKAVASDAFGVAIEEVSKDQRTASKKIQFGIVYQESARGLAEGITMS
DPOL_BPT5       VYYAAVLSGDRNMQQVFINNEDFHSNIAHMVFKLDVKKLFPALRQAAKAITFGILYGSGPAKVAHSVNEA
DPO1_AQUAE      LRIAAEYVKDPLMLDAFKKGKDMHRYTASVVLGKKEEEITKEERQLAKAINFGLIYGISAKGLAEYVEIS
DPOLQ_HUMAN     LRILAHLSHDRRLIQVLNTGADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIK
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      LRVLAALSGDRNMIEAFENGADLHQMTADAA---------QVPRKVGKTANFQKVYGGGAKALAEAVGIS
DPOL_BPMD2      LRVLAALSGDRTMIQAFKDGADLHLMTARAAFGDHITKDDPE-RKYAKTVNFGRVYGGGANTVAEQTGIS
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       LRCLA------HFMARFDNGEYAHEILNGDIHTKNQMAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
DPOL_BPT7       LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     --------------------------------------------------------------ISKEFNIT
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
DPO1_HAEIN      RADAQKYMDLYFQRYPSVQQFMTDIREKAKAQGYVETLFGRRLYLPDINSSNAMRRKGAERVAINAPMQG
DPO1_RICFE      NGEASEYIKKYFAEYKGVQEYMEQTKAFASSNGYVINFFGRKCFVPLIHDK--KLKQFAERAAINAPIQG
DPO1_RICCN      NGEASEYIKKYFAEYKGVQEYMEQTKAFASSNGYVTNCFGRKCFVPLIHDK--KLKQFAERAAINAPIQG
DPO1_PSEAE      RKEAQAYIDRYFARYPGVLAYMERTRAQAAEQGFVETLFGRRLYLPEIHSKNGAMRKAAERTAINAPMQG
DPO1_RICHE      NGEASEYIKKYFAEYKGVQEYMEQTKAFASSNGYVTNFFGRKCFVPLIHDK--KLKQFAERAAINAPIQG
DPO1_ECOLI      RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGXXXXXXXXXXINAPMQG
DPO1_SALTY      RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLEGRRLYLPDIKSSNXXXXXXXXXXXXXXPMQG
DPO1_RICPR      NSTASEYIKQYFAEYKGVQEYMTQTKACASRNGYVTNFFGRKCFIPLIHDK--KLKQFAERAAINAPIQG
DPO1_RICTY      NGTAAEYIKQYFAEYKGMQEYMVQTKAYANRNGYVTNFFGRKCFIPLIHDK--KLKQFAERAAINAPIQG
DPO1_ANATD      RKEAAEFINKYFERYPKVKEYLDNTVKFARDNGFVLTLFNRKRYIKDIKSTNRNLRGYAERIAMNSPIQG
DPO1_BORBU      KEEAKGFINSYFDSYPKIKEFIINQINFVRNAGYSETILKRRRYIKEINSNNYLERSAAERIAINSIIQG
DPO1_RHILE      RSEAGDYIKKYFERFPGIRDYMESRKAMARDKGYVETIFGRRINYPEIRSSNPSVRAFNERAAINAPIQG
DPO1_BACCA      RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
DPO1_BACSU      RKEAGAFIDRYLESFQGVKAYMEDSVQEAKQKGYVTTLMHRRRYIPELTSRNFNIRSFAERTAMNTPIQG
DPO1_BACST      RKEAAEFIERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPIQG
DPO1_LACLA      RKDAKNYIETYFERYPGIKTYMENIVREARDKGFVETMSHRRRKIPDINARNFNVRGFAERTAINSPIQG
DPO1_LACLM      RKDAKNYIETYFERYPGIKTYMENIVREARDKGFVETMSHRRRKIPDINARNFNVRGFAERTAINSPIQG
DPO1_CHLAA      RDLARQLIDNLFAQFPGIRRYIDQTLEFGRQHGYVQTLFGRRRVMEDL-XXXXXXXXXXXXXXINAPIQG
DPO1_STRPN      RKEAKAYIDTYFERFPGIKNYMDEVVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQG
DPO1_SYNY3      AVEGREFIDRYHRTYAQVFDYLETMKLEAIAKGYVTTIVGRRRYFNFVTEALRQLRNYNDRSAANAPIQG
DPO1_STRR6      RKEAKAYIDTYFERFPGIKNYMDEVVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQG
DPO1_RICBR      NTEAAEYIKKYFAEYKGVQEYMEATKSFAQANGYVTDFFGRKCFVPLINDK--RLKQFAERAAINAPIQG
DPO1_TREPA      QKEAQSFIYRYFETYPGVYAFSTQVAEQTRKTGYVTSLAGRRRYIRTIDSRNTLERARAERMALNTQIQS
DPO1_HELPJ      LSEAKSYIEAYFKRFPSIKDYLNGMREEILKTSKAFTLLGRYRDFTGVND---YVKGNYLREGVNAIFQG
DPO1_HELPY      LNEAKSYIEAYFKRFPSIKDYLNRMKEEILKTSKAFTLLGRYRDFTGAND---YVKGNYLREGVNAIFQG
DPO1_DEIRA      YAEAATFIEIYFATYPGIRRYINHTLDFGRTHGYVETLYGRRRYVPGLSSRNRVQREAEERLAYNMPIQG
DPO1_THEAQ      YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
DPO1_THEFI      YKEAEAFIERYFQSFPKVRAWIERTLEEGRTRGYVETLFGRRRYVPDLASRVRSVREAAERMAFNMPVQG
DPO1_THECA      YEEAVAFIERYFQSFPKVRAWIEKTLEEGRKRGYVETLFGRRRYVPDLNARVKSVREAAERMAFNMPVQG
DPO1F_THETH     YEEAVAFIERYFQSYPKVRAWIEGTLEEGRRRGYVETLFGRRRYVPDLNARVKSVREAAERMAFNMPVQG
DPO1T_THET8     YEEAVAFIERYFQSFPKVRAWIEKTLEEGRKRGYVETLFGRRRYVPDLNARVKSVREAAERMAFNMPVQG
DPO1_MYCTU      TEEANEQMDAYFARFGGVRDYLRAVVERARKDGYTSTVLGRRRYLPELDSSNRQVREAAERAALNAPIQG
DPO1_MYCBO      TEEANEQMDAYFARFGGVRDYLRAVVERARKDGYTSTVLGRRRYLPELDSSNRQVREAAERAALNAPIQG
DPO1_MYCLE      TEEAKLQMEQYFARFGGVRDYLMDVVEQARKDGYTSTVLGRRRYLPELDSSNRQIREAAERAALNAPIQG
DPOLN_MOUSE     VLEATHFLERFLQKYKKIKDFAQTVIGQCHSAGYVTSILGRRRPLPRICAQDQQLRAQAERQAVNFVVQG
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     IQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRRPLPRIHAHDQQLRAQAERQAVNFVVQG
DPOL_BPSP1      EDECEIFIKKYFKRFPKVSKWIRDTKKHVKDISTVKTLTGATRNLPDIDSIDQSKANEAERQAVNTPIQG
DPOL_BPT5       LLEAKEYIETYFGQFPQLKRWIDKCHDQIKNHGFIYSHFGRKRRLHNIHSEDRGVQGEEIRSGFNAIIQS
DPO1_AQUAE      LEEAQVLRERFFKNFKAFKEWHDRXXXXXXXXXXXXTLLGRRFSANTFND------------AVNYPIQG
DPOLQ_HUMAN     ENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLPGIKDNNPYRKAHAERQAINTIVQG
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      IPVAKRVHEAFSATYPGVERLSKKLAMEAGRNGYIVNAMGRR----------LPVDSSRTYSALNYMIQS
DPOL_BPMD2      IETAKQVVDGFDKAYPGVTRYSRKLANEAKRNGYIINPMGRR----------LPVDRSRTYSALNYQIQS
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       KERGKELKKKFLENTPAIAALRESIQQLVESSQWVAQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
DPOL_BPT7       KERGKELKKKFLENTPAIAALRESIQQLVESSQWVAQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     EEQALEEINAVRERYPNIKKSLENIPKY-KPPGIGVDIQGKTR-----NNYKMRIAGARDRAQLNRIITF
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
DPO1_HAEIN      TAADIIKRAMIKLD---EVIRHDPDEMIMQVHDELVFEVRSEKVAFFREQIKQHMEAAAE-----LVVPL
DPO1_RICFE      TNADIIKIAMINLDQEIE--KNNKTRLVLQIHDELLFEVPEDEVELVTPIIKKIMENSTNMDV-----PI
DPO1_RICCN      TNTDIIKIAMINLDQEIEK-RKLKTRLVLQIHDELLFEAPIDEVEIITPIIKKIMENST-----NMAVPI
DPO1_PSEAE      TAADIMKRAMVAVDNWLQE-SGLDARVILQVHDXXXXXXXXXXXXXXCEGIRPLMSGAA-----TLDVPL
DPO1_RICHE      TNADIIKIAMINLDQEIEK-RKLKTRLVLQIHDELLFEAXXXXXXXXXXXXXXXMEYSTNMDV-----PI
DPO1_ECOLI      TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDV-----PL
DPO1_SALTY      TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDLDAVAKRIHQLMENCTRIDV-----PL
DPO1_RICPR      TNADIIKIAMIKLDKEIEE-RKLKTRLILQIHDELLFXXXXXXXXXXXXXXXXXMEHST-----NMNVPI
DPO1_RICTY      TSADIIKIAMIKLAQEIEK-RKLKTRLILQIHDXXXXXXXXXXXXXXXXXXXXXMEYSTNIDV-----PI
DPO1_ANATD      SAADIMKLAMIKVYQKLKE-NNLKSKIILQVHDELLIEAPYEEKDIVKEIVKREMENAV-----ALKVPL
DPO1_BORBU      SAADIMKIAMVKVFNEFKS-KKMESKILLQVHDEMLIESPIEEENEVKKILKIMMETA-----YTLNLPL
DPO1_RHILE      SAADVIRRAMIKIEPALVEVLADRVRMLLQVHDELIFEVEDQDVEKAMPVIVSVMENATMPALE-MRVPL
DPO1_BACCA      SAADIIKKAMIDLNARLKE-ERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
DPO1_BACSU      SAADIIKKAMIDMAAKLKE-KQLKARLLLQVHDELIFEAPKEEIEILEKLVPEVMEHALALDV-----PL
DPO1_BACST      SAADIIKKAMIDLS-VXXXXXXXXXXXXXXVHDELILEAPKEEIERLCRLVPEVMEQAV-----TLRVPL
DPO1_LACLA      SAADILKIAMINLDKAL-SARDFKSKLLLQVHDEIILDVPLEELDEIKVLVKQTMEEAIE-----LAVPL
DPO1_LACLM      SAADILKIAMINLDKALTE-RQSKSKLLLQVHDEIILDVPLEELEDIKALVKQTMEEAIE-----LAVPL
DPO1_CHLAA      TAADLMKMAMVNVHRALRE-QGLRTRLLLQVHDELIXXXXXXXXXXXXRLLRDVMSSV----YRDLVVPL
DPO1_STRPN      SAADILKIAMIQLDKALVA-GGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQ-----LSVPL
DPO1_SYNY3      SSADIIKIAMVKLAKLLESY---QTRMLLQVHDELIFEMPPEEWEELAPLIQNTMEQAL-----TLSVPL
DPO1_STRR6      SAADILKIAMIQLDKALVA-GGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQ-----LSVPL
DPO1_RICBR      TNADIIKIAMTLLDREIEK-RKLKTRLVLQIHDELLFEAPIDEIETIMPIIKQIMENSTNMDV-----PI
DPO1_TREPA      SAADIVKIAMIAI-XXXXXXXXXXXXXXXXVHDELIFEAPAAETAIVKEILFAEMEHAVE-----LSIPL
DPO1_HELPJ      SASDLLKLGMLKVSERF---KNNPSRLLLQVHDELIFEI---EEKNAPE-LQQEIQRILNDEVYPLRVPL
DPO1_HELPY      SASDLLKLGMLKVSERF---KNNPSRLLLQVHDELIFEI---EEKNAPE-LQQEIQRILNDEVYPLRVPL
DPO1_DEIRA      TAADIMKLAMVQLDPQLDAI---GARMLLQVHDELLIEAPLDKAEQVAALTKKVMENVVQ-----LKVPL
DPO1_THEAQ      TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
DPO1_THEFI      TAADLMKIAMVKL---FPRLKPLGAHLLLQVHDELVLEVPEDRAEEAKALVKEVMENAYPLDV-----PL
DPO1_THECA      TAADLMKLAMVKL---FPRLREMGARMLLQVHDELLLEAPQAGAEEVAALAKEAMEKA-----YPLAVPL
DPO1F_THETH     TAADLMKLAMVRL---FPRLQELGARMLLQVHDELVLEAPKDRAERVAALAKEVMEGV-----WPLQVPL
DPO1T_THET8     TAADLMKLAMVKL---FPRLREMGARMLLQVHDELLLEAPQARAEEVAALAKEAMEKA-----YPLAVPL
DPO1_MYCTU      SAADIIKVAMIQVDKALNEAQ-LASRMLLQVHDELLFEIAPGERERVEALVRDKMGGAYPLDV-----PL
DPO1_MYCBO      SAADIIKVAMIQVDKALNEAQ-LASRMLLQVHDELLFEIAPGERERVEALVRDKMGGAYPLDV-----PL
DPO1_MYCLE      SAADIIKVAMIAVDKSLKQAK-LASRMLLQVHDELLFEVAIGEREQIEAMVREQMGSAYPLDV-----PL
DPOLN_MOUSE     SAADLCKLAMIRISTAVATSPTLTARLVAQIHDELLFEVEDTQVPEFAALVRRIMESXXXXXXXXXXXXX
EX53_AQUAE      ----------------------------------------------------------------------
DPOLN_HUMAN     SAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPECAALVRRTMESXXXXXXXXXXXPL
DPOL_BPSP1      TGSDCTLMSLILINQWLRE-SGLRSRICITVHDSIVLDCPKDEVLEVAKKVKHIMENLGENEFYKFDVPI
DPOL_BPT5       ASSDSLLLGAVDADNEIISLLEQEMKIVMLVHDSVVAIVREDLIDQYNEIL-------------------
DPO1_AQUAE      TGADLLKLAVLLFDANLQK-KGIDAKLVNLVHD-------------------------------------
DPOLQ_HUMAN     SAADIVKIATVNIQKQLET---------------------------------------------------
EX53_BACSU      ----------------------------------------------------------------------
EX53_BUCBP      ----------------------------------------------------------------------
EX53_UREPA      ----------------------------------------------------------------------
EX53_BUCAP      ----------------------------------------------------------------------
EX53_BUCAI      ----------------------------------------------------------------------
XNI_SHEPA       ----------------------------------------------------------------------
XNI_SHEPW       ----------------------------------------------------------------------
XNI_COLP3       ----------------------------------------------------------------------
XNI_SHESH       ----------------------------------------------------------------------
EX53_BACHD      ----------------------------------------------------------------------
XNI_SERP5       ----------------------------------------------------------------------
XNI_SHEHH       ----------------------------------------------------------------------
XNI_SHEFN       ----------------------------------------------------------------------
XNI_SHEDO       ----------------------------------------------------------------------
XNI_SHEB9       ----------------------------------------------------------------------
EX53_STRCO      ----------------------------------------------------------------------
XNI_SHEB8       ----------------------------------------------------------------------
XNI_SHEB5       ----------------------------------------------------------------------
XNI_SHEB2       ----------------------------------------------------------------------
XNI_TOLAT       ----------------------------------------------------------------------
XNI_SHESA       ----------------------------------------------------------------------
XNI_SHEPC       ----------------------------------------------------------------------
XNI_SHESW       ----------------------------------------------------------------------
XNI_ENTS8       ----------------------------------------------------------------------
XNI_SHEWM       ----------------------------------------------------------------------
XNI_PHOLL       ----------------------------------------------------------------------
XNI_ESCF3       ----------------------------------------------------------------------
XNI_SODGM       ----------------------------------------------------------------------
XNI_KLEP7       ----------------------------------------------------------------------
XNI_KLEP3       ----------------------------------------------------------------------
EX53_MYCPU      ----------------------------------------------------------------------
XNI_PSYIN       ----------------------------------------------------------------------
XNI_PSEHT       ----------------------------------------------------------------------
XNI_SHIFL       ----------------------------------------------------------------------
XNI_SHIF8       ----------------------------------------------------------------------
XNI_SHISS       ----------------------------------------------------------------------
XNI_SHIDS       ----------------------------------------------------------------------
XNI_SHIBS       ----------------------------------------------------------------------
XNI_SHIB3       ----------------------------------------------------------------------
XNI_ECOSE       ----------------------------------------------------------------------
XNI_ECOLU       ----------------------------------------------------------------------
XNI_ECOLI       ----------------------------------------------------------------------
XNI_ECOL5       ----------------------------------------------------------------------
XNI_ECOHS       ----------------------------------------------------------------------
XNI_ECODH       ----------------------------------------------------------------------
XNI_ECOBW       ----------------------------------------------------------------------
XNI_ECO8A       ----------------------------------------------------------------------
XNI_ECO57       ----------------------------------------------------------------------
XNI_ECO55       ----------------------------------------------------------------------
XNI_ECO27       ----------------------------------------------------------------------
XNI_ECO24       ----------------------------------------------------------------------
XNI_ECOUT       ----------------------------------------------------------------------
XNI_ECOL6       ----------------------------------------------------------------------
XNI_ECOK1       ----------------------------------------------------------------------
XNI_ECO81       ----------------------------------------------------------------------
XNI_ECO45       ----------------------------------------------------------------------
XNI_PECCP       ----------------------------------------------------------------------
EX53_MYCTU      ----------------------------------------------------------------------
DPOL_BPML5      SSRDVTCRALIRLHE-----AGYTPYLRLPIHDEIVASLPASEAEHIGHLMQEQMGPV------------
DPOL_BPMD2      TSRDVTCKALIRLHE-----AGFTPYLRLPIHDEIVASLPAEKAREIARLMAEEMGPV------------
XNI_ERWCT       ----------------------------------------------------------------------
XNI_VIBPA       ----------------------------------------------------------------------
XNI_ECO7I       ----------------------------------------------------------------------
XNI_AERHH       ----------------------------------------------------------------------
XNI_ALISL       ----------------------------------------------------------------------
XNI_SALG2       ----------------------------------------------------------------------
XNI_SALEP       ----------------------------------------------------------------------
XNI_SALDC       ----------------------------------------------------------------------
XNI_SALTY       ----------------------------------------------------------------------
XNI_SALPB       ----------------------------------------------------------------------
XNI_SALNS       ----------------------------------------------------------------------
XNI_SALHS       ----------------------------------------------------------------------
XNI_SALA4       ----------------------------------------------------------------------
XNI_AERS4       ----------------------------------------------------------------------
XNI_SALTI       ----------------------------------------------------------------------
XNI_SALSV       ----------------------------------------------------------------------
XNI_SALPK       ----------------------------------------------------------------------
XNI_SALPA       ----------------------------------------------------------------------
XNI_CITK8       ----------------------------------------------------------------------
XNI_VIBHB       ----------------------------------------------------------------------
EX53_MYCPN      ----------------------------------------------------------------------
XNI_YERE8       ----------------------------------------------------------------------
XNI_SHESR       ----------------------------------------------------------------------
XNI_SHESM       ----------------------------------------------------------------------
XNI_VIBFM       ----------------------------------------------------------------------
XNI_SALPC       ----------------------------------------------------------------------
XNI_SALCH       ----------------------------------------------------------------------
XNI_VIBF1       ----------------------------------------------------------------------
XNI_YERPY       ----------------------------------------------------------------------
XNI_YERPS       ----------------------------------------------------------------------
XNI_YERPB       ----------------------------------------------------------------------
XNI_YERP3       ----------------------------------------------------------------------
XNI_YERPP       ----------------------------------------------------------------------
XNI_YERPN       ----------------------------------------------------------------------
XNI_YERPE       ----------------------------------------------------------------------
XNI_VIBSL       ----------------------------------------------------------------------
XNI_SHEAM       ----------------------------------------------------------------------
XNI_EDWI9       ----------------------------------------------------------------------
XNI_VIBVY       ----------------------------------------------------------------------
XNI_VIBCH       ----------------------------------------------------------------------
XNI_YERPA       ----------------------------------------------------------------------
XNI_VIBVU       ----------------------------------------------------------------------
EX53_MYCGE      ----------------------------------------------------------------------
XNI_SHELP       ----------------------------------------------------------------------
XNI_SHEON       ----------------------------------------------------------------------
XNI_PHOPR       ----------------------------------------------------------------------
DPOL_BPT3       AGALICKLWIIKVEKGLKHGWDGDFAYMAWIHDEIQVACRTEEIKTVIEVAQEAMRWVGEH--WNFRCLL
DPOL_BPT7       AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
EXO5_BPT5       ----------------------------------------------------------------------
RNH_BPT4        ----------------------------------------------------------------------
FEN_SULTO       ----------------------------------------------------------------------
FEN_METKA       ----------------------------------------------------------------------
FEN_METST       ----------------------------------------------------------------------
RAD2_YEAST      ----------------------------------------------------------------------
FEN_METTP       ----------------------------------------------------------------------
FEN_IGNH4       ----------------------------------------------------------------------
FEN_THENV       ----------------------------------------------------------------------
MUTL_DICTD      ----------------------------------------------------------------------
FEN_PICTO       ----------------------------------------------------------------------
FEN_SULAC       ----------------------------------------------------------------------
FEN_PYRAR       ----------------------------------------------------------------------
FEN_PYRCJ       ----------------------------------------------------------------------
FEN_NANEQ       ----------------------------------------------------------------------
EXO1_YEAST      ----------------------------------------------------------------------
PP1R7_MOUSE     ----------------------------------------------------------------------
FEN_PYRIL       ----------------------------------------------------------------------
YR327_MIMIV     MNILIYRQRMKDLLQKLTKIARRRNKV-----DEIVHETPIKSVKQMTNIDRKRLTSKTEDD--------
FEN_PYRAE       ----------------------------------------------------------------------
FEN_KORCO       ----------------------------------------------------------------------
FEN1A_ORYSJ     ----------------------------------------------------------------------
EFG_CARRP       ----------------------------------------------------------------------
MNME_FUSNN      ----------------------------------------------------------------------
HEM1_THEM4      ----------------------------------------------------------------------
FEN_UNCMA       ----------------------------------------------------------------------
SYP_HELHP       ----------------------------------------------------------------------
SEP14_HUMAN     ----------------------------------------------------------------------
FEN_ARCFU       ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
FEN_CALMQ       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           TVDVNTGDNWGILH
DPO1_HAEIN      IVEVGVGQNWDEAH
DPO1_RICFE      ITEIRVGNNWMEIH
DPO1_RICCN      ITEIRAGNNWMEIH
DPO1_PSEAE      VVEAGVGSNWDEAH
DPO1_RICHE      ITEIRTGNNWMEIH
DPO1_ECOLI      LVEVGSGENWDQAH
DPO1_SALTY      LVEVGSGENWDQAH
DPO1_RICPR      ITEIKAGNNWKEIH
DPO1_RICTY      ITEIRAGNNWKEIH
DPO1_ANATD      VVEVKEGLNW----
DPO1_BORBU      RANIETGKSWGEIH
DPO1_RHILE      RVDARAATNWDEAH
DPO1_BACCA      KVDYHYGSTW----
DPO1_BACSU      KVDFASGPSW----
DPO1_BACST      KVDYHYGPTW----
DPO1_LACLA      KVDENTGKTW----
DPO1_LACLM      KVDDNTGKTW----
DPO1_CHLAA      SVNLEVGPNW----
DPO1_STRPN      IADENEGATW----
DPO1_SYNY3      VVEMHRGSNW----
DPO1_STRR6      IADENEGATW----
DPO1_RICBR      ITEIRAGNNWMEIH
DPO1_TREPA      RIHVESGNSWGDFH
DPO1_HELPJ      ETSAFIAKRWNEL-
DPO1_HELPY      ETSAFIAKRWNEL-
DPO1_DEIRA      AVEVGTGPNW----
DPO1_THEAQ      EVEVGIGEDW----
DPO1_THEFI      EVEVGVGRDW----
DPO1_THECA      EVEVGMGEDW----
DPO1F_THETH     EVEVGLGEDW----
DPO1T_THET8     EVEVGMGEDW----
DPO1_MYCTU      EVSVGYGRSW----
DPO1_MYCBO      EVSVGYGRSW----
DPO1_MYCLE      EVSVGFGRSWG---
DPOLN_MOUSE     XXKVNVGRSWGHL-
EX53_AQUAE      --------------
DPOLN_HUMAN     KVSLSAGRSWGHL-
DPOL_BPSP1      LSEMEIGRNYG---
DPOL_BPT5       --------------
DPO1_AQUAE      --------------
DPOLQ_HUMAN     --------------
EX53_BACSU      --------------
EX53_BUCBP      --------------
EX53_UREPA      --------------
EX53_BUCAP      --------------
EX53_BUCAI      --------------
XNI_SHEPA       --------------
XNI_SHEPW       --------------
XNI_COLP3       --------------
XNI_SHESH       --------------
EX53_BACHD      --------------
XNI_SERP5       --------------
XNI_SHEHH       --------------
XNI_SHEFN       --------------
XNI_SHEDO       --------------
XNI_SHEB9       --------------
EX53_STRCO      --------------
XNI_SHEB8       --------------
XNI_SHEB5       --------------
XNI_SHEB2       --------------
XNI_TOLAT       --------------
XNI_SHESA       --------------
XNI_SHEPC       --------------
XNI_SHESW       --------------
XNI_ENTS8       --------------
XNI_SHEWM       --------------
XNI_PHOLL       --------------
XNI_ESCF3       --------------
XNI_SODGM       --------------
XNI_KLEP7       --------------
XNI_KLEP3       --------------
EX53_MYCPU      --------------
XNI_PSYIN       --------------
XNI_PSEHT       --------------
XNI_SHIFL       --------------
XNI_SHIF8       --------------
XNI_SHISS       --------------
XNI_SHIDS       --------------
XNI_SHIBS       --------------
XNI_SHIB3       --------------
XNI_ECOSE       --------------
XNI_ECOLU       --------------
XNI_ECOLI       --------------
XNI_ECOL5       --------------
XNI_ECOHS       --------------
XNI_ECODH       --------------
XNI_ECOBW       --------------
XNI_ECO8A       --------------
XNI_ECO57       --------------
XNI_ECO55       --------------
XNI_ECO27       --------------
XNI_ECO24       --------------
XNI_ECOUT       --------------
XNI_ECOL6       --------------
XNI_ECOK1       --------------
XNI_ECO81       --------------
XNI_ECO45       --------------
XNI_PECCP       --------------
EX53_MYCTU      --------------
DPOL_BPML5      --------------
DPOL_BPMD2      --------------
XNI_ERWCT       --------------
XNI_VIBPA       --------------
XNI_ECO7I       --------------
XNI_AERHH       --------------
XNI_ALISL       --------------
XNI_SALG2       --------------
XNI_SALEP       --------------
XNI_SALDC       --------------
XNI_SALTY       --------------
XNI_SALPB       --------------
XNI_SALNS       --------------
XNI_SALHS       --------------
XNI_SALA4       --------------
XNI_AERS4       --------------
XNI_SALTI       --------------
XNI_SALSV       --------------
XNI_SALPK       --------------
XNI_SALPA       --------------
XNI_CITK8       --------------
XNI_VIBHB       --------------
EX53_MYCPN      --------------
XNI_YERE8       --------------
XNI_SHESR       --------------
XNI_SHESM       --------------
XNI_VIBFM       --------------
XNI_SALPC       --------------
XNI_SALCH       --------------
XNI_VIBF1       --------------
XNI_YERPY       --------------
XNI_YERPS       --------------
XNI_YERPB       --------------
XNI_YERP3       --------------
XNI_YERPP       --------------
XNI_YERPN       --------------
XNI_YERPE       --------------
XNI_VIBSL       --------------
XNI_SHEAM       --------------
XNI_EDWI9       --------------
XNI_VIBVY       --------------
XNI_VIBCH       --------------
XNI_YERPA       --------------
XNI_VIBVU       --------------
EX53_MYCGE      --------------
XNI_SHELP       --------------
XNI_SHEON       --------------
XNI_PHOPR       --------------
DPOL_BPT3       DTEGKMGANWKECH
DPOL_BPT7       DTEGKMGPNWAICH
EXO5_BPT5       --------------
RNH_BPT4        --------------
FEN_SULTO       --------------
FEN_METKA       --------------
FEN_METST       --------------
RAD2_YEAST      --------------
FEN_METTP       --------------
FEN_IGNH4       --------------
FEN_THENV       --------------
MUTL_DICTD      --------------
FEN_PICTO       --------------
FEN_SULAC       --------------
FEN_PYRAR       --------------
FEN_PYRCJ       --------------
FEN_NANEQ       --------------
EXO1_YEAST      --------------
PP1R7_MOUSE     --------------
FEN_PYRIL       --------------
YR327_MIMIV     --------------
FEN_PYRAE       --------------
FEN_KORCO       --------------
FEN1A_ORYSJ     --------------
EFG_CARRP       --------------
MNME_FUSNN      --------------
HEM1_THEM4      --------------
FEN_UNCMA       --------------
SYP_HELHP       --------------
SEP14_HUMAN     --------------
FEN_ARCFU       --------------
HMW2_MYCPN      --------------
FEN_CALMQ       --------------