[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21058.1

[Show Plain Result]


## Summary of Sequence Search
    1::967
   15::994       0.0  55% 1004 aa  ODO1_BRUC2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  55% 1004 aa  ODO1_BRUSU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  55% 1004 aa  ODO1_BRUSI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  55% 1004 aa  ODO1_BRUAB RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  55% 1004 aa  ODO1_BRUA2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  55% 1004 aa  ODO1_BRUA1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  54% 1004 aa  ODO1_BRUME RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  54% 1004 aa  ODO1_BRUMB RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   15::994       0.0  54% 1004 aa  ODO1_BRUO2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   11::990       0.0  54% 1001 aa  ODO1_OCHA4 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    4::932       0.0  48%  950 aa  ODO1_RALEH RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   12::941       0.0  46%  943 aa  ODO1_AZOVI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  127::973       0.0  49%  977 aa  ODO1_RICFE RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   12::926       0.0  48%  933 aa  ODO1_ECOLI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   12::926       0.0  48%  933 aa  ODO1_ECOL6 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   12::926       0.0  48%  933 aa  ODO1_ECO57 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    6::922       0.0  47%  927 aa  ODO1_RICBR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    4::923       0.0  46%  928 aa  ODO1_RICCN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    5::922       0.0  45%  936 aa  ODO1_RICPR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    1::919       0.0  47%  920 aa  ODO1_LEPIN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    1::919       0.0  47%  920 aa  ODO1_LEPIC RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   47::1002      0.0  46% 1013 aa  ODO1_DICDI RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   16::930       0.0  45%  935 aa  ODO1_HAEIN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
    5::923       0.0  44%  933 aa  ODO1_RICTY RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   52::1015      0.0  46% 1027 aa  ODO1_CAEBR RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   43::1012      0.0  45% 1014 aa  ODO1_YEAST RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   47::1004      0.0  44% 1009 aa  ODO1_SCHPO RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   51::1017      0.0  44% 1029 aa  ODO1_CAEEL RecName: Full=2-oxoglutarate dehydrogenase E1 component,
    8::933       0.0  44%  934 aa  ODO1_COXBU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   41::1009      0.0  46% 1018 aa  OGDHL_XENLA RecName: Full=2-oxoglutarate dehydrogenase E1
   49::1015      0.0  45% 1023 aa  ODO1_MOUSE RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   49::1015      0.0  45% 1023 aa  ODO1_MACFA RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   49::1015      0.0  45% 1023 aa  ODO1_HUMAN RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   49::1015      0.0  45% 1023 aa  ODO1_RAT RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   49::1015      0.0  45% 1023 aa  ODO1_PONAB RecName: Full=2-oxoglutarate dehydrogenase E1 component,
    1::902       0.0  44%  909 aa  ODO1_BUCAI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   49::1015      0.0  46% 1023 aa  ODO1_BOVIN RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   49::1012      0.0  46% 1021 aa  ODO1_XENLA RecName: Full=2-oxoglutarate dehydrogenase E1 component,
   49::1000      0.0  44% 1010 aa  OGDHL_HUMAN RecName: Full=2-oxoglutarate dehydrogenase E1
  412::1267      0.0  45% 1269 aa  KGD_MYCSS RecName: Full=2-oxoglutarate decarboxylase;       
  412::1267      0.0  45% 1269 aa  KGD_MYCSK RecName: Full=2-oxoglutarate decarboxylase;       
  407::1262      0.0  45% 1264 aa  KGD_MYCSJ RecName: Full=2-oxoglutarate decarboxylase;       
   49::1000      0.0  44% 1010 aa  OGDHL_PONAB RecName: Full=2-oxoglutarate dehydrogenase E1
   12::918       0.0  43%  923 aa  ODO1_BUCAP RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  380::1237      0.0  45% 1238 aa  KGD_MYCLE RecName: Full=2-oxoglutarate decarboxylase;       
  374::1242      0.0  44% 1243 aa  KGD_MYCVP RecName: Full=2-oxoglutarate decarboxylase;       
  369::1226      0.0  44% 1227 aa  KGD_MYCS2 RecName: Full=2-oxoglutarate decarboxylase;       
  387::1246      0.0  44% 1247 aa  KGD_MYCPA RecName: Full=2-oxoglutarate decarboxylase;       
  371::1230      0.0  45% 1231 aa  KGD_MYCBP RecName: Full=2-oxoglutarate decarboxylase;       
  371::1230      0.0  45% 1231 aa  KGD_MYCBO RecName: Full=2-oxoglutarate decarboxylase;       
  371::1230      0.0  45% 1231 aa  KGD_MYCTU RecName: Full=2-oxoglutarate decarboxylase;       
  371::1230      0.0  45% 1231 aa  KGD_MYCTA RecName: Full=2-oxoglutarate decarboxylase;       
  377::1237      0.0  43% 1238 aa  KGD_MYCUA RecName: Full=2-oxoglutarate decarboxylase;       
  407::1256      0.0  44% 1257 aa  ODO1_CORGL RecName: Full=2-oxoglutarate dehydrogenase E1 component;  
   54::939       0.0  44%  953 aa  ODO1_OCEIH RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::936       0.0  45%  944 aa  ODO1_BACSU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  43%  932 aa  ODO1_STAAU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   49::908       0.0  43%  910 aa  ODO1_STAAN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAAW RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAAT RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAAS RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAAE RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAAC RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAA8 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  44%  932 aa  ODO1_STAA3 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  43%  932 aa  ODO1_STAAM RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  43%  932 aa  ODO1_STAA9 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  43%  932 aa  ODO1_STAA2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930       0.0  43%  932 aa  ODO1_STAA1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   63::908       0.0  43%  916 aa  ODO1_BUCBP RecName: Full=Oxoglutarate dehydrogenase;       
   67::924       0.0  43%  927 aa  DHTK1_XENLA RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
   71::930       0.0  43%  932 aa  ODO1_STAAR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   84::944       0.0  44%  952 aa  ODO1_GEOSW RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::936       0.0  45%  944 aa  ODO1_BACA2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   54::935       0.0  43%  943 aa  ODO1_BACSK RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   43::918       0.0  41%  919 aa  DHTK1_DROME RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
   74::929       0.0  44%  934 aa  ODO1_STAES RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   74::929       0.0  44%  934 aa  ODO1_STAEQ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   60::919       0.0  43%  920 aa  DHTK1_DANRE RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
    1::930       0.0  42%  951 aa  ODO1_EXISA RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   61::936       0.0  43%  944 aa  ODO1_BACLD RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   66::939       0.0  42%  945 aa  ODO1_BACHD RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   48::928     e-180  43%  933 aa  ODO1_STAS1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   71::930     e-180  42%  932 aa  ODO1_STAAB RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-179  42%  955 aa  ODO1_BACHK RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::938     e-179  42%  955 aa  ODO1_BACCQ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::938     e-179  42%  955 aa  ODO1_BACC7 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-179  42%  955 aa  ODO1_BACC4 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::938     e-179  42%  955 aa  ODO1_BACAN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::938     e-179  42%  955 aa  ODO1_BACAC RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::938     e-179  42%  955 aa  ODO1_BACAA RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-179  42%  955 aa  ODO1_BACCR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-179  42%  955 aa  ODO1_BACC1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   59::875     e-179  42%  919 aa  DHTK1_PONAB RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
   70::938     e-179  42%  955 aa  ODO1_BACC3 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::938     e-178  42%  955 aa  ODO1_BACC0 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-178  42%  955 aa  ODO1_BACCZ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-178  42%  955 aa  ODO1_BACC2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   60::919     e-178  42%  921 aa  DHTK1_MOUSE RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
   59::936     e-178  43%  944 aa  ODO1_BACP2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   74::933     e-178  42%  934 aa  ODO1_STAHJ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   70::933     e-178  42%  955 aa  ODO1_BACWK RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  153::943     e-177  45%  950 aa  ODO1_GEOKA RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   56::910     e-177  42%  911 aa  DHTK1_CAEEL RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
   59::872     e-177  42%  919 aa  DHTK1_HUMAN RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
   59::936     e-175  42%  958 aa  ODO1_BACCN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   59::918     e-174  41%  920 aa  DHTK1_RAT RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
  186::363     1e-09  32%  391 aa  ODPAT_RAT RecName: Full=Pyruvate dehydrogenase E1 component subunit
  186::363     3e-09  32%  391 aa  ODPAT_MOUSE RecName: Full=Pyruvate dehydrogenase E1 component
  163::326     3e-09  28%  348 aa  ODPA_RHIME RecName: Full=Pyruvate dehydrogenase E1 component
  172::362     3e-09  31%  390 aa  ODPA_PANTR RecName: Full=Pyruvate dehydrogenase E1 component
  172::362     3e-09  31%  390 aa  ODPA_HUMAN RecName: Full=Pyruvate dehydrogenase E1 component
  171::361     4e-09  31%  389 aa  ODPA_PIG RecName: Full=Pyruvate dehydrogenase E1 component subunit
  172::362     4e-09  31%  390 aa  ODPA_MACFA RecName: Full=Pyruvate dehydrogenase E1 component
  210::372     6e-09  28%  409 aa  ODPA_SCHPO RecName: Full=Pyruvate dehydrogenase E1 component
  145::347     7e-09  31%  363 aa  ODPA_SMIMA RecName: Full=Pyruvate dehydrogenase E1 component
  172::362     7e-09  31%  390 aa  ODPA_RAT RecName: Full=Pyruvate dehydrogenase E1 component subunit
  172::362     7e-09  31%  390 aa  ODPA_MOUSE RecName: Full=Pyruvate dehydrogenase E1 component
  172::362     7e-09  31%  390 aa  ODPA_BOVIN RecName: Full=Pyruvate dehydrogenase E1 component
  184::360     1e-08  30%  388 aa  ODPAT_HUMAN RecName: Full=Pyruvate dehydrogenase E1 component
  183::358     1e-08  28%  393 aa  ODPA2_ARATH RecName: Full=Pyruvate dehydrogenase E1 component
  172::362     2e-08  31%  390 aa  ODPA_PONAB RecName: Full=Pyruvate dehydrogenase E1 component
  193::362     3e-08  28%  397 aa  ODPA_PEA RecName: Full=Pyruvate dehydrogenase E1 component subunit
  179::354     1e-07  27%  389 aa  ODPA1_ARATH RecName: Full=Pyruvate dehydrogenase E1 component
  181::356     3e-07  27%  391 aa  ODPA_SOLTU RecName: Full=Pyruvate dehydrogenase E1 component
  184::365     5e-07  29%  412 aa  ODPA_KLULA RecName: Full=Pyruvate dehydrogenase E1 component
  192::378     1e-05  27%  420 aa  ODPA_YEAST RecName: Full=Pyruvate dehydrogenase E1 component
  181::349     2e-05  28%  396 aa  ODPA_ASCSU RecName: Full=Pyruvate dehydrogenase E1 component
  175::344     4e-05  27%  391 aa  ODPT_ASCSU RecName: Full=Pyruvate dehydrogenase E1 component
  181::347     4e-05  27%  397 aa  ODPA_CAEEL RecName: Full=Probable pyruvate dehydrogenase E1
   52::304     9e-05  25%  326 aa  ODPA_RICBR RecName: Full=Pyruvate dehydrogenase E1 component
  176::336     2e-04  28%  354 aa  ODPA_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component
  150::303     2e-04  23%  358 aa  ODPA_MYCGE RecName: Full=Pyruvate dehydrogenase E1 component
  170::329     2e-04  21%  345 aa  ODPA_ACHLA RecName: Full=Pyruvate dehydrogenase E1 component
  182::344     4e-04  27%  377 aa  ODPA_DICDI RecName: Full=Pyruvate dehydrogenase E1 component
  151::307     0.001  25%  326 aa  ODPA_RICFE RecName: Full=Pyruvate dehydrogenase E1 component
  127::315     0.001  25%  333 aa  ACOA_RALEH RecName: Full=Acetoin:2,6-dichlorophenolindophenol
    1::967

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSSKNLEFEKTSFLSKSNSAFIEQMYLKFINKDKDLPESWQNYFEGMSEDLSMIAKEINGPSWNXXXXX
ODO1_BRUC2      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUSU      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUSI      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUAB      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUA2      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUA1      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUME      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUMB      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_BRUO2      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGPSWTRKNWP
ODO1_OCHA4      --------FALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKNAEGASWTRKNWP
ODO1_RALEH      -------QYQSNSYLFGGNAPYVEELYEAYLQNPASVPDNWRAYFDAMQN-----VPAVDGSNGRDIPHA
ODO1_AZOVI      -----------SAHLSGGNAAYVEELYELYLHDPNAVPEEWRTYFEKLPAEAGTSTDVPHAP--------
ODO1_RICFE      ----------------------------------------------------------------------
ODO1_ECOLI      -----------SSYLSGANQSWIEQLYEDFLTDPDSVDANWRSYFRRLAKDASRYSSTISDPD-------
ODO1_ECOL6      -----------SSYLSGANQSWIEQLYEDFLTDPDSVDANWRSYFRRLAKDASRYSSTISDPD-------
ODO1_ECO57      -----------SSYLSGANQSWIEQLYEDFLTDPDSVDANWRSYFRRLAKDASRYSSTISDPD-------
ODO1_RICBR      ---------KKTGFLFGGNAVFIEELYKQYLENPASVDQTWQEFFSSVKDSNQLLNKST-----------
ODO1_RICCN      -------DFKKTGYLFGGNAVFVEELYKQYLANPASVDQTWQEFFAGIKDNNTLLNK-------------
ODO1_RICPR      --------FNKTGYLFSGNAVFVEELYRQYLANPNSVDQTWQEFFADIKDNNVVLNKST-----------
ODO1_LEPIN      ------MKIEKLMALYGENGALLEELYNQYKLNPETLDKEWKSFFQEV--DTNGLA---NGSGYTN----
ODO1_LEPIC      ------MKIEKLMALYGENGALLEELYNQYKLNPETLDKEWKSFFQEV--DTNGLA---NGSGYTN----
ODO1_DICDI      ------------SFLDGTSSTYVEDMFANWVKDPKSVHPSWASFFESSERGVPAGEAFMSPPTLGSS---
ODO1_HAEIN      --------------LGGANQSYIEELYESYLSDPQSVEESWRKTFDSLPKTTAL--EQPHTP--------
ODO1_RICTY      --------FNKTGYLFAGNAVFVEELYRQYLANPNSVDQTWQEFFADIKDNNALLNKST-----------
ODO1_CAEBR      -------------FLNGSSSVYIEQMYETWLENPSSVHTSWDAYFRNVEXXXXXXXXXXXXXSVAYAGSM
ODO1_YEAST      ------------NFLSTSNATYIDEMYQAWQKDPSSVHVSWDAYFKNMSNPKIPATKAFQAPP-------
ODO1_SCHPO      -------------FLTGGAADYVDEMYDAWKKDPNSVHASWQAYFKNVQERGVSPSKAFQAPP-------
ODO1_CAEEL      -------------FLNGSSSIYIEQMYEAWLQDPSSVHTSWDAYFRNVEXXXXXXXXXXXXXXXXYAGAL
ODO1_COXBU      -------QFQKNSYLADNNAGYIETLYENFLKDPHSVNEEWRSYFRTLT----------NGASTPDISHA
OGDHL_XENLA     ----------KEPFLSGTNSSYVEEMYYAWLENPKSVHKSWDAFFR--SADNGTPQCEIQGPS-------
ODO1_MOUSE      -------------FLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTN------AGAPPGTAYQSPLS-
ODO1_MACFA      -------------FLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTN------AGAPPGTAYQSPLP-
ODO1_HUMAN      -------------FLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTN------AGAPPGTAYQSPLP-
ODO1_RAT        -------------FLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTN------AGAPPGTAYQSPLS-
ODO1_PONAB      -------------FLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTN------AGAPPGTAYQSPLP-
ODO1_BUCAI      MDKNKIEYWLNSSWLSRENQNYIETIYKSFLTNAQSIDDMWHKAFLEFSEEQKN----------------
ODO1_BOVIN      -------------FLSGTSSNYVEEMYYAWLENPKSVHKSWDIFFRNTN------AGAPPGTAYQXXXXX
ODO1_XENLA      -------------FLSGTNSNYVEEMYYAWLENPKSVHKSWDIFFRNANAGAS--------PGAAYXXXX
OGDHL_HUMAN     -------------------SSYMEEMYFAWLENPQSVHKSWDSFFREASEEAFSGSAQPRPPS-------
KGD_MYCSS       ----------------------------------------------------------------------
KGD_MYCSK       ----------------------------------------------------------------------
KGD_MYCSJ       ----------------------------------------------------------------------
OGDHL_PONAB     -------------------SSYMEEMYFAWLENPRSVHKSWDSFFRKASEEAFSGSAQPRPPS-------
ODO1_BUCAP      -----------SSWLSGNNQNYIEKIYESYLINPKSVDITWQDKFSDLSKKRKNILKE------------
KGD_MYCLE       ----------------------------------------------------------------------
KGD_MYCVP       ----------------------------------------------------------------------
KGD_MYCS2       ----------------------------------------------------------------------
KGD_MYCPA       ----------------------------------------------------------------------
KGD_MYCBP       ----------------------------------------------------------------------
KGD_MYCBO       ----------------------------------------------------------------------
KGD_MYCTU       ----------------------------------------------------------------------
KGD_MYCTA       ----------------------------------------------------------------------
KGD_MYCUA       ----------------------------------------------------------------------
ODO1_CORGL      ----------------------------------------------------------------------
ODO1_OCEIH      ----------------------------------------------------------------------
ODO1_BACSU      ----------------------------------------------------------------------
ODO1_STAAU      ----------------------------------------------------------------------
ODO1_STAAN      ----------------------------------------------------------------------
ODO1_STAAW      ----------------------------------------------------------------------
ODO1_STAAT      ----------------------------------------------------------------------
ODO1_STAAS      ----------------------------------------------------------------------
ODO1_STAAE      ----------------------------------------------------------------------
ODO1_STAAC      ----------------------------------------------------------------------
ODO1_STAA8      ----------------------------------------------------------------------
ODO1_STAA3      ----------------------------------------------------------------------
ODO1_STAAM      ----------------------------------------------------------------------
ODO1_STAA9      ----------------------------------------------------------------------
ODO1_STAA2      ----------------------------------------------------------------------
ODO1_STAA1      ----------------------------------------------------------------------
ODO1_BUCBP      ----------------------------------------------------------------------
DHTK1_XENLA     ----------------------------------------------------------------------
ODO1_STAAR      ----------------------------------------------------------------------
ODO1_GEOSW      ----------------------------------------------------------------------
ODO1_BACA2      ----------------------------------------------------------------------
ODO1_BACSK      ----------------------------------------------------------------------
DHTK1_DROME     ----------------------------------------------------------------------
ODO1_STAES      ----------------------------------------------------------------------
ODO1_STAEQ      ----------------------------------------------------------------------
DHTK1_DANRE     ----------------------------------------------------------------------
ODO1_EXISA      MGESSNVH-EKSQAFYGPNLGYIIELYEQYLEDPSSVDEETRRYFDGAPETSTPTEVPVSGPSFD-----
ODO1_BACLD      ----------------------------------------------------------------------
ODO1_BACHD      ----------------------------------------------------------------------
ODO1_STAS1      ----------------------------------------------------------------------
ODO1_STAAB      ----------------------------------------------------------------------
ODO1_BACHK      ----------------------------------------------------------------------
ODO1_BACCQ      ----------------------------------------------------------------------
ODO1_BACC7      ----------------------------------------------------------------------
ODO1_BACC4      ----------------------------------------------------------------------
ODO1_BACAN      ----------------------------------------------------------------------
ODO1_BACAC      ----------------------------------------------------------------------
ODO1_BACAA      ----------------------------------------------------------------------
ODO1_BACCR      ----------------------------------------------------------------------
ODO1_BACC1      ----------------------------------------------------------------------
DHTK1_PONAB     ----------------------------------------------------------------------
ODO1_BACC3      ----------------------------------------------------------------------
ODO1_BACC0      ----------------------------------------------------------------------
ODO1_BACCZ      ----------------------------------------------------------------------
ODO1_BACC2      ----------------------------------------------------------------------
DHTK1_MOUSE     ----------------------------------------------------------------------
ODO1_BACP2      ----------------------------------------------------------------------
ODO1_STAHJ      ----------------------------------------------------------------------
ODO1_BACWK      ----------------------------------------------------------------------
ODO1_GEOKA      ----------------------------------------------------------------------
DHTK1_CAEEL     ----------------------------------------------------------------------
DHTK1_HUMAN     ----------------------------------------------------------------------
ODO1_BACCN      ----------------------------------------------------------------------
DHTK1_RAT       ----------------------------------------------------------------------
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      ----------------------------------------------------------------------
ODPA_HUMAN      ----------------------------------------------------------------------
ODPA_PIG        ----------------------------------------------------------------------
ODPA_MACFA      ----------------------------------------------------------------------
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      ----------------------------------------------------------------------
ODPA_RAT        ----------------------------------------------------------------------
ODPA_MOUSE      ----------------------------------------------------------------------
ODPA_BOVIN      ----------------------------------------------------------------------
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      ----------------------------------------------------------------------
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      ----------------------------------------------------------------------
ODPA_YEAST      ----------------------------------------------------------------------
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXLSNEGNIAKVNSKDLVKSNINSIRAVALIRAYRQRGHLLAKLDPLGMMETEYLDE
ODO1_BRUC2      IAANGELVSALDGNWAEVEKHVADLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUSU      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUSI      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUAB      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUA2      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUA1      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUME      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUMB      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_BRUO2      IAANGELVSALDGNWAEVEKHVTDLTAEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLAENDY-NE
ODO1_OCHA4      IAANGELISALDGNWAEVEKHVTDLTSEEITQAARDSVXXXXXXXXXXXXGHLHANLDPLGLSENDY-NE
ODO1_RALEH      PIVASFAER-------AKQGPIRTIVASADSDMGRKRVAATQLIAAYRNIGSHWADLDPLKRQERPPLPD
ODO1_AZOVI      -------VRDQFVLLAKNQRRAQPVATSSVTEHEKKQVEVLRLIQAYRTRGHQASQLDPLGLWQRTAPSD
ODO1_RICFE      ----------------------------------MSSLKAKEMINTYRKHAHYLANLDPLGLRKTKNDLK
ODO1_ECOLI      --------------------------------TNVKQVKVLQLINAYRFRGHQHANLDPLGLWQQDKVAD
ODO1_ECOL6      --------------------------------TNVKQVKVLQLINAYRFRGHQHANLDPLGLWQQDKVAD
ODO1_ECO57      --------------------------------TNVKQVKVLQLINAYRFRGHQHANLDPLGLWQQDKVAD
ODO1_RICBR      ------------AKIILKAAATEESKTSENPVSTTNNFNVGAMIKNYRKYAHYLAKLDPLGLEVTKTKED
ODO1_RICCN      --------------------STAKIIIPDEIKKXXXXXKAKEMINAYRKHAHYLANLDPLGLRKTKNDLK
ODO1_RICPR      ------------AKVISTNVXXXXXXXXXXXXXXXXXXXAKEMISAYRRNAHYLANLDPLGLRKTKNDLK
ODO1_LEPIN      ----------------GNGKSAVATSFTDAQAASIREMGIINLLNAYRRQGHLAAKLDPLGIQKPN----
ODO1_LEPIC      ----------------GNGKSAVATSFTDAQAASIREMGIINLLNAYRRQGHLAAKLDPLGIQKPN----
ODO1_DICDI      ---------------VATKATPSTYTSSGSPKQVSDSMRLLLLVRAYQVRGHALANLDPLGLEVKEEPAE
ODO1_HAEIN      --------VRDYFRRLARENHNEAVTVIDPA-AGAKLVKVLQFINAYRFRGHLEANLDPLNYYKVSFVPE
ODO1_RICTY      ------------AKVIRPNPNVTKLLNNNLSYEGLHNLKAKEMISAYRRNAHYLANLDPLGLEIRKTKDE
ODO1_CAEBR      GVXXXXXXXXXXXXRLDTNASVQSIS---------DHLKIQLLIRSYQTRGHNIADLDPLGINSADLDDT
ODO1_YEAST      ---------SISNFPQGTEAAPLGTAMTGSVDENVSHLKVQLLCRAYQVRGHLKAHIDPLGISNNPVPPE
ODO1_SCHPO      -LLDYADSYTALDSSLINGNNYADIDVGIYMKVQL-------LVRAYQSRGHHLAKLDPLGIVNHNRPSE
ODO1_CAEEL      GVSPAAAQVT------TSSAPATRLDTNASVQSISDHLKIQLLIRSYQTRGHNIADLDPLGINSADLDDT
ODO1_COXBU      TIREEFRELARKPRSISPTA----------ITPAAEQAAVDLLIEGYRRFGHLNAKINPLG--DNRPVDS
OGDHL_XENLA     -----LADIESKLPSLSSQGATAPAKAEKIVEEHL---AVQSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_MOUSE      ---------------LSRSSLATMAHAQSLVEAQPNVDKLVSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_MACFA      ---------------LSRGSLAAVAHAQSLVEAQPNVDKLVSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_HUMAN      ---------------LSRGSLAAVAHAQSLVEAQPNVDKLVSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_RAT        ---------------LSRSSLATMAHAQSLVEAQPNVDKLVSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_PONAB      ---------------LSRGSLAAVAHAQSLVEAQPNVDKLVSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_BUCAI      ----------------TYERNNTKNNKYLLIK------KIDHMIHAFRSEGYQQSLIDPLKLKKRTKIHD
ODO1_BOVIN      XXXXXXA--------VARAGPLAQPNVDKLVEDHL---AVQSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_XENLA      XXXXXXXXXXXXXXXXXXXPNVDKLVEDHLAVQS--------LIRAYQIRGHHVAQLDPLGILDAD-LDS
OGDHL_HUMAN     ---------------VVHESRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDAD-LDS
KGD_MYCSS       --------------------------------------RVIELIAAYRNRGHLMADIDPLRLDSNRFRS-
KGD_MYCSK       --------------------------------------RVIELIAAYRNRGHLMADIDPLRLDSNRFRS-
KGD_MYCSJ       --------------------------------------RVIELIAAYRNRGHLMADIDPLRLDSNRFRS-
OGDHL_PONAB     ---------------VVHESRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDAD-LDS
ODO1_BUCAP      ----------EKFVYKNNSFKEIKIDKQEILEKKINYI-----INTFRKKGYKKSLIDPLKLNEQKKYKY
KGD_MYCLE       --------------------------------------RVMELIAAYRNRGHLMADIDPLRLDNTRFRS-
KGD_MYCVP       -----------------------RIDNPDSIEDK--NARVIELIAAYRNRGHLMADIDPLRLDKTRFRSD
KGD_MYCS2       --------------------------------------RVIELIAAYRNRGHLMADIDPLRLDNTRFRSD
KGD_MYCPA       --------------------------------------RVMELIAAYRNRGHLMADIDPLRLDGSRFRS-
KGD_MYCBP       --------------------------------------RVMNLIAAYRNRGHLMADTDPLRLDKARFRS-
KGD_MYCBO       --------------------------------------RVMNLIAAYRNRGHLMADTDPLRLDKARFRS-
KGD_MYCTU       --------------------------------------RVMNLIAAYRNRGHLMADTDPLRLDKARFRS-
KGD_MYCTA       --------------------------------------RVMNLIAAYRNRGHLMADTDPLRLDKARFRS-
KGD_MYCUA       --------------------------------------RIIELIAAYRNRGHLMADIDPLRLDKTRFRS-
ODO1_CORGL      --------------------------------------RVMQLIEAYRSRGHLIADTNPLGMPVPDHRD-
ODO1_OCEIH      ---------------LSSTENVKSVNASDFDVTKLTS--AIRLVEAIRRYGHTDADIYPVGGYKGDRSKM
ODO1_BACSU      ----------------------------DLIQKIASAVRLAEDIRTY---GHLNASVNPL--RKDEKKSE
ODO1_STAAU      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAN      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAW      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAT      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAS      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAE      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAC      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAA8      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAA3      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAAM      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAA9      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAA2      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_STAA1      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_BUCBP      -------------------------DSKDTIKLTIE-----LLINIFRTLGYKFAHLNPLDTFKNDNXXX
DHTK1_XENLA     ------------------------------------------LVTAYREHGHKAAKINPL--FTGQAVMD
ODO1_STAAR      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_GEOSW      -------------------------------------VAAVKLADKIRHYGHLAADINPLN---TQNKDT
ODO1_BACA2      ----------------------------DLIQKIAAAVKLAEDIRTY---GHLNASVNPL--RKDPKKSE
ODO1_BACSK      ------------------EENVSSSNAKETIGADMISVGAVRLADYIRAKGHLVSDIQPIWKTDKNS-NL
DHTK1_DROME     --------------------------AEDVRASRNSQANVYRFVEAFRQHGHKLAAVNPISIRTSQQLQE
ODO1_STAES      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPERQNVPK
ODO1_STAEQ      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPERQNVPK
DHTK1_DANRE     ------------------------------------------LVEAYRAHGHKVAKINPL-LPQSPVLES
ODO1_EXISA      ---------------------LEKV------------VSATRLINDIRAFGHKAADIYPLKDHPREQLFE
ODO1_BACLD      -----------------------KNEEADFTAGSIQKIAAVKLAEDIRTYGHLNASVNPL--RKTQEKQE
ODO1_BACHD      ----------------------ASITDPDVIKKFVGAVKLADHIRAF---GHLAADIQPI-LKEQRREDM
ODO1_STAS1      ----------------NGEANIATEGQSNVTKGDSTIKRVMRLIDNIRQYGHLLADIYPVNRPQRENVPK
ODO1_STAAB      --------------------------------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPK
ODO1_BACHK      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMGANGQSLLEK
ODO1_BACCQ      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACC7      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACC4      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACAN      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACAC      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACAA      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACCR      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACC1      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
DHTK1_PONAB     ------------------------------------------LVTVYREHGHKAAKINPL--FTGQALLE
ODO1_BACC3      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLER
ODO1_BACC0      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
ODO1_BACCZ      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLER
ODO1_BACC2      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLLEK
DHTK1_MOUSE     ------------------------------------------LVTVYCEHGHKAAQINPL--FPGQALLD
ODO1_BACP2      ---------------------IGKKENSVVTSEQIQKIASVVLAEDIRTYGHLNASVNPL--RKEKELQE
ODO1_STAHJ      --------------------------------------RIMRLIDNIRQYGHLKADIYPVNAPKRTNLPK
ODO1_BACWK      -----------------NTGNIEKI------------LKVVQLVEQIRSFGHTLAHINPMAANGQSLIEK
ODO1_GEOKA      ----------------------------------------------------------------------
DHTK1_CAEEL     ----------------------------------------VHLINAFRRYGYLEADLDPLGLRKVESVAE
DHTK1_HUMAN     ------------------------------------------LVTVYCEHGHKAAKINPL--FTGQALLE
ODO1_BACCN      -------------------GDNKETNFSPQSTGNIETIKAVQVVENIRSFGHLSAHINPMEEPHDSLIET
DHTK1_RAT       ------------------------------------------LVTVYCEHGHKAAQINPL--FPGQALLD
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      ----------------------------------------------------------------------
ODPA_HUMAN      ----------------------------------------------------------------------
ODPA_PIG        ----------------------------------------------------------------------
ODPA_MACFA      ----------------------------------------------------------------------
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      ----------------------------------------------------------------------
ODPA_RAT        ----------------------------------------------------------------------
ODPA_MOUSE      ----------------------------------------------------------------------
ODPA_BOVIN      ----------------------------------------------------------------------
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      ----------------------------------------------------------------------
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      ----------------------------------------------------------------------
ODPA_YEAST      ----------------------------------------------------------------------
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LHPEHYGFKKENYDEKIYLDGVINKEHSSIKEILNFLNKTYCGPIGYEYMHISNPTERKWLRDRIEQDEN
ODO1_BRUC2      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUSU      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUSI      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUAB      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUA2      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUA1      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUME      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUMB      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_BRUO2      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_OCHA4      LEPENYGFTPADYNRKIFIDNVLGLEYATVPEMLDILKRTYCGTIGVEFMHISDPAEKAWIQERIEGPDK
ODO1_RALEH      LDPAFYGFSEADLDIVFNASNTFGKESMSLRELLNNLRETYCGTIGFEFMYVSDQAQKRWWQERLETTRS
ODO1_AZOVI      LSITHYGLTNADLDTPFRTGELIGKEEATLREILQALQETYCRTIGAEFTHIVDSEQRNWFAQRLESVRG
ODO1_RICFE      LNIETFGLDNSQLEKNINIDEFVGNWNCKLSELVTKLDKTYTGSIGVEFEQIENVEEKNWLYNKLESE--
ODO1_ECOLI      LDPSFHDLTEADFQETFNVGSFASKETMKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIESGRA
ODO1_ECOL6      LDPSFHDLTEADFQETFNVGSFASKETMKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIESGRA
ODO1_ECO57      LDPSFHDLTEADFQETFNVGSFASKETMKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIESGRA
ODO1_RICBR      LKLENFGFTNDQLSKVIFLEKTYN-----LGELVNFLDKTYAGSIGVXXXXXXXXXXKNWLYSKLES--G
ODO1_RICCN      LNIETFGLDSGQLEENINIDEFVGTWNCKLSELVTKFDKVYTGSIGVEFEQIENVAGKNWLYNKLESE--
ODO1_RICPR      LNIEAFGLDSSQLGENIIMDEFIGTWNCKLSELVTKLDKVYTSSIGVEFDQIENVEEKNWLYTKLETD--
ODO1_LEPIN      ---------RTFIDSKLHIDTVVDSERVKLAEIVDLYEKVYCNTIGAEHFYLVNDEEREWLQKKMESPEF
ODO1_LEPIC      ---------RTFIDSKLHIDTVVDSERVKLAEIVDLYEKVYCNTIGAEHFYLVNDEEREWLQKKMESPEF
ODO1_DICDI      FNPAKYGFTEADMDRPIFVEGFINKQETTLRQVLKRLKETYCGDIGIEYMHIQDREMCDWIRDKFETSQ-
ODO1_HAEIN      LDYRHHGFTEQDLNETFNINHYVYKRDTKLGELAQMLKETYCGSIGLEFMHVQDMEQKMWLQSKMESLLD
ODO1_RICTY      LNIEAFGLDSSQLEENINIDEFIGTWNCKLSELVTKLDKVYTSSIGVEFDQIENVEEKNWLYTKLETE--
ODO1_CAEBR      IPPEFYGLGERDLDREFLLPPISEKKSLTLREILQRLKEIYCTSTGVEYMHLNNLEQQDWIRRRFEAPRV
ODO1_YEAST      LTLDYYGFSKHDLDKEINLGGILGKSKMSLKEIVDHLEKLYCSSYGVQYTHIPSKQKCDWLRERIEIPE-
ODO1_SCHPO      LTLEHYGFTESDLNRTIHLGGILGRKTMTLREIVETCEKIYCGSFAVEFTHISSRKRSNWILSHLETP-T
ODO1_CAEEL      IPPEFYGLGERDLDREFLLPPISEKKSLTLREILQRLKDIYCTSTGVEYMHLNNLEQQDWIRRRFEAPRV
ODO1_COXBU      LELGHYNLTESDFNKTFATYGLLNKPKATLKEIYTRLREIYCGSIGVQYSTISDERERNWLRDYVEQRLP
OGDHL_XENLA     FVPSDYGLHEGDLDKVFYIGGTDST--LSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETP-G
ODO1_MOUSE      SVPADYGLHESDLDKVFHLPTTTQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETP-G
ODO1_MACFA      SVPADYGLDESDLDKVFHLPTTIGGQESALREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETP-G
ODO1_HUMAN      SVPADYGLDESDLDKVFHLPTTIGGQESALREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETP-G
ODO1_RAT        SVPADYGLHESDLDKVFHLPTTTQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETP-G
ODO1_PONAB      SVPADYGLDESDLDKVFHLPTTIGGQESALREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETP-G
ODO1_BUCAI      LDLSFYNFTEEETRQTVEINFKCTNFRTNIISLYKILYKKYCGSIGFEYMYVNNLLEKQWITNHIESFFN
ODO1_BOVIN      SVPADYGLDESDLDKVFHLPTTIGGQESALREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETP-G
ODO1_XENLA      CVPADYGLQESDLDKVFHLPTTTNEMALPLREIIRRLENAYCQHIGVEFMFINDLEQCQWIRQKFEAP-G
OGDHL_HUMAN     FVPSDYDLQEADLDKEFQLPTTTSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETP-G
KGD_MYCSS       -HPDTHGLTLWDLDREFKVNGFAGAERKKLRDVLAVLRDAYCRHIGVEYTHILEPEQQQWLQERIEGKHE
KGD_MYCSK       -HPDTHGLTLWDLDREFKVNGFAGAERKKLRDVLAVLRDAYCRHIGVEYTHILEPEQQQWLQERIEGKHE
KGD_MYCSJ       -HPDTHGLTLWDLDREFKVNGFAGAERKKLRDVLAVLRDAYCRHIGVEYTHILEPEQQQWLQERIEGKHE
OGDHL_PONAB     FVPSDYDLQEADLDKEFQLPTTTSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETP-G
ODO1_BUCAP      LEPTFYHFSEDELKKTVKIDFKNSSQYEKIRDLYEQLNNKYCGSIGFEYMYIENSFEKKWITKHIELFFK
KGD_MYCLE       -HPDTHGLTLWDLDRVFKVNGFGGWKYKKLRDVLGLLRDAYCRHIGVEYTHILDPEQQEWLQQRVET--K
KGD_MYCVP       LDVNTHGLTLWDLDREFKVNGFAGKTHKKLRDILGLLRDAYCRHIGVEYTHILEPEQQQWLQERIEVKHE
KGD_MYCS2       LDVNSHGLTLWDLDREFKVDGFAGVQRKKLRDILSVLRDAYCRHVGVEYTHILEPEQQRWIQERVETKHD
KGD_MYCPA       -HPDNHGLTLWDLDRVFKVNGFAGAEYKKLRDILGLLRDAYCRHIGVEYTHILDPEQQEWLQQRVETKH-
KGD_MYCBP       -HPDTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKH-
KGD_MYCBO       -HPDTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKH-
KGD_MYCTU       -HPDTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKH-
KGD_MYCTA       -HPDTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKH-
KGD_MYCUA       -HPDTHGLTLWDLDRSFKVGGCFGPQNMKLRDVLSILRDTYCRHVGVEYTHILEPEQQQWLQQRVEAKH-
ODO1_CORGL      LDIETHNLTIWDLDRTFNVGGFGGKETMTLREVLSRLRAAYTLKVGSEYTHILDRDERTWLQDRLEA--G
ODO1_OCEIH      LDLSTYNLKEQDL-EKIPASWIWEKQAPGVADVVNQLKKYYTGTITFEYDHVNNDEERKWLFDLIEEGNA
ODO1_BACSU      LFPSDYGLTEEEI--KAIPASVICKDASNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTRKIESGE-
ODO1_STAAU      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAN      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAW      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAT      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAS      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAE      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAC      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAA8      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAA3      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAAM      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAA9      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAA2      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_STAA1      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_BUCBP      XXXXXXXXEQDSYLVKLVLDDI------TTKNVYDDYKNIYCKRIGYQFMHIHNSNEMNWIKNYIET-KH
DHTK1_XENLA     MVPEIQEIM-EILHGPFSTTGLLNKSEATIEEVLAYLDHTYCGQISIETSQLQNYKEREWFSRRFEELKQ
ODO1_STAAR      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_GEOSW      RRIELSEFDLTEDDLKIPVAFICPHAPAHVKDAINHLRKIYTDKIAFEFSQVHNLEERNWLISQIESGAY
ODO1_BACA2      LFPSDYGLTEE--EMKAIPASVICKDATNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGE-
ODO1_BACSK      LDYDRFNVTEEEL-KKVPVKLICKDAPPHLKEAIEHLKKVYTQTMAFEFGHVQDEEERNWLRKQVESEAY
DHTK1_DROME     LSPAFYGLQTQ---EPVRTDGLLSGPQHNVAQLEQLLKDIYCGSTSAEFSYVEDIEEREWLARNFETLDQ
ODO1_STAES      LEIEDFDLDKETL-EKIS-SGIVSEHFKDIYDAIVRMERRYKGPIAFEYTHINNNKERVWLKRRIETPYK
ODO1_STAEQ      LEIEDFDLDKETL-EKIS-SGIVSEHFKDIYDAIVRMERRYKGPIAFEYTHINNNKERVWLKRRIETPYK
DHTK1_DANRE     V-PEISLLNGA-------VRGVLNKAEATAEEVVAYLESTYCGGISVETSQLQTLEEREWFADRFEELKK
ODO1_EXISA      L--SRYDLTEEDLKQARLLSDDAPKPNASALELFRHLLDVYTGTVAIELRHLDDMEEKKWIRRQVEQGAL
ODO1_BACLD      LFPAEYGLTEQDV-KKIPASVICKKEVTNGLEAIQYLRNTYKKSISFEFDHVHIFEERNWLMKKIESGEL
ODO1_BACHD      FDLDRFGLTESDI-RSVPVDLLCPYAPAHVKDAINHLKEVYTKTIAFEFVHVTDEEERKWLNRMIESGLY
ODO1_STAS1      LNMEDFNLDQETLES--ISAGIVSEHFKDIYEAIVRMEKRYKGPIAFEYTHINNNRERVWLKRRIETPYK
ODO1_STAAB      LEIEDFDLDQQTLEG--ISAGIVSDHFADIYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYK
ODO1_BACHK      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACCQ      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQTLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACC7      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQTLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACC4      AMSELSDADLKAIPAKTVWPDAPEGIHTAL-DVIHRLKDVYTKSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACAN      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACAC      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACAA      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACCR      AMSELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKDVYTKSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACC1      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQTLAYEFSHIQDSEERAWLHQMVESNSL
DHTK1_PONAB     NVPEIQALV-QTLQGPFHTAGLLNKEEASLEEVLVYLNQIYCGQISIETSQLQSQEEKDWFAKRFEELQK
ODO1_BACC3      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACC0      AMNELSDADLKAIPAKTVWPDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACCZ      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_BACC2      AMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKDVYTKSLAYEFSHIQDSEERTWLHQMVESNSL
DHTK1_MOUSE     TVPEIQALVR-TLQGPFTTTGLLNKEAASLEEVLAYLNHIYCGPISIETAQLQSQEERDWFA-RXXXXXX
ODO1_BACP2      LFPKEYGLTEE--DVKNIPISIISKHISNGIEAINHLRNTYKRTISFEFDHVHDFEERNWLSKSIESGEL
ODO1_STAHJ      LEIEEFNLDKENVSAEIVSDH-FKDIYDNAYEAIERMEKRYKGPIAFEYNHINNNKERTWLKRRIETPYR
ODO1_BACWK      TMNELSDADLKAIPAKTVWQDAPEGIHTAL-DVIHRLKDVYTKSLAYEFSHIQDSEERAWLHQMVESNSL
ODO1_GEOKA      ------------------------------------LRKIYTDKIAFEFSQVHNLEERNWLIQQIESGAY
DHTK1_CAEEL     LDPAIYGL---SLDENV-------KGNFSLHDLAEQLRHIYCGPTAIEFMHINNWEERQWISQNFE---N
DHTK1_HUMAN     NVPEIQALV-QTLQGPFHTAGLLNKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQK
ODO1_BACCN      MMRELNDVDLKAIPAKTVWPDAPNDVHTAL-DAIHRLKDVYTKSLAYEFSHIQDSEERTWLHQMVESNSL
DHTK1_RAT       TVPEIQALV-QTLQGPFTTTGLLNKEEASLEEVLAYLNHIYCGPISIETAQLQSQEEKDWFA-RXXXXXX
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      ----------------------------------------------------------------------
ODPA_HUMAN      ----------------------------------------------------------------------
ODPA_PIG        ----------------------------------------------------------------------
ODPA_MACFA      ----------------------------------------------------------------------
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      ----------------------------------------------------------------------
ODPA_RAT        ----------------------------------------------------------------------
ODPA_MOUSE      ----------------------------------------------------------------------
ODPA_BOVIN      ----------------------------------------------------------------------
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      ----------------------------------------------------------------------
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      ----------------------------------------------------------------------
ODPA_YEAST      ----------------------------------------------------------------------
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SLQFTKNGKEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
ODO1_BRUC2      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUSU      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUSI      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUAB      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUA2      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUA1      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUME      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUMB      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_BRUO2      KVAFTPEGKMAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVLGMAHR
ODO1_OCHA4      KVAFTPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGAMGVKEIIFGMAHR
ODO1_RALEH      KPVFTLEKKKHILDRLTAAEGLERFLHTKYVGQKRFSLEGGESFIAAMDELIQHAGSKGVQEIVIGMAHR
ODO1_AZOVI      RPVYSKEAKSHLLERLSAAEGLEKYLGTKYPGTKRFGLEGGESLVPVVDEIIQRSGSYGTKEVVIGMAHR
ODO1_RICFE      -VTFSSEDKKTILNDLVEVEGFEQYLHTKFPGAKRFSVEGGDASIVAMSKAIDLSMNQGVEEIVIGMAHR
ODO1_ECOLI      T--FNSEEKKRFLSELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHR
ODO1_ECOL6      T--FNSEEKKRFLSELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHR
ODO1_ECO57      T--FNSEEKKRFLSELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHR
ODO1_RICBR      VISFSSEEKKNILNDLVEVEGFEQYLHTKFPGAKRFSVEGGDASIVAMNKAIDLSLHQGVEEIVIGMAHR
ODO1_RICCN      -VTFSSEDKKTILNDLVEVEGFEQYLHTKFPGAKRFSIEGGDASIVAMSKAIDLSMHQGVSEIVIGMAHR
ODO1_RICPR      -ITFTSEEKKSILNDLVEVECFEQFLHIKFPGAKRFSIEGGDASIVAMNKAIDLSMHQGVEEIVIGMAHR
ODO1_LEPIN      LAPLPRGIKLRLFEKLFQADYFETFLAKKYVGKKRFSLEGGESFIPLLDTIVEEAGYHQMDGLVIGMAHR
ODO1_LEPIC      LAPLPRGIKLRLFEKLFQADYFETFLAKKYVGKKRFSLEGGESFIPLLDTIVEEAGYHQMDGLVIGMAHR
ODO1_DICDI      PVEIPDKEKIKILERLSWADQFEGFLGLKYRATRRFGLDGCESLIPGMKAMIDTATEDGVESIVLGMPHR
ODO1_HAEIN      KPLFTSEERVNFLRELTAADGLERYLGAKFPGAKRFSLEGSDAFIPLMKEIIRHSSRQGVNDVVMGMAHR
ODO1_RICTY      -ITFASEEKRSILNDFVEVECFEQFLHTKFPGAKRFSIEGGDSSIVAMNKAIDLSMNQGVEEIVIGMAHR
ODO1_CAEBR      T-ELSHDQKKVLFKRLIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAIKQVIDSSSTLGVDSFVIGMPHR
ODO1_YEAST      PYQYTVDQKRQILDRLTWATSFESFLSTKFPNDKRFGLEGLESVVPGIKTLVDRSVELGVEDIVLGMAHR
ODO1_SCHPO      PFRYSHDQKIMIFDRLSWADSFERFLFTKFPNDKRFGLEGCEAMVPGMKALIDRSVDEGISNIVIGMAHR
ODO1_CAEEL      T-ELSHDQKKVLFKRLIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHR
ODO1_COXBU      SIEFDKETKRNILQQLVTAESLEKYLDTKYVGQVRYSLEGGDSLIPLLDELTKRARHQKIEEIVICMAHR
OGDHL_XENLA     IMKFINEEKRTLLARLIRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKAIIDKSSEMGLEYVILGMPHR
ODO1_MOUSE      IMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHR
ODO1_MACFA      IMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHR
ODO1_HUMAN      IMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHR
ODO1_RAT        IMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHR
ODO1_PONAB      IMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHR
ODO1_BUCAI      ENVFTIEEKINFLKELTYAETLEKYIGKKFPGAKRFSLEGAETLIPVLHEVIRFSKKNNISKIVLGMAHR
ODO1_BOVIN      VMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENGVDYVIMGMPHR
ODO1_XENLA      IMQFNNEEKRTLLARLVRSTRFEEFLHRKWSSEKRFGLEGCEVLIPALKTIIDKSSGNGVDYVIMGMPHR
OGDHL_HUMAN     VMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHR
KGD_MYCSS       KPTVAQ--QKYILSRLNAAEAFETFLQTKYVGQKRFSLEGAETVIPAMDAVIDQCAEHALDEVVIGMPHR
KGD_MYCSK       KPTVAQ--QKYILSRLNAAEAFETFLQTKYVGQKRFSLEGAETVIPAMDAVIDQCAEHALDEVVIGMPHR
KGD_MYCSJ       KPTVAQ--QKYILSRLNAAEAFETFLQTKYVGQKRFSLEGAETVIPAMDAVIDQCAEHALDEVVIGMPHR
OGDHL_PONAB     VMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHR
ODO1_BUCAP      ENLFIKKEKIRFLKEILYGETFEKYLGKKFSGTKRFSLEGGETLISILHEIIRYSKKNDVSEIILGMAHR
KGD_MYCLE       NVKPTVAEQKYILSKLNAAEAFETFLHTKYVGQKRFSLEGAESVIPMMDAAIDQCAKHGLDEVVIGMPHR
KGD_MYCVP       KPTVAE--QKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAAIDQCAEHGLDEVVIGMPHR
KGD_MYCS2       KPTVAE--QKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVVIAMPHR
KGD_MYCPA       -VKPTVAEQKFILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHR
KGD_MYCBP       -VKPTVAQQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHR
KGD_MYCBO       -VKPTVAQQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHR
KGD_MYCTU       -VKPTVAQQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHR
KGD_MYCTA       -VKPTVAQQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHR
KGD_MYCUA       -VKPTVAQQKYVLSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEYGLDEVVIGMPHR
ODO1_CORGL      MPKPTQAEQKYILQKLNAAEAFENFLQTKYVGQKRFSLEGAEALIPLMDSAIDTAAGQGLDEVVIGMPHR
ODO1_OCEIH      RLDPSDDERKKILQRLADVEGFEKFLHKTFVGQKRFSIEGLESMVPMIDHIVQYSNQDSIEHVMMGMAHR
ODO1_BACSU      --LFQKNSAEAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTTSVNIGMAHR
ODO1_STAAU      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAN      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAW      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAT      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAS      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAE      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAC      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAA8      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAA3      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAAM      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAA9      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAA2      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_STAA1      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_BUCBP      SNXXXXXXXXXXXXXXXXSEMLEKYFSSKFPSIKRFSIEGAESLIPMLKEVIKYTKKFNLHKIIFGMSHR
DHTK1_XENLA     E-SFSTEERKHLARLMLECQEFDHFLATKFSTVKRYGGEGAESMMGFFHEMLKMCSFGGVTDVIIGMPHR
ODO1_STAAR      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_GEOSW      YPSLTNEEKVALLRRLTEVEGFEKFLHRTFVGQKRFSIEGLDSMVPLLDELIRHSIEEEVKAVNIGMAHR
ODO1_BACA2      --LFRKNSPEAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTTNVNIGMAHR
ODO1_BACSK      ADELPNKEKKALLERLTSVEGFEKFIHRTFVGQKRFSIEGLDTLVPMLDKAIREVRKEKTDHVMIGMAHR
DHTK1_DROME     Q-QLGKSERCEIAELLIKSQAWDNFMALKFPTVKRYGGEGAESMLAFFWQLLRDSVQANIEHVVLAMPHR
ODO1_STAES      A-SLNDNQKKELFKKLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTITLAGNEGIKNIQIGMAHR
ODO1_STAEQ      A-SLNDNQKKELFKKLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTITLAGNEGIKNIQIGMAHR
DHTK1_DANRE     EA-FSPEERRMLAKLMLESQEFDHFLATKFATVKRYGGEGAESMMGFFYELFRSSVYSGVTDVVMGMPHR
ODO1_EXISA      QQTFSKEEKIELFKRLAETELFESFLHKTYVGQKRFSIEGLDAMVPLLDAMVGGLISSGSEHINIGMAHR
ODO1_BACLD      FTPKSKEKLVEVLRRLTEVESLEQFLHKTFVGQKRFSIEGLDALVPMLDDIIAKSVSAGTTNVNIGMAHR
ODO1_BACHD      LPNLSTEQRKSLLKRLTDVEGFEKFLHRTFVGQKRFSIEGLDTLVPMLDEVVREAVHEGTTNVMIGMAHR
ODO1_STAS1      AT-LNDNQKIELFKNLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQQTLRIASDEGIQNIQIGMAHR
ODO1_STAAB      -VTLNNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGMAHR
ODO1_BACHK      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACCQ      RQPLSNQKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACC7      RQPLSNQKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACC4      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACAN      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACAC      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACAA      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACCR      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACC1      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
DHTK1_PONAB     ET-FTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAESMMGFFYELLKMSAYSGITDVIIGMPHR
ODO1_BACC3      RQPLSNQKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACC0      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACCZ      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
ODO1_BACC2      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVMIGMAHR
DHTK1_MOUSE     XXXXXXXXXXYLSKLLLESQEFDHFLATKFATVKRYGGEGAESMMGFFHELLKLSAYGGITDIIIGMPHR
ODO1_BACP2      FKKKPADKLVSVFKRLTEVEQFEQFLHKTFVGQKRFSIEGLDALVPVLDEIISESVTQGTSNINIGMAHR
ODO1_STAHJ      A-NINNDERKKLFDTLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTLKRAAEIEINNIQIGMAHR
ODO1_BACWK      RQPLSNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVSEGAKGGVEDVMIGMAHR
ODO1_GEOKA      YPSLANKERVALLRRLTEVEGFEKFIHRTYVGQKRFSIEGLDSMVPLLDELVRQAIEHEIDAVNIGMAHR
DHTK1_CAEEL     CIAEELRKEELLRIGMLKCENFDKFLSTKFPTLKRYGAEGAESMFAFFSELFEGAAEKQVEEIIIGIAHR
DHTK1_HUMAN     ET-FTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAESMMGFFHELLKMSAYSGITDVIIGMPHR
ODO1_BACCN      RQPLSNQKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEMIAEGAKAGVEDVMIGMAHR
DHTK1_RAT       XXXXXXXXXXHLSKLLLESQEFDHFLATKFATVKRYGGEGAESMMGFFHELLKLSAYGGITDIIIGMPHR
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      ----------------------------------------------------------------------
ODPA_HUMAN      ----------------------------------------------------------------------
ODPA_PIG        ----------------------------------------------------------------------
ODPA_MACFA      ----------------------------------------------------------------------
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      ----------------------------------------------------------------------
ODPA_RAT        ----------------------------------------------------------------------
ODPA_MOUSE      ----------------------------------------------------------------------
ODPA_BOVIN      ----------------------------------------------------------------------
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      ----------------------------------------------------------------------
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      ----------------------------------------------------------------------
ODPA_YEAST      ----------------------------------------------------------------------
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      ------------------------------------------------EAVISAVDMVKQKEDSMVTSYR
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
ODO1_BRUC2      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUSU      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUSI      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUAB      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUA2      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUA1      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUME      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUMB      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_BRUO2      GRLNVLSQVMGKPHRAIFHEFKGGSYTPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_OCHA4      GRLNVLSQVMGKPHRAIFHEFKGGSYAPDDEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHLEIVNPV
ODO1_RALEH      GRLNVLVNTLGKMPADLFAEFEG--KHVDDLPAGDVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPV
ODO1_AZOVI      GRLNLLVNALGKNPRDLFDEFEGKHLV--ELGSGDVKYHQGFSSNVMTSGGEVHLAMAFNPSHLEIVSPV
ODO1_RICFE      GRLNTLTKVVGKPYKAVIAGFSGSVFPDELNVSGDVKYHLGYSSDRTIDNKKIHLSLADNPSHLEAVNPI
ODO1_ECOLI      GRLNVLVNVLGKKPQDLFDEFAG--KHKEHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPV
ODO1_ECOL6      GRLNVLVNVLGKKPQDLFDEFAG--KHKEHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPV
ODO1_ECO57      GRLNVLVNVLGKKPQDLFDEFAG--KHKEHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPV
ODO1_RICBR      GRLNTLTKVVGKPYRAVIAGFSGSVFPDELNVSGDVKYHLGYSSDRVVGDKKIHLSLADNPSHLEAVNPI
ODO1_RICCN      GRLNTLTKVVGKPYKAVIADFSGSVFPDELNVSGDVKYHLGYSSDRTLEDKKIHLSLADNPSHLEAVNPI
ODO1_RICPR      GRLNTLTKVVGKPYKEVIASFIGNIFPDGLNVSGDVKYHLGYSADRVRANQKIHLSLADNPSHLEAINSI
ODO1_LEPIN      GRLNVLVNIIEKPASLIFAEFEEKTDKDNLSYA-DVKYHLGYSNSRTTSGKEVKLSLAFNPSHLECVDPV
ODO1_LEPIC      GRLNVLVNIIEKPASLIFAEFEEKTDKDNLSYA-DVKYHLGYSNSRTTSGKEVKLSLAFNPSHLECVDPV
ODO1_DICDI      GRLNVLANVVRKPLPAIFNEFNGGISIEGEYSAGDVKYHLGTSYDRTSSGKKVHLSLVANPSHLEAVNPL
ODO1_HAEIN      GRLNMLVNVLGKKPENLFDEFAGK---HSSERTGDVKYHQGFSSDFAVDDKRVHLTLAFNPSHLEIVSPV
ODO1_RICTY      GRLNTLTKVVGKPYKAVIAGFIGNVFPDELNISGDVKYHLGYSADRVRANQKIHLSLADNPSHLEAINSI
ODO1_CAEBR      GRLNVLANVCRQPLATILSQFS--TLEPADEGSGDVKYHLGVCINRQSQKN-VKIAVVANPSHLEAVDPV
ODO1_YEAST      GRLNVLSNVVRKPNESIFSEFKGSSARDDIEGSGDVKYHLGMNYQRPTSGKYVNLSLVANPSHLESQDPV
ODO1_SCHPO      GRLNLLHNIVRKPAQAIFSEFRGT-QDPDDEGSGDVKYHLGMNYQRPTSGKRVSLSLVANPSHLEAEDPV
ODO1_CAEEL      GRLNVLANVCRQPLATILSQFS--TLEPADEGSGDVKYHLGVCINRQSQKN-VKIAVVANPSHLEAVDPV
ODO1_COXBU      GRVNVLLNIMGQSAAELFQEFEG----KKDYGSGDVKYHRGYSRDVKTDAGPIHLSLAFNPSHLEFICPV
OGDHL_XENLA     GRLNVLANVIRKDLDQIFCQFDPKLEAS-DEGSGDVKYHLGMYHERRATNKKITLSLVANPSHLEAVDPV
ODO1_MOUSE      GRLNVLANVIRKELEQIFCQFDSKLEAA-DEGSGDMKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
ODO1_MACFA      GRLNVLANVIRKELEQIFCQFDSKLEAA-DEGSGDVKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
ODO1_HUMAN      GRLNVLANVIRKELEQIFCQFDSKLEAA-DEGSGDVKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
ODO1_RAT        GRLNVLANVIRKELEQIFCQFDSKLEAA-DEGSGDMKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
ODO1_PONAB      GRLNVLANVIRKELEQIFCQFDSKLEAA-DEGSGDVKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
ODO1_BUCAI      GRLNVLINVLNKSPKVLFDEFSN--LNLFQKISGDVKYHMGGTAEIQYE-KKIIFHMACNPSHLEIINPV
ODO1_BOVIN      GRLNVLANVIRKELEQIFCQFDSKLEAA-DEGSGDVKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
ODO1_XENLA      GRLNVLANVIRKELEQIFCQFDSKLEAT-DEGSGDVKYHLGMYHNRVTDRN-ITLSLVANPSHLEAADPV
OGDHL_HUMAN     GRLNVLANVIRKDLEQIFCQFDPKLEAA-DEGSGDVKYHLGMYHERRVTNRNITLSLVANPSHLEAVDPV
KGD_MYCSS       GRLNVLANIVGKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGSSGTQMFGDNDITVSLTANPSHLEAVDPV
KGD_MYCSK       GRLNVLANIVGKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGSSGTQMFGDNDITVSLTANPSHLEAVDPV
KGD_MYCSJ       GRLNVLANIVGKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGSSGTQMFGDNDITVSLTANPSHLEAVDPV
OGDHL_PONAB     GRLNVLANVIRKDLEQIFCQFDPKLEAA-DEGSGDVKYHLGMYHERRVTNRNITLSLVANPSHLEAVDPV
ODO1_BUCAP      GRXXXXXXXXXXXXXXXFNEFSGI--NIPKEYSGDVKYHMGGXXXXXXXXXXXXXXLAYNPSHLEIVNPV
KGD_MYCLE       GRLNVLANIVGKPYSQIFTEFEGNLNPTLAHSSGDVKYHLGATGLQMFGDNDIQVSLTANPSHLEAVDPV
KGD_MYCVP       GRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGANGTQMFGDNDIDVSLVANPSHLEAVDPV
KGD_MYCS2       GRLNVLANIVGKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGATGTQMFGDNDIEVSLTANPSHLEAVDPV
KGD_MYCPA       GRLNVLANIVGKPYSQIFSEFEGNLNPAQAHGSGDVKYHLGATGVQMFGDNDIQVSLTANPSHLEAVDPV
KGD_MYCBP       GRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLQMFGDNDIQVSLTANPSHLEAVDPV
KGD_MYCBO       GRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLQMFGDNDIQVSLTANPSHLEAVDPV
KGD_MYCTU       GRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLQMFGDNDIQVSLTANPSHLEAVDPV
KGD_MYCTA       GRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLQMFGDNDIQVSLTANPSHLEAVDPV
KGD_MYCUA       GRLNVLANIVGKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGATGVQMFGDNDIQVSLTANPSHLEAVDPV
ODO1_CORGL      GRLNVLFNIVGKPLASIFNEFEGQMEQGQIGGSGDVKYHLGSEGQQMFGDGEIKVSLTANPSHLEAVNPV
ODO1_OCEIH      GRLSVLANVLGKPYDKIFSEFTKEKELMPSEGSGDVKYHYGAEKEVEFGNKGTRITLAHNPSHLEFVNPV
ODO1_BACSU      GRLNVLAHVLGKPYEIIFSEFQHAVPSEGSIGTGDVKYHLGANREQDAETKSARITLANNPSHLEFINPI
ODO1_STAAU      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAN      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAW      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAT      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAS      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAE      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAC      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAA8      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAA3      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAAM      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAA9      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAA2      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_STAA1      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_BUCBP      GRLNVLANILDKPIKTIXXXXXXXXXXXXXXG--DVKYHMGFCCTKTIGLRKIILDLKSNPSHLEVINPV
DHTK1_XENLA     GRLNLLTGLLQFPPELMFRKMRGLSEPENSPSIGDVLSHLTSSVDLDFGSHRLHVTMLPNPSHLEAINPV
ODO1_STAAR      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_GEOSW      GRLNVLAHVLGKPYEMIFAEFAESKDFMPSEGSGDVKYHLGAARRRNKNEHTMRITLANNPSHLEVVNPV
ODO1_BACA2      GRLNVLAHVLGKPYEIIFSEFQHAVPSEGSTGTGDVKYHLGADRQQDAETKSARITLANNPSHLEFINPI
ODO1_BACSK      GRLNVLAHTLGKPYKAIFSEFAPNKLNAPSEGTGDVKYHLGADRQISDDKSATIVSLANNPSHLEFVSPI
DHTK1_DROME     GRTPLQAALLNMRPAKVFRKLSGASEFSEDEAMSDVISHFHVSEQLKILGKKLSFSMVRNPSHLEAANPV
ODO1_STAES      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSSDVKYHLGGVKTTNSYGIEQRISLANNPSHLEIVAPV
ODO1_STAEQ      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSSDVKYHLGGVKTTNSYGIEQRISLANNPSHLEIVAPV
DHTK1_DANRE     GRLNLLTGLLQFPPELMFRKMRGLSEPEHSPSIGDVLSHLTSTVELDFGGHPLHVTMLPNPSHLEAINPV
ODO1_EXISA      GRLNVLAHVLGKPYEMIFAEFQHAIPSEGSIGSGDVKYHLGLDRKVVEQQKEVRLNLANNPSHLEFVGSV
ODO1_BACLD      GRLNVLAHVLGKPYEIIFSEFQHAVPSEGSTGTGDVKYHLGANRQQDEHTKTARIALANNPSHLEFIDPI
ODO1_BACHD      GRLNVLAHVLNKPYEMIFAEFLHSLNSEGSIGTGDVKYHLGADRQRDENTAEARLTLANNPSHLEFVSPI
ODO1_STAS1      GRLNVLTHVLEKPYEMMISEFMGSLQTSG--WTGDVKYHLGGVKTTQSYGSEQRISLANNPSHLEIVAPV
ODO1_STAAB      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGIKTTDSYGTMQRIALANNPSHLEIVAPV
ODO1_BACHK      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACCQ      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACC7      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACC4      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACAN      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACAC      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACAA      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACCR      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACC1      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
DHTK1_PONAB     GRLNLLTGLLQFPPELMFRKMRGLSEFPENFSAGDVLSHLTSSVDLDFGAHHLHVTMLPNPSHLEAVNPV
ODO1_BACC3      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACC0      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACCZ      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
ODO1_BACC2      GRLSVLAHVLEKPYSHMFAEFKGAVANSG--WTGDVKYHLGREQVVSNEEVSTRVTLANNPSHLEFVNPV
DHTK1_MOUSE     GRXXXXXXXXXXXXXXMFRKMRG-LSEFPENVAGDVLSHLTSSVDLDFGAHQLHVTMLPNPSHLEAVNPV
ODO1_BACP2      GRLNVLAHVLGKPYEIIFSEFAPNKELVPSEGSGDVKYHLGADRQKDEDTKSARVTLANNPSHLEFIDPI
ODO1_STAHJ      GRLNVLTHVLEKPYEMMISEFTDPMKFLPEDGSGDVKYHLGGVKTTSSYGIEQRISLANNPSHLEIVAPV
ODO1_BACWK      GRLSVLAHVLEKPYSHMFAEFKGAVANAG--WTGDVKYHLGREQVVGNEEVSTRVTLANNPSHLEFVNPV
ODO1_GEOKA      GRLNVLAHVLGKPYEMIFAEFAESKNFIPSEGSGDVKYHLGAARRRNQSAHTMRITLANNPSHLEVVNPV
DHTK1_CAEEL     GRLNLLTQLMDFPPVHMFRKIKGRAEPESADAAGDVLSHLVSSFDYKGSEGNVHVTMLPNPSHLEAVNPV
DHTK1_HUMAN     GRLNLLTGLLQFPPELMFRKMRGLSEFPENFSAGDVLSHLTSSVDLYFGAHHLHVTMLPNPSHLEAVNPV
ODO1_BACCN      GRLSVLAHVLEKPYSHMFAEFKSDDKTNHNAGTGDVKYHLGREQVVGNETVRTRVTLANNPSHLEFVNPV
DHTK1_RAT       GRXXXXXXXXXXXXXXMFRKMRGLSEFPENVAAGDVLSHLTSSVDLDFGAHRLHVTMLPNPSHLEAINPV
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      --------------------------------------------------------------------PL
ODPA_HUMAN      --------------------------------------------------------------------PL
ODPA_PIG        --------------------------------------------------------------------PL
ODPA_MACFA      --------------------------------------------------------------------PL
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      --------------------------------------------------------------------PL
ODPA_RAT        --------------------------------------------------------------------PL
ODPA_MOUSE      --------------------------------------------------------------------PL
ODPA_BOVIN      --------------------------------------------------------------------PL
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      --------------------------------------------------------------------PL
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      --------------------------------------------------------------------PL
ODPA_YEAST      --------------------------------------------------------------------PL
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      DHAHIILAGTEPKY--VLAELMGRA-TGCSKGKGG-SMHLFDVPNKFYGGHGI----------VGAQVPI
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ---------------------------------------------------------------LGAGAPL


                         .         .         .         .         *         .         .:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
ODO1_BRUC2      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUSU      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUSI      VMGKARAKQDLLVGRERPKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUAB      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUA2      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUA1      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUME      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUMB      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_BRUO2      VMGKARAKQDLLVGRERAKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_OCHA4      VMGKARAKQDLLAGRTRDKVLPLLLHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPA
ODO1_RALEH      VEGSAKARQERRGEVGHKEVLPVQVHGDAAFAGQGVVMETLNLAQTRGYGTGGSMHIVINNQIGFTTSPR
ODO1_AZOVI      VEGSVRARQDRRVDATGEKVVPISIHGDSAFAGQGVVMETFQMSQIRGYKTGGTIHIVVNNQVGFTTSPV
ODO1_RICFE      VAGKVRAKQDILGDTKRSKVKAILVHGDAAFCGQGVVAESLSMSPLAAYDIGGILHFVINNQLGFTANAA
ODO1_ECOLI      VIGSVRARLDRLDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSPL
ODO1_ECOL6      VIGSVRARLDRLDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSPL
ODO1_ECO57      VIGSVRARLDRLDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSPL
ODO1_RICBR      FAGKVRAKQDMLKDNKRSKVKAILVHGDAAFCGQGVVAESLSMSPLAAYNIGGVLHFVINNQLGFTANAA
ODO1_RICCN      VAGKVRAKQDILGDTKRSKVKAILVHGDAAFCGQGVVAESLSMSPLAAYDIGGILHFVINNQLGFTANAA
ODO1_RICPR      VAGKVRAKQDIFVDTKRSKIKAILVHGDAAFCGQGVVAESLSMSPLTAYNVGGILHFVINNQLGFTANAA
ODO1_LEPIN      VTGSVRARQTLIGDKDRSKYMPILIHGDAAFAGQGVVAETLNLMNLEGYTTGGTFHIVVNNQIGFTTLPD
ODO1_LEPIC      VTGSVRARQTLIGDKDRSKYMPILIHGDAAFAGQGVVAETLNLMNLEGYTTGGTFHIVVNNQIGFTTLPD
ODO1_DICDI      VEGKVRAKQHYSKDTEQKKSMAVQLHGDASVAGQGVVYETLHLSNLDNYSTGGTVHIVVNNQIGFTTNPK
ODO1_HAEIN      VIGSVRSRQTRMNDTEHSKVLAITVHGDSAVAGQGVVQETLNMSNTRGYSVGGTIRIVINNQIGFTTSPN
ODO1_RICTY      VAGKVRAKQDMLVDTKRSKVKAILLHGDAAFCGQGVVAESLSMSPLTAYNVGGILHFVINNQLGFTANAA
ODO1_CAEBR      VMGKVRAEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPR
ODO1_YEAST      VLGRTRALLHAKNDKEKTKALGVLLHGDAAFAGQGVVYETMGFLTLPEYSTGGTIHVITNNQIGFTTDPR
ODO1_SCHPO      VLGKVRAIQHYTSDESHEQSMGILIHGDAAFAAQGVVYETFGLHALPGYSTGGTVHIVINNQIGFTTDPR
ODO1_CAEEL      VMGKVRAEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPR
ODO1_COXBU      AMGSVRARQERQNGHKRDYAMTVMIHGDASFSGEGIVMEALSMSQTRAHHVGGSIHIILNNQVGFTTSPH
OGDHL_XENLA     VQGKTKAEQFYRGDTEGNKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGTIHIVVNNQIGFTTDPR
ODO1_MOUSE      VMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYXXXXXXXXXXNNQIGFTTDPR
ODO1_MACFA      VMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYXXXXXXXXXXNNQIGFTTDPR
ODO1_HUMAN      VMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYXXXXXXXXXXNNQIGFTTDPR
ODO1_RAT        VMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYXXXXXXXXXXNNQIGFTTDPR
ODO1_PONAB      VMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYXXXXXXXXXXNNQIGFTTDPR
ODO1_BUCAI      VSGISRSYIDNMKNID-NEVLPISIHGDASVIGQGVVQETLNMSQTEGYKVGGTVHIIINNQIGFTTSPK
ODO1_BOVIN      VMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYXXXXXXXXXXNNQIGFTTDPR
ODO1_XENLA      VQGKTKAEQFYCGDTEGKKVMAILLHGDAAFAGQGIVYETFHLSDLPSXXXXXXXXXXXNNQIGFTTDPR
OGDHL_HUMAN     VQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYXXXXXXXXXXXXQIGFTTDPR
KGD_MYCSS       MEGLVRAKQDLGDTEDGYTVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHLIVNNQIGFTTSPA
KGD_MYCSK       MEGLVRAKQDLGDTEDGYTVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHLIVNNQIGFTTSPA
KGD_MYCSJ       MEGLVRAKQDLGDTEDGYTVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHLIVNNQIGFTTSPA
OGDHL_PONAB     VQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYXXXXXXXXXXXXQIGFTTDPR
ODO1_BUCAP      VLGIARASINQLKISE-NKFLSINIHGDASIIGQGVIQETLNMSQTEAYKIGGTIHIVINNQIGFTTSPK
KGD_MYCLE       LEGLVRAKQLLNKDTNGNQVVPMMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPE
KGD_MYCVP       LEGLVRAKQDI-LDKGNGPVVPMMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIIVNNQIGFTTSPY
KGD_MYCS2       LEGLVRAKQDLLDTGERFSVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIVVNNQIGFTTAPT
KGD_MYCPA       LEGLVRAKQDLQGDEKAFSVVPMMLHGDAAFAGQGVVAETLNLTHLPGYRVGGTIHIIVNNQIGFTTAPE
KGD_MYCBP       LEGLVRAKQSIDSDGQRASVVPLMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPE
KGD_MYCBO       LEGLVRAKQSIDSDGQRASVVPLMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPE
KGD_MYCTU       LEGLVRAKQSIDSDGQRASVVPLMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPE
KGD_MYCTA       LEGLVRAKQSIDSDGQRASVVPLMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPE
KGD_MYCUA       LEGLVRAKQDLLEHGETDSVVPMMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPE
ODO1_CORGL      MEGIVRAKQYLDKGVDGKTVVPLLLHGDAAFAGLGIVPETINLAKLRGYDVGGTIHIVVNNQIGFTTTPD
ODO1_OCEIH      VEGFTRAAQDDRSEKGTNKAVSVLIHGDAAFIGEGVVAETLNLSGLPGYSTGGTLHIIANNLLGYTTDRE
ODO1_BACSU      VEGSTRAAQETRTQQDETKSLAILIHGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESA
ODO1_STAAU      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAN      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAW      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAT      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAS      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAE      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAC      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAA8      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAA3      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAAM      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAA9      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAA2      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAA1      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_BUCBP      VVGSSRAYIDSNDNLNDENILPIIIHGDAAISGQGVVQELLNMSQARGYKVGGTIHIVVNNQIGFTTSKK
DHTK1_XENLA     AVGKTRARQQSLSDGDYSKVVCLQVHGDASISGQGIVTETFTLSNLPHYRIGGSIHLIVNNQLGYTTPAE
ODO1_STAAR      VEGRTRAAQ---DDTQRHKAMPIIIHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_GEOSW      VLGFTRAAQEDRSNQDTDSAFAIMIHGDAAFPGQGIVAETLNLSRLQGYQTGGSIHIIANNMIGFTTESY
ODO1_BACA2      VEGSTRAAQETRTQKDETKSLAILIHGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESD
ODO1_BACSK      VEGYARAAQEDRSSKDTTRAYSILIHGDAAFPGQGVVTETLNLSRLNGYHVGGSLHIIANNNIGYTTEMH
DHTK1_DROME     AMGKTRSKQQARGEGAGEHVLNVILHGDAAFAGQGINQECLNMAYVPHFEVGGSLHLIVNNQVGFTTPGD
ODO1_STAES      VAGKTRAAQDTHQSTDFHKAMPIIIHGDAAYPGQGINFETMNLGSLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_STAEQ      VAGKTRAAQDTHQSTDFHKAMPIIIHGDAAYPGQGINFETMNLGSLKGYSTGGSLHIITNNRIGFTTEPF
DHTK1_DANRE     TQGKTRGRQQVKQDRPGDKVICLQVHGDASFSGQGIVPETFTLSNLPHYRVGGSIHLIVNNQVGYTTPSE
ODO1_EXISA      VEGYTRAAQDDRSEKHDDLAASILIHGDAAFPGQGIVAETLNMTNLTGYRTGGTVHVIANNTIGFTTDPN
ODO1_BACLD      VEGSTRAAQETRTEQDVKKSMAILIHGDAAFPGEGIVAETLNLSQLKGYQVGGAIHIIANNMIGFTTESN
ODO1_BACHD      VEGYARAAQEDRTEQDIMKAYSILIHGDAAFPGQGVVTETLNLSRLTGYQTGGSLHIIANNNIGFTTETF
ODO1_STAS1      VLGKTRANQDT-TDKEFKKSMPILIHGDAAYPGQGINFEAMNLGNLEGYSTGGSLHIITNNRIGFTTEPE
ODO1_STAAB      VEGRTRAAQ---DDTQRHKAMPIIIHGDGAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPI
ODO1_BACHK      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACCQ      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACC7      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACC4      VEGFARAAQENRKDQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACAN      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACAC      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACAA      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACCR      VEGFARAAQENRKDQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACC1      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
DHTK1_PONAB     AVGKTRGRQQSRQDGDYSRVICLQVHGDASFCGQGIVPETFTLSNLPHFRIGGSVHLIVNNQLGYTTPAE
ODO1_BACC3      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACC0      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACCZ      VEGFARAAQENRKEQDTSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_BACC2      VEGFARAAQENRKDQDISKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
DHTK1_MOUSE     AVGKTRGRQQSREDGDYSKVICLQVHGDASFCGQGIVLETFTLSNLPHFRIGGSIHLIVNNQLGYTTPAE
ODO1_BACP2      IEGSTRAAQELRTQKDVEKALAILIHGDAAFPGEGIVAETLNLSQLVGYQVGGTIHIIANNMIGFTTESN
ODO1_STAHJ      VIGKTRASQDDTKHAGKHKGMPIIIHGDAAYPGQGINFETMNLSNLDGYSTGGALHIITNNRIGFTTEPV
ODO1_BACWK      VEGFARAAQENRKEQDTTKSFVILVHGDAAFPGQGVVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSY
ODO1_GEOKA      VLGYTRAAQ---EDRTKPGVFAILIHGDAAFPGQGIVAETLNLSQLRGYTTGGTIHIIANNMIGFTTESY
DHTK1_CAEEL     AMGKARARAWSYSPDERSSVLNVLVHGDGAFTGQGVVWESIALSQAPHFRLGGTVHLVTNNQIAFTAESS
DHTK1_HUMAN     AVGKTRGRQQSRQDGDYSRVICLQVHGDASFCGQGIVPETFTLSNLPHFRIGGSVHLIVNNQLGYTTPAE
ODO1_BACCN      VEGYARAAQENRKEQDSSKSFVILVHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHIIANNTIGFXXXXX
DHTK1_RAT       AVGKTRGRQQSQEDGDYSKVICLQVHGDASFCGQGIVLETFTLSNLPHFRIGGSIHLIVNNQLGYTTPAE
ODPAT_RAT       ----------------KNGQICLALYGDGA-ANQGQVFEAYNMSALP------CVFICENNRYGMGTAER
ODPAT_MOUSE     ----------------KNGQVCLALYGDGA-ANQGQVFEAYNMSALP------CVFICENNLYGMGTSER
ODPA_RHIME      -----------------NDNVSLAYFGDGA-ANQGQVYESFNMAALP------VIYIVENNRYAMGTSVS
ODPA_PANTR      GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPA_HUMAN      GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPA_PIG        GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CVFICENNRYGMGTSVE
ODPA_MACFA      GAGIALACKYNGKDE-----VCLTLYGDGA-ADQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPA_SCHPO      ------------------------LYGDGA-SNQGQAFEAFNMAGLP------VIFACENNKYGMGTSAE
ODPA_SMIMA      GVGIALACKYNEKDE-----ICLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPA_RAT        GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPA_MOUSE      GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPA_BOVIN      GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
ODPAT_HUMAN     -----------------NDEICLTLYGDGA-ANQGQIAEAFNMAALP------CVFICENNLYGMGTSTE
ODPA2_ARATH     ----------FAQKYNKDEAVTFALYGDGA-ANQGQLFEALNISALWDLPA---ILVCENNHYGMGTATW
ODPA_PONAB      GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFGAYNMAALP------CIFICENNRYGMGTSVE
ODPA_PEA        ----------------KDESVTFALYGDGA-ANQGQLFEALNISALWDLPA---ILVCENNHYGMGTATW
ODPA1_ARATH     ----------FAQKYNKEEAVTFALYGDGA-ANQGQLFEALNISALWDLPA---ILVCENNHYGMGTAEW
ODPA_SOLTU      ----------FAQKYKKEDYVTFAMYGDGA-ANQGQLFEALNMAALWDLPA---ILVCENNHYGMGTAEW
ODPA_KLULA      GAGLAFAHQYKHED-----ACSFALYGDGA-SNQGQVFESFNMANLPA------VFCCENNKYGMGTAA-
ODPA_YEAST      GAGLAFAHQYKNED-----ACSFTLYGDGA-SNQGQVFESFNMANLP------VVFCCENNKYGMGTAA-
ODPA_ASCSU      --------------KEKN--VCITMFGDGA-TNQGQLFESMNMADLP------VLYVCENNGYGMGTAA-
ODPT_ASCSU      ---------------KKQKNVCITLFGDGA-TNQGQLYESMNMAKLP------VLYVCENNGYGMGTSA-
ODPA_CAEEL      ------------------KNVCVTLYGDGA-ANQGQLFEATNMADLP------VLFVCENNGFGMTTAER
ODPA_RICBR      GTGLAFAEKYNGTNN-----ICFTFLGDGA-VNQGQVYEAFNMAALWGLPV---VYIIENNEYSMGTS--
ODPA_ZYMMO      --------------------------GDGS-ANQGQVYEAYNMAALP------VIFVIENNGYAMGTSIQ
ODPA_MYCGE      -----------HYKKQPNVAVTMIGDGGTA---EGEFYEAMNIASIHKWNT---VFCINNNQFAISTRTK
ODPA_ACHLA      ------------------------------------------------------VAVIQNNQWAISTPVR
ODPA_DICDI      ----------------------LAMYGDGA-ANQGQLFEAFNMASLP------VIFICENNKYGMGTSQK
ODPA_RICFE      --------------------------GDGA-VNQGQVYEAFNMAALWGLPV---VYIIENNEYSMGTS--
ACOA_RALEH      ICGAALAAKFRGKGE-----VGITFCGDGA-SNQGTFLESLAVWNLP------VIFVIENNGYAESTSRD


                         .         .         +         .         .         .         .:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
ODO1_BRUC2      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUSU      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUSI      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUAB      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUA2      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUA1      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUME      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUMB      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_BRUO2      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_OCHA4      FSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQ
ODO1_RALEH      DARSTLYCTDVVKMIEAPVLHVNGDDPEAVVYAMQLAVDFRMEFKKDVVVDIICFRKLGHNEQDTPAVTQ
ODO1_AZOVI      DTRSTEYCTDPAKMIQAPVLHVNGDDPEAVLFVTQLAVDYRMQFKRDVVIDLVCYRRRGHNEADEPSGTQ
ODO1_RICFE      DTRASRYSTEFAKIIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGDEPMYTQ
ODO1_ECOLI      DARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQ
ODO1_ECOL6      DARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQ
ODO1_ECO57      DARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQ
ODO1_RICBR      DTRASRYSTEFAKIIAVPILHVNGDDIEAVLKATNIAVEYRQKFGKDVIVEIICYRKYGHNEGDEPMYTQ
ODO1_RICCN      DTRASRYSTEFAKIIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGDEPMYTQ
ODO1_RICPR      DTRASRYSTEFAKIISAPILHVNGDDIEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEGDEPMYTQ
ODO1_LEPIN      ESRSTLYATDLAKGFQIPIIHVNGDDPEAVYRVVKLGMEYRQKFKKDFIIDLVCYRRLGHNETDEPAFTQ
ODO1_LEPIC      ESRSTLYATDLAKGFQIPIIHVNGDDPEAVYRVVKLGMEYRQKFKKDFIIDLVCYRRLGHNETDEPAFTQ
ODO1_DICDI      YSRSSKYCTDVAKTIDIPVFHVNGDNVEAVVKVCKIAAEWRQKFKRDVFVDIVCYRKHGHNETDQPKFTQ
ODO1_HAEIN      DTRSTEYCTDIAKMIQAPIIHVNGDDPEAVAFAARMAVEYRNLFKRDIFIDLISYRRHGHNEADEPLATQ
ODO1_RICTY      DTRASRYSTEFAKIIAAPILHVNGDDIEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEGDEPMYTQ
ODO1_CAEBR      SSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQ
ODO1_YEAST      FARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKHGHNETDQPSFTQ
ODO1_SCHPO      FARSTPYCTDIAKSMEAPIFHVNGDDVEAVTFICQLAADWRKAFKTDVVVDIVCYRRHGHNETDQPSFTQ
ODO1_CAEEL      SSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQ
ODO1_COXBU      DARSSMYCSDIAKMLDAPVFHVNGDDPEAVVAVTQLALDYRMAFHKDVFIDLVCYRRHGHQEVDDPMPTQ
OGDHL_XENLA     MARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQ
ODO1_MOUSE      MARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
ODO1_MACFA      MARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
ODO1_HUMAN      MARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
ODO1_RAT        MARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
ODO1_PONAB      MARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
ODO1_BUCAI      HLRSSEYCTDVAKIIQAPVFHVNADDLEASIFAIQLALHFRKIFKKDVFIDLVCYRRNGHNEVDEPSVTQ
ODO1_BOVIN      MARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
ODO1_XENLA      MARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQ
OGDHL_HUMAN     MARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQ
KGD_MYCSS       AAKSSEYCTDVAKMIGAPIFHVNGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQ
KGD_MYCSK       AAKSSEYCTDVAKMIGAPIFHVNGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQ
KGD_MYCSJ       AAKSSEYCTDVAKMIGAPIFHVNGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQ
OGDHL_PONAB     MARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQ
ODO1_BUCAP      NLRSSKYCTDVAKMIQAPVFHVNADDIEASIFAIQLALXXXXXXXXDVFIDLVCYRRHGHNEVDDPFVTQ
KGD_MYCLE       YSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVAKLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTN
KGD_MYCVP       DSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVAKLAVDFRQKFKKDVVIDMLCYRRRGHNEGDDPSMTQ
KGD_MYCS2       DSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQ
KGD_MYCPA       HSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVAKLAVDFRQKFKKDVVIDMLCYRKRGHNEGDDPSMTN
KGD_MYCBP       YSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTN
KGD_MYCBO       YSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTN
KGD_MYCTU       YSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTN
KGD_MYCTA       YSRSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTN
KGD_MYCUA       YSRSTEYCTDVAKTIGAPIFHVNGDDPEACVWVARLAVDFRQRFNKDVIIDMLCYRRRGHNEGDDPSMTN
ODO1_CORGL      SSRSMHYATDYAKAFGCPVFHVNGDDPEAVVWVGQLATEYRRRFGKDVFIDLVCYRLRGHNEADDPSMTQ
ODO1_OCEIH      DGRSTRYASDLAKGFEIPVIRVNADDPISCISAIKIAYEYRQKFQKDFLIDLVGYRRYGHNEMDEPRTTQ
ODO1_BACSU      ESRSTKYASDLAKGYEIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQ
ODO1_STAAU      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAN      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAW      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAT      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAS      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAE      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAC      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAA8      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAA3      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAAM      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAA9      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAA2      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_STAA1      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_BUCBP      DLRTSQYCTDIAKMIDSPIFHVNADDPESVIFVTHLALNYRFCFKKDVFINLVCYRRHGHNEIDDPSITQ
DHTK1_XENLA     RGRSSLYSSDVGKIVGCAVIHVNGDDPEEVLRATRLAVEYQRCFRKDVIIDLLCYRQWGHNELDEPFFTN
ODO1_STAAR      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_GEOSW      DSRSTKYASDIAKGFEIPIVHVNADDPEXXXXXXXXXXXYRKRFKKDFVIDLIGYRRFGHNEMDEPMATN
ODO1_BACA2      ESRSTKYASDLAKGYEIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQ
ODO1_BACSK      DSRSTTYASDPAKGFEIPIVHVNADDAEACVRAIKFAVEYRRKFQKDFLIDLIGYRRFGHNEGDEPAVTQ
DHTK1_DROME     RGRSTAYTSDLAKSIQAPVFHVNGDDPEALARVTSLAFRYQREFRKDIFIDLNCFRRWGHNELDDPTFTN
ODO1_STAES      DGRSTTYSSDVAKGYDVPILHVNADDVXXXXXXXXXXMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITN
ODO1_STAEQ      DGRSTTYSSDVAKGYDVPILHVNADDVXXXXXXXXXXMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITN
DHTK1_DANRE     RGRSSLYCSDVGKMVGCAIIHVNGDDAEEVLRATRLAVEYQRRFRKDVIVDLLCYRQWGHNELDEPFFTN
ODO1_EXISA      DSRSTRYASDIAKGYEIPVFHVNADDPEACVAVAKLISEYRAKFHKDILVDLIGYRRYGHNEMDEPMNTN
ODO1_BACLD      ESRSTKYASDLAKGFEIPIVHVNADDPEACLSAVQLAVEYRMTFNKDFLIDLIGYRRFGHNEMDEPSATQ
ODO1_BACHD      DSRSTLYSSDPAKGFEIPIVHVNADDPEACLAAVHLAFQYRKRFKKDFLIDLIGYRRFGHNEMDEPAVTQ
ODO1_STAS1      DGRSTTYSSDVAKGYDVPIMHVNADNVXXXXXXXXXXMAFRKEFNKDVVIDLVGYRRYGHNEMDEPSITN
ODO1_STAAB      DARSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITN
ODO1_BACHK      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACCQ      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACC7      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACC4      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACAN      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACAC      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACAA      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACCR      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACC1      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
DHTK1_PONAB     RGRSSLYCSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFRKDVIIDLLCYRQWGHNELDEPFFTN
ODO1_BACC3      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACC0      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACCZ      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_BACC2      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
DHTK1_MOUSE     RGRSSLYSSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFRKDVIVDLLCYRQWGHNELDEPFFTN
ODO1_BACP2      ESRSTKYASDLAKGFEIPIVHVNADDPEACLAAVQLAVEYRKRFKKDFLIDLIGYRRYGHNEMDEPSTTQ
ODO1_STAHJ      DGRSTTYSTDIAKGYDVPILHVNADDVEATIEAIDIAMEFRKEFHKDFVIDLVGYRRYGHNEMDEPSITN
ODO1_BACWK      DSRSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRTLFKKDFLIDLIGYRRYGHNEMDDPAVTQ
ODO1_GEOKA      DSRSTTYASDMAKGFEVPIVHVNADDPEXXXXXXXXXXXYRQRFKKDFVIDLIGYRRFGHNEMDEPMATN
DHTK1_CAEEL     VGRSSTHCTDIAKAFEYPVIHVNGDHPEEVVKATRLALAYRERFRKDVFINLVCFRRWGHNELDDPTFTS
DHTK1_HUMAN     RGRSSLYCSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFRKDVIIDLLCYRQWGHNELDEPFYTN
ODO1_BACCN      XXXXXXXXXXLAKGFDIPIVHVNADDPEACLAAANLAIQYRLRFKKDILIDLIGYRRYGHNEMDDPAVTQ
DHTK1_RAT       RGRSSLYSSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFRKDVIIDLLCYRQWGHNELDEPFFTN
ODPAT_RAT       SAASTDYHK---KGFVIPGLRVNGMDILSVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGSYRT
ODPAT_MOUSE     SAASTDYHK---KGFIIPGLRVNGMDILCVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGSYRS
ODPA_RHIME      RASAQTDFSQRGASFGIPGYQVDGMDVRAVKAAADEAVEHCRSGKGPIILEMLTYRYRGHSMSDPAKYRS
ODPA_PANTR      RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSSGPGVSYRT
ODPA_HUMAN      RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
ODPA_PIG        RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
ODPA_MACFA      RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
ODPA_SCHPO      --RSSAMTEFYKRGQYIPGLLVNGMDVLAVLQASKFAKKYTVENSQPLLMEFVTYRYGGHSMSDPTTYRS
ODPA_SMIMA      RAAAS---TDYYKRGDIPGIMVDGMDVLCVREATKFAAAYCRSGKGPMLMELQTYRYHGHSMSDPGSYRT
ODPA_RAT        RAAAS---TDYYKRGDIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGSYRT
ODPA_MOUSE      RAAAS---TDYYKRGDIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGSYRT
ODPA_BOVIN      RAAAS---TDYYKRGDIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGSYRT
ODPAT_HUMAN     RAAASPDYYKRGNFI--PGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
ODPA2_ARATH     --RSAKSPAYFKRGDYVPGLKVDGMDALAVKQACKFAKEHALK-NGPIILEMDTYRYHGHSMSDPGSYRT
ODPA_PONAB      RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
ODPA_PEA        --RSAKSPAYFKRGDYVPGLKVDGMDALAVKQACKFAKEHALK-NGPIILEMDTYRYHGHSMSDPGSYRT
ODPA1_ARATH     RAAKSP--SYYKRGDYVPGLKVDGMDAFAVKQACKFAKQHALE-KGPIILEMDTYRYHGHSMSDPGSYRT
ODPA_SOLTU      RAAKSPAYYKRGDYV--PGLRVDGMDVFAVKQACTFAKQHALK-NGPIILEMDTYRYHGHSMSDPGSYRT
ODPA_KLULA      -ARSSAMTEYFKRGQYIPGLKVNGMDILAVYQASKFAKDWTVSGNGPIVLEYETYRYGGHSMSDPTTYRT
ODPA_YEAST      -SRSSAMTEYFKRGQYIPGLKVNGMDILAVYQASKFAKDWCLSGKGPLVLEYETYRYGGHSMSDPTTYRT
ODPA_ASCSU      -ARSSASTDYYTRGDYVPGIWVDGMDVLAVRQAVRWAKEWCNAGKGPLMIEMATYRYSGHSMSDPTSYRT
ODPT_ASCSU      -ARSSASTDYYTRGDYVPGFWVDGMDVLAVRQAIRWGKEWCNAGKGPLMIEMATYRYGGHSMSDPTSYRT
ODPA_CAEEL      SSASTEY---YTRGDYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPTSYRT
ODPA_RICBR      VARST-FMRDLYKKGESKGFQLNGMDFEEMYDGVKQAAEYVRENSMPLILEVKTYRYRGHSMSDPAKYRS
ODPA_ZYMMO      RANAHTALSERGAGFGIPALVVDGMDVLEVRGAATVAVDWVQAGKGPIILEMKTYRYRGHSMSDPARYRS
ODPA_MYCGE      LESAVSDLSVKAIACGIPRVRVDGNDLIASYEAMQDAANYARGGNGPVLIEFFSYRQGPHTTSDDPSIYR
ODPA_ACHLA      KASNSETLAQKGVAFGIPYIQVDGNDMLAMYVASKEAMDRARKGDGPTLIEAFTYRMGPHTTSDDPSIYR
ODPA_DICDI      --RSTAGHDFYTRGHYVAGLKVDGMDVFAVKEAGKYAAEWCRAGNGPIILEMDTYRYVGHSMSD-PGITY
ODPA_RICFE      VARST-FMRDLYKKGESKGFQLDGMDFEEMYNGAKQAAEYVRENSFPLILEVKTYRYRGHSMSDPAKYRS
ACOA_RALEH      YGTAVDSYVDRAAGFGIPGVTVDGTDFFAVHEAAGEVIRRAREGGGPSLLECKMVRFYGHFEGDAQTYRA


                         *         .         .         .         .         +         .:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPE
ODO1_BRUC2      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUSU      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUSI      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUAB      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUA2      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUA1      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUME      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUMB      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_BRUO2      PLMYKAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPKADWLDGAWAGLRTA
ODO1_OCHA4      PLMYKAIRAHKTTVQLYSDKLIAEGLIKQEEIDQMKAQWRENLETEFDAGQSYKPKADWLDGAWAGLRTA
ODO1_RALEH      PLMYKKIAQHPGTRKLYADKLAAQN-LVPAEFGDEKVKAYRAAMDAGKHTADFKNK---FAVDWMPFLNR
ODO1_AZOVI      PLMYQKIAKQPTTRELYADALVKEGSLSQEEVQAKVDEYRTALDNGQHVLKSLEPNTELFVD-WTPYLGH
ODO1_RICFE      GKMYNIIKSKPTPGNIYANELVKSGIIDNNYFAKLKEEFKAKLDKEFEQAKNYKPEAHFLGGLWQGIS--
ODO1_ECOLI      PLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDCVVAEWRP-MNMHSFTWSPYLNH
ODO1_ECOL6      PLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDCVVAEWRP-MNMHSFTWSPYLNH
ODO1_ECO57      PLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDCVVAEWRP-MNMHSFTWSPYLNH
ODO1_RICBR      GKMYNIIKSKLTPGNIYANELVKSGVIDNNYFAKLKEQFKAKLDKEYEQAKNYKQEAHFLGGLWQGIT--
ODO1_RICCN      GKMYNIIKNKLTPGNIYANELVKSGVIDNNYFAKLKEEFKAKLDKEYEQAKSYKQEAHFLGGLWQGIS--
ODO1_RICPR      SKMYNIIKSKPTPGSIYANELVKNGIIDNNYYAKLKEKFKIRLDQEYEQAKSYKQETHFFEGYWKGISRI
ODO1_LEPIN      PKMYAIIKNHPPTVKLYEKRLVEEGDIPQEDIDFIKNGSMHGLEDSFQRAKDVKIRVDTMQGVWSKFSKD
ODO1_LEPIC      PKMYAIIKNHPPTVKLYEKRLVEEGDIPQEDIDFIKNGSMHGLEDSFQRAKDVKIRVDTMQGVWSKFSKD
ODO1_DICDI      PIMYDKIGKQQPIIEKYSNKLIAEKVITQEQYLQMKNIIHESYEKGYQDGMKHVPNAEWLESRWEGFKSP
ODO1_HAEIN      PMMYSIIKKHPTPRKVYADRLVSEGVMTEEQVTEMANDYRDALDNGDRVVSEWREKMDWLQYNYDWTAPY
ODO1_RICTY      SKMYNIIKSKPTPGNIYANELVKSGIIDNNYYAXXXXXXXXXXXXXYEQAKSYKQESHFLGGCWKGISRT
ODO1_CAEBR      PLMYQRIKQTKTALEKYQEKILNEGVANEQYVKEELTKYGAILEDAYENAQTYVRNRDWLDSPWDDFFKK
ODO1_YEAST      PLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDAFEKAKDYVPQREWLTAAWEGFKSP
ODO1_SCHPO      PRMYKAIAKHPPTFKIYTQQLLQEKTVSKAEVDAQEKRVWDILESSFESSKNYKSDHEWLSNPWVGFASP
ODO1_CAEEL      PLMYQRIKQTKTALEKYQEKILNEGVANEQYVKEELTKYGSILEDAYENAQTYVRNRDWLDSPWDDFFKK
ODO1_COXBU      PAMYKVIQEHPTTRTLYAKNLIEKKLCTAEEVDQWIDDYRDRLDRGRQLVETLPEGLSHYAANWTPYL--
OGDHL_XENLA     PLMYKQIHKQVPVLKKYADKMIAEGTVTLQEFEEEIAKYDRICEEAYARSKDKKNIKHWLDSPWPGFFTL
ODO1_MOUSE      PLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKHIKHWLDSPWPGFFTL
ODO1_MACFA      PLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKHIKHWLDSPWPGFFTL
ODO1_HUMAN      PLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKHIKHWLDSPWPGFFTL
ODO1_RAT        PLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKHIKHWLDSPWPGFFTL
ODO1_PONAB      PLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKHIKHWLDSPWPGFFTL
ODO1_BUCAI      PIMYQKIKNHPTSRTIYSDVLISKKIITSEKNQEIMNQYLSKLQKGFSKSKNIHFKNEFFL--------E
ODO1_BOVIN      PLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKHIKHWLDSPWPGFFTL
ODO1_XENLA      PLMYKQIRKQKAVLQKYAETLISQGVVNQLEYEEEISKYDKICEEAFARSKDEKHIKHWLDSPWPGFFTL
OGDHL_HUMAN     PLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKHIKHWLDSPWPGFFNV
KGD_MYCSS       PSMYDVIDTKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLEQVFNEVRELKHEIEPSESV----EAD
KGD_MYCSK       PSMYDVIDTKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLEQVFNEVRELKHEIEPSESV----EAD
KGD_MYCSJ       PSMYDVIDTKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLEQVFNEVRELKHEIEPSESV----EAD
OGDHL_PONAB     PLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKHIKHWLDSPWPGFFNV
ODO1_BUCAP      PIMYKKIHNHPTIGQIYSNLLISEKLITSNDIEKIIEKYTTKLV-QGKNVLSQERNITFQNGN-KNFFIK
KGD_MYCLE       PYMYDVVDTKRGARKSYTEALIGRGDISLKEAEDALRDYQGQLERVFNEVRDLKHGVQPSESVESDQMIP
KGD_MYCVP       PTMYDVIDTKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELKHAIAPSSSVESDQMVP
KGD_MYCS2       PYMYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELKHEIEPSESV----EAD
KGD_MYCPA       PAMYDVVDIKRGVRKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELE---KHGVGPSESVEAD
KGD_MYCBP       PYMYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELKHGVQPSESVESDQMIP
KGD_MYCBO       PYMYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELKHGVQPSESVESDQMIP
KGD_MYCTU       PYVYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELKHGVQPSESVESDQMIP
KGD_MYCTA       PYVYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELKHGVQPSESVESDQMIP
KGD_MYCUA       PRMYDVVDTKRGVRKSYTEALIGRGDISIKEAEDALRDYQGQLEQVFNEVRELKHGAQPSESVESDQMIP
ODO1_CORGL      PKMYELITGRETVRAQYTEDLLGRGDLSNEDAEAVVRDFHDQMESVFNEVKEGKKQAEAQTGITGSQKLP
ODO1_OCEIH      PSLYQQIDDHPSVASLFGKGMEEKGILQEGGFEEVKSAVEKKLTDIYKGMTE--SEIGEPEAKLMPQVLT
ODO1_BACSU      PMLYDAVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDAYQKVPSKK------EHTACEIEPE
ODO1_STAAU      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_STAAN      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_STAAW      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAAT      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAAS      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAAE      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAAC      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAA8      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAA3      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNP----DME
ODO1_STAAM      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_STAA9      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_STAA2      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_STAA1      PVPYQNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_BUCBP      PVLYSKIKNHPTTATSYYNKLLLKNIINKSFLITYQKKIKKKLDVEYNNKKMSEKRLKCCSIVKADYINV
DHTK1_XENLA     PSMYKIIRSRKSIPDVYSERLIAEGLMTEEEATEIRTTYYSKFNDHLSNMTLYSPPSTNLQAHWREMIEP
ODO1_STAAR      PVPYQNIRKHDSVEYVFGKKLVNEGIISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_GEOSW      PTMYSIIQQHPTVRQLYAQKLIEKGIITKXXXXXXXXXXXXXLKIAYEKVPKDESKLDFI---MDPPKPV
ODO1_BACA2      PMLYDAVRKHPTVKRIFAEKLVSEGLISEEKAQNIETAVTKRIEDAYKKVEDAVREIELPEPVSNGFPDV
ODO1_BACSK      PDLYAQIRKHPTVRAIYAKQLEAEQVITAKEAQKLDTDMYNYLLEEYNKVNSDKSEKKYELSPPDFIVDG
DHTK1_DROME     PLVYKIVHQRESVPDLYAQQLAKEQVLSESKAKEMRDEYMKYLGEELALAPAYQPPPSYFEKQWTNFQLA
ODO1_STAES      PVPYQNIRKHDSVEILYGKKLVDEGIISEDEMNEVQKEMRTAHDKIDKNDKMNNPDMEKPE---SLQLPL
ODO1_STAEQ      PVPYQNIRKHDSVEILYGKKLVDEGIISEDEMNEVQKEMRTAHDKIDKNDKMNNPDMEKPE---SLQLPL
DHTK1_DANRE     PAMYKIIRSRKSIPDSYADQLISEGLMTDEERSQIKTSYYATLNNQLTNMTLYSPPPTNLQGRWGDLVEP
ODO1_EXISA      PVLYKAIKGHQSVRHVYAARLEEEGVMTKDE----KAQIEQKIEEALKAARDLVPSEEEDADIVLPDAVH
ODO1_BACLD      PMLYDAVRKHPTVKNIFAEKLIHKGIVDKETVGKIKDAVQKRLEEAYRKVPAKKEDM-----THEIVLPE
ODO1_BACHD      PGVYQIIRKHPTVRELYSKQLVKKGLIDEQTVKQLDDEVQDKLQSVYEET--LRNRTDEHLPDTPPVEVV
ODO1_STAS1      PLQYYEIRKHESVDILYGKQLVNENIISENQMNQIFDDVQNTLDKIDKNDKMDNPDMQKPD---SLAEPI
ODO1_STAAB      PVPYQNIRKNDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKEL----RQAHDKINKADKMDNPDMEKPAE
ODO1_BACHK      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACCQ      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACC7      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACC4      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEVETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACAN      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACAC      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACAA      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACCR      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEVETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACC1      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQF---IQEQLKSDYAQVPPADTSDATIHVKVPD
DHTK1_PONAB     PIMYKIIRARKSIPDTYAEHLIAGGLMTQEEVSEIKSSYYAKLNDHLNNMAHYSPPAQNLQAHWQGLAQP
ODO1_BACC3      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACC0      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACCZ      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEIETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
ODO1_BACC2      PQVYKKIKNHPTVRAIYADQLQAAGVLNADEVETI-TQFTQ---EQLKSDYAQVPPADTSDATIHVKVPD
DHTK1_MOUSE     PVMYKIIRARKSIPDTYAEHLIASGLMTQEEVSDIKTSYYTKLNDHLANVAHYSPPATNLQARWQGLVQP
ODO1_BACP2      PMLYDAVRKHKTVKNIFADKLVSEGLLTKEQREEIEQAVATRIEEAYQKVPSKKEEIELPEPVSNGFPAV
ODO1_STAHJ      PLPYHNIRKHDSVEIIYGNKLVEDGVISKEQMEKVQKEMRAAQDKIDKSDKMDNPDMERPE---SLQEPL
ODO1_BACWK      PQVYKKIKNHPTVRAIYADQLQSAGVLNADEVETITQFMQEELKAEYAQV----PPADTSAATIHVKVPE
ODO1_GEOKA      PTMYAIINQHPTVRKLYAQKLMEKGIITEREVDEMEQEVAERLKIAYERVPKNEDELDFI---MDPPKPV
DHTK1_CAEEL     PVMYKEVEARESVPRLFLDRLVEEGFTTEEAVKEQLQKHTEQLNNELKKVDSTVPIDISHRGRWEGFKQA
DHTK1_HUMAN     PIMYKIIRARKSIPDTYAEHLIAGGLMTQEEVSEIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQP
ODO1_BACCN      PQVYKKIKNHPTVRAIYAEQLKAEGVLSSDEVETITQFTQEQLKAEYAQV----PPADTSEAAIHVKVPD
DHTK1_RAT       PVMYKIIRARKSIPDTYAEHLIASGLMTQEEVSDIKASYYAKLNGHLANVAHYSPPAPHLQARWQGLVQP
ODPAT_RAT       REEVQNVRSKSDPIMLLRERMISNNLSSVEELKEIDADVKKEVEEAAQFATDPEPPLE------------
ODPAT_MOUSE     REEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATDPEPAVE------------
ODPA_RHIME      KDEVQKMRSEHDPIEQVKARLTDKGWATEDELKQIDKEVRDIVAD-------------------------
ODPA_PANTR      REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_HUMAN      REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_PIG        REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_MACFA      REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_SCHPO      REEVQKVRAARDPIEGLKKHIMEWGVANANELKNIEKRIRGMVDEEVRIAEE------------------
ODPA_SMIMA      REEIQEVRSKSDPIMLLKDRMVNNNLASIEELKEIDVEVRKEIEDQFATADPEPPLEELGYHIYSRDPP-
ODPA_RAT        REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_MOUSE      REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_BOVIN      REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPAT_HUMAN     REEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATDPEPHLE------------
ODPA2_ARATH     RDEISGVRQVRDPIERVRKLLLTHDIATEKELKDMEKEIRKEVDDAVAQAKE------------------
ODPA_PONAB      REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
ODPA_PEA        RDEISGVRQERDPIERVRKLLLSHDIATEKELKDTEKEVRKEVDEAIAKAKD------------------
ODPA1_ARATH     RDEISGVRQERDPIERIKKLVLSHDLATEKELKDMEKEIRKEVDDAIAKAKD------------------
ODPA_SOLTU      RDEISGVRQERDPVERIRSLILAHNIATEAELKDIEKENRKVVDEAIAKAKE------------------
ODPA_KLULA      RDEIQHMRSKNDPIAGLKMHLLELGIATEDEIKAYDKAARKYVDEQVELA--------------------
ODPA_YEAST      RDEIQHMRSKNDPIAGLKMHLIDLGIATEAEVKAYDKSARKYVDEQVELADAAPP---------------
ODPA_ASCSU      REEVQEVRKTRDPITGFKDKIVTAGLVTEDEIKEIDKQVRKEIDAAVKQA--------------------
ODPT_ASCSU      REEIQEVRKTRDPITGFKDKIVTAGLVTEDELKEVDKEIRKEVDAAVKQA--------------------
ODPA_CAEEL      REEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIA--------------------
ODPA_RICBR      KEEVETYKER-DPITEIRKIILENNYASEADLKEIEQSVKEIVKE-------------------------
ODPA_ZYMMO      REEVNDMKENHDPLDNLKKDLFAAG-VPEAELVKLDEDIR----QQVKEAADFAEK--------------
ODPA_MYCGE      TKQEEEEGMKSDPVKRLRNFLFDRSILNQAQ---------------------------------------
ODPA_ACHLA      TKEEENEWAKKDQIARFKTYLINKGYWSXXXXXXXXXXXXXXINDTFKKVESYGANIEIFEHTYAEMTPQ
ODPA_DICDI      RTRVNHVRQTRDPIENIRQIILDNKIATEDQLAAIEETVRDEMEKASEKA--------------------
ODPA_RICFE      KEEVEQYKER-DPLVIIRKTILDNKYATEADLKEIEQSVKEIVKEAVK----------------------
ACOA_RALEH      AGELDDIRANKDCLKLFGRAVTQAGVVAREELDTIDREVAALIEHAVQEAK-------------------


                         .         .         .         *         .         .         .:630
query           KGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFGSLLEEG
ODO1_BRUC2      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_BRUSU      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_BRUSI      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_BRUAB      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_BRUA2      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_BRUA1      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_BRUME      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEA
ODO1_BRUMB      DNADRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEA
ODO1_BRUO2      DNADEQGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLAVEG
ODO1_OCHA4      DNADRRGKTAVPMKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSLVAEG
ODO1_RALEH      KWTDAADTA-VPVTELKRLAERITTTPETLKLHPLVEKVVKDRANMGRGDQPLDWGMGEHLAFASLVSSG
ODO1_AZOVI      AWTARHDTS-FELKTLQELNAKLLQIPEGFVVQRQVAKILEDRGRMGVGAMPINWGCAETLAYATLLKEG
ODO1_RICFE      RIRTQAAITGVGKKTLQDLGTKLCEIPKDFAVNPKLVKLFEARKATLTSDQPIDWATAEQLAFASLLSEG
ODO1_ECOLI      EW-DEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLAYATLVDEG
ODO1_ECOL6      EW-DEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLAYATLVDEG
ODO1_ECO57      EW-DEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLAYATLVDEG
ODO1_RICBR      RTRTQVAVTGVDKKTLQSLGTKLCEMPKDFAVNPKLVKLFDARKAALTADQPIDWATAEQLAFASLLTSG
ODO1_RICCN      RTRTQATITGISKKTLHDLGTKLCEIPKDFAVNPKLVKLFEARKATLTADQPIDWATAEQLAFASLLASG
ODO1_RICPR      RGKD--AITGVNKKILQDLGTKLCEIPKDFAINPKLIRLFEVRKTTLTTDQPIDWATAEQLAFAHLLCSG
ODO1_LEPIN      S-LDSEPATKLLAEQMHGIVQALTSVPQGFTPNSKLVKLLQSRKEMAEGKIPVDWGFAEALSFGSILESG
ODO1_LEPIC      S-LDSEPATKLLAEQMHGIVQALTSVPQGFTPNSKLVKLLQSRKEMAEGKIPVDWGFAEALSFGSILESG
ODO1_DICDI      IELGNPGRTGIDQDLLQKIGKVLYTEPSGFEVHSTIKRLLKEKKDMFDKGTGFDWATAEALAFGSLLLDG
ODO1_HAEIN      ESK-------FSQERFLTLAKRVCEYPESLRAHPRVEKIYNDRKAMYQGEKLLDWGMAETMAYATLLDEG
ODO1_RICTY      RGK--AAITGVNKKILQDLGTKLCEIPKDFTINPKLVRLFEVRKNTLTTDQPIDWATAEQLAFAHLLCSG
ODO1_CAEBR      RDPLKLPSTGIEQENIEHIIGKFGSYPEGFNLHRGLERTLKGRQQMLKD-NSLDWACGEALAFGSLLKEG
ODO1_YEAST      KELATEILTNVPESTLKELGKVLSSWPEGFEVHKNLKRILKNRGKSIETGEGIDWATGEALAFGTLVLDG
ODO1_SCHPO      KDLMTKILPSYPTDTLKQIGKALYTLPEGFDAHXXXXXXXXXXXXSISSGEGIDMPTAEALAFGTLLEEG
ODO1_CAEEL      RDPLKLPSTGXXXXXXXXXXGKFSQYPEGFNLHRGLERTLKGRQQMLKD-NSLDWACGEALAFGSLLKEG
ODO1_COXBU      ---------GQDWTTLVDTTXXFSTLPNTLHLHRKVEAIYKARLEMAEGKTPMDWGFAEMLAYASLLEEG
OGDHL_XENLA     DGEPKSMTTGIPEDMLSHIGAIASSVPLKFKIHGGLSRILKSR-LEMTNSRTVDWALAEYMTFGSLLKEG
ODO1_MOUSE      DGQPRSMTTGLEEDVLFHIGKVASSVPENFTIHGGLSRILKTRRELVTN-RTVDWALAEYMAFGSLLKEG
ODO1_MACFA      DGQPRSPSTGLTEDILTHIGNVASSVPENFTIHGGLSRILKTRGEMVKN-RTVDWALAEYMAFGSLLKEG
ODO1_HUMAN      DGQPRSPSTGLTEDILTHIGNVASSVPENFTIHGGLSRILKTRGEMVKN-RTVDWALAEYMAFGSLLKEG
ODO1_RAT        DGQPRSMTTGLEEDILTHIGNVASSVPENFTIHGGLSRILKTRRELVTN-RTVDWALAEYMAFGSLLKEG
ODO1_PONAB      DGQPRSPSTGLTEDILTHIGNVASSVPENFTIHGGLSRILKTRGEMVKN-RTVDWALAEYMAFGSLLKEG
ODO1_BUCAI      EXXXXXXXXDVNFSDLKNLACLINQIPDSVKMHQRVKKIYEERLEMAQRLKLFDWGAAETLAYATILNEG
ODO1_BOVIN      DGQPRSMTTGLTEDILTHIGNVASSVPEDFTIHGGLSRILKTRGELVKN-RTVDWALAEYMAFGSLLKEG
ODO1_XENLA      DGQPRSMTTGLTEEDLTHIGNVASSVPEDFMIHGGLSRILKGRGEMVKN-RTVDWALAEYMALGSLLKEG
OGDHL_HUMAN     DGEPKSPATGIPEDMLTHIGSVASSVPEDFKIHTGLSRILRGR-ADMTKNRTVDWALAEYMAFGSLLKEG
KGD_MYCSS       QQIPAKLATAVDKSLLARIGDAHLAVPEGFTVHPRVKPVLEKRREMAYEGK-VDWAFAELLALGTMISEG
KGD_MYCSK       QQIPAKLATAVDKSLLARIGDAHLAVPEGFTVHPRVKPVLEKRREMAYEGK-VDWAFAELLALGTMISEG
KGD_MYCSJ       QQIPAKLATAVDKSLLARIGDAHLAVPEGFTVHPRVKPVLEKRREMAYEGK-VDWAFAELLALGTMISEG
OGDHL_PONAB     DGEPKSPATGIPEDMLTHIGSVASSVPEDFKIHTGLSRILRGRADMIKN-RTVDWALAEYMAFGSLLKEG
ODO1_BUCAP      KQKENTQLNFLNIKDLLY---SINTIPNSIEVHNRVKKIYQERIGMADGQILLDWGTAELLAYATILKEG
KGD_MYCLE       AGLS----TAVDKALLARIGDAFLAVPEGFTVHPRVQPVLEKRREMAYEGK-IDWAFAELLALGSLVAEG
KGD_MYCVP       AGMS----TAVDKSLLARIGDAHLGYPDDFNVHPRVKPVLEKRREMAYEGK-VDWAFAELLALGTFLAEG
KGD_MYCS2       QQIPSKLATAVDKAMLQRIGDAHLALPEGFTVHPRVRPVLEKRREMAYEGR-IDWAFAELLALGSLIAEG
KGD_MYCPA       QMLPAGLATAVDKALLARIGDAFLALPEGFTAHPRVQPVLEKRREMAYEGK-IDWAFAELLALGSLVAGG
KGD_MYCBP       AGL----ATAVDKSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGK-IDWAFGELLALGSLVAEG
KGD_MYCBO       AGL----ATAVDKSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGK-IDWAFGELLALGSLVAEG
KGD_MYCTU       AGL----ATAVDKSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGK-IDWAFGELLALGSLVAEG
KGD_MYCTA       AGL----ATAVDKSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGK-IDWAFGELLALGSLVAEG
KGD_MYCUA       AGL----ATAVDKSLLARIGDAFLAVPDGFTTHPRVQPVLEKRREMAYEGK-IDWAFAELLALGSLVAEG
ODO1_CORGL      HGLE----TNISREELLELGQAFANTPEGFNYHPRVAPVAKKRVSSVTEG-GIDWAWGELLAFGSLANSG
ODO1_OCEIH      NGLDQF-TTAIDLATLKSINEELLERPEGFKGFKKTERILQRRKDALEEGNKADWGTGEALAFASILKEG
ODO1_BACSU      PVSN--GFPDVDTSIDFDVLRKLNGEPESFNVFGKLKRILERRAKAFDDDRKVEWSLAESLAFASILKDG
ODO1_STAAU      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAN      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAW      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAT      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAS      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAE      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAC      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAA8      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAA3      KPADLALPLQADEQSLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAAM      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAA9      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAA2      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_STAA1      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_BUCBP      SNTPINNIS---QSDLTILAKKIFSIPNNIEVHNRVFKIYKDRLKMANNEKLFDWGASELLAYASLLNEG
DHTK1_XENLA     SARTTTWDTGLPADLLKFIGAKSVEVPEEFKMHSHLLKMAQSRVQKLQEATKLDWATAEALAFGSLLCQG
ODO1_STAAR      LALPLQAEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_GEOSW      ASKLPFVKTSVEKDVLRRLNKELLQFPSDFHVFNKLERILK-RREGVFDGKGIDWAHAEILAFATILRDG
ODO1_BACA2      D-------TAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLAESLAFASILKDG
ODO1_BACSK      LPKVKTAV---EKEKLVAMNEQLLDWPSSFKPNQKLEKILK-RRANAFDGEGVDWGLAEILAFASILHDG
DHTK1_DROME     PSKETYWDTGLDYSLLHYIGQQSVTFPEDFNIHPHLLKTVNARLKKLENGVKIDWSTAEALAIGSLMYQG
ODO1_STAES      QSDTK----DFSFDHLKEINDAMLDYPKDFHVLKKLNKVLEKRREPFEKEEGVDWAQAEQLAFATILQDG
ODO1_STAEQ      QSDTK----DFSFDHLKEINDAMLDYPKDFHVLKKLNKVLEKRREPFEKEGGVDWAQAEQLAFATILQDG
DHTK1_DANRE     QNRVSCWDTGVAQPLLQFVGAKSVDIPEEIILHSHLRKTVQARLQKLEEGTKLDWSTAEALAFGTLLCQG
ODO1_EXISA      KGFPKVDTS-VEREFLTQLNEELLNWPEGFGVFHKLQKVLDRRRDAFSEGGKIDWGHAETLAFASILSDG
ODO1_BACLD      PVSNPDVDTSVDFETLRKINQELVSWPENFNVFDKLKRILERRAKAFEDDRKVDWSLAEAMAFASILKDG
ODO1_BACHD      NGLPKLD-TGVQSETLKAINNELLEWPESFSVNPKLEKILK-RRLNVFDGDGVDWALAETLAFATILHDG
ODO1_STAS1      QTKDEE--VSYEQLK--EINDAMLSYPSDFXXXXXXXXXXXXXXXPFESEDGVDWAQAEQLAFATITQNG
ODO1_STAAB      LALPLQAEQSFTFDHLKEINDALLTYPDGFNIXXXXXXXXXXRHEPFNKEDGVDWAQAEQLAFATILQDG
ODO1_BACHK      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACCQ      VAKGIQSITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACC7      VAKGIQSITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACC4      VAKGIQSITGVEIDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACAN      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACAC      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACAA      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACCR      VVA--KGITGVEIDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACC1      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
DHTK1_PONAB     EARITTWSTGVPLDLLRFVGVKSVEVPRQLQMHSHLLKTVQSRMEKVMDGTKLDWATAEALALGSLLAQG
ODO1_BACC3      VAKGIQSITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACC0      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACCZ      VVA--KGITGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_BACC2      VVA--KGITGVEIDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
DHTK1_MOUSE     EACVTTWDTGVPLELLRFIGVKSVEVPEELQVHSHLLKMVQSRMEKVKNGSGLDWATAETLALGSLLAQG
ODO1_BACP2      D-------TSVEFDVLRKLNEELISWPDDFQVFGKLKRILEKRAKVFTDDRKVEWSLGEALAFASILKDG
ODO1_STAHJ      QSDDK----DFSVDHLKEINDAMLTYPEDFHVLKKLNKVLEKRREPFESENGVDWAQAEQLAFATIVQDG
ODO1_BACWK      VVA--KGITGVSIESLRAINEGLLSWPEGFNVYPKVKKILERRKDALEENGKIEWALAESLAFASILQEG
ODO1_GEOKA      VDRLPEVKTSVAKDVLHRVNEELLQFPDGFNVFNKLERILKRRSGVFAQNGKVDWAHAEILAFATILQDG
DHTK1_CAEEL     PKAIESWDTGVATDLLRFIGAGSVKVPEDFDTHKHLYKMIDSRMQKMQTGEGIDWATAEAMAFGSILLEG
DHTK1_HUMAN     EAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTVQSRMEKMMDGIKLDWATAEALALGSLLAQG
ODO1_BACCN      VVA--RGITGLPLETLRAINEGLLSWPEGFNVYPKVKKILERRRTALDADGKVEWALAESLAFASILQEG
DHTK1_RAT       AACVTTWDTGVPLELLRFVGVKSVEVPEELQLHSHLLKMVQSRMEKVKNGTNLDWATAETLALGSLLAQG
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      ----------------------------------------------------------------------
ODPA_HUMAN      ----------------------------------------------------------------------
ODPA_PIG        ----------------------------------------------------------------------
ODPA_MACFA      ----------------------------------------------------------------------
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      ----------------------------------------------------------------------
ODPA_RAT        ----------------------------------------------------------------------
ODPA_MOUSE      ----------------------------------------------------------------------
ODPA_BOVIN      ----------------------------------------------------------------------
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      ----------------------------------------------------------------------
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      ----------------------------------------------------------------------
ODPA_YEAST      ----------------------------------------------------------------------
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
ODO1_BRUC2      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUSU      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUSI      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUAB      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUA2      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUA1      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUME      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUMB      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_BRUO2      HPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_OCHA4      SPIRLSGQDVERGTFSQRHTVLYDQETQNRYIPLNNIQKGQAIYEAINSMLSEEAVLGYEYGYSLSDPRA
ODO1_RALEH      YPVRITGQDAGRGTFTHRHAVLHDQADAGSYVPLQNVSENQAPFTVIDSVLSEEAVLGFEYGYSAAEPNA
ODO1_AZOVI      HPVRITGQDVGRGTFSHRHAALHNQKDASRYIPLQNLYEGQPKFELYDSFLSEEAVLAFEYGYATTTPNA
ODO1_RICFE      TNIRLTGQDCGRGTFSHRHSVLHNQIDDTTYIPLNNLSKTQAKYEVADSNLSEYAVLGFEYGYSLANPKN
ODO1_ECOLI      IPVRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRT
ODO1_ECOL6      IPVRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRT
ODO1_ECO57      IPVRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRT
ODO1_RICBR      TNIRLTGQDCGRGTFSHRHSVLHNQVDDTTYIPLNNLSKEQATYEVADSNLSEYAVLGFEYGYSLANPKN
ODO1_RICCN      TNIRLTGQDSGRGTFSHRHSVLHNQIDGTTYIPLNNLSKEQAKYEVADSNLSEYAVLGFEYGYSLANPKN
ODO1_RICPR      INIRLTGQDSARGTFSHRHSILHNQIDDTTYIPLNNLSKTQAKYEVANSNLSEYAALGFEYGYSLANPKN
ODO1_LEPIN      FRIRLSGQDSQRGTFSHRHAVLVDTNTNEKYIPLNHISSKQAKAEIINSSLSEFSVLGFEYGYSLSDPNA
ODO1_LEPIC      FRIRLSGQDSQRGTFSHRHAVLVDTNTNEKYIPLNHISSKQAKAEIINSSLSEFSVLGFEYGYSLSDPNA
ODO1_DICDI      NHVRLSGQDVERGTFSHRHAVWHDQKTDQTYAPLTKLAKDAAEFVASNSSLSEFAVLGFELGYSLENPDA
ODO1_HAEIN      VNVRLSGEDAGRGTFFHRHAVVHNQNDGTGYVPLTHLHANQGRFEVWDSVLSEESVLAFEYGYATTDPKT
ODO1_RICTY      TNIRLTGQDSERGTFSHRHSILHNQIDDTTYIPLNNLSKTQAQYEVANSNLAEYAVLGFEYGYSLASPKN
ODO1_CAEBR      IHVRLSGQDVERGTFSHRHHVLHDQKDQKIYNPLNDLADPQGEYTVCNSSLSEYAVLGFELGYSMVDPNS
ODO1_YEAST      QNVRVSGEDVERGTFSQRHAVLHDQQSEAIYTPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDY
ODO1_SCHPO      HHVRVSGQDVERGTFSQRHAVLHDQSSENVYIPLNHLSPNQASFVIRNSSLSEYGVLGFEYGYSLSSPNA
ODO1_CAEEL      IHVRLSGQDVQRGTFSHRHHVLHDQKDQKIYNPLNDLSEGQGEYTVCNSSLSEYAVLGFELGYSMVDPNS
ODO1_COXBU      FSVRLVGQDSRRGTFFHRHAVVFDQETGKEYEPLKHLSDKQAAPHIYDSLLCEAGALGFEYGYSTADPNS
OGDHL_XENLA     IHVRLSGQDVERGTFSHRHHVLHDQEDRWTCVPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_MOUSE      IHVRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_MACFA      IHIRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_HUMAN      IHIRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_RAT        IHVRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_PONAB      IHIRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_BUCAI      ISCRISGEDVSRGTFFHRHAFIHNQINGSIYIPLNNISKKQGKFQIWDSVLSEEAVLAFEYGYSLSSPNT
ODO1_BOVIN      IHIRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
ODO1_XENLA      IHIRLSGQDVERGTFSHRHHVLHDQNDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNA
OGDHL_HUMAN     IHVRLSGQDVERGTFSHRHHVLHDQEDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNA
KGD_MYCSS       KLVRLSGQDTRRGTFTQRHSVVIDRKTGKEFTPLQLLATDSGKFLVYDSPLSEFAAVGFEYGYSVGNPDA
KGD_MYCSK       KLVRLSGQDTRRGTFTQRHSVVIDRKTGKEFTPLQLLATDSGKFLVYDSPLSEFAAVGFEYGYSVGNPDA
KGD_MYCSJ       KLVRLSGQDTRRGTFTQRHSVVIDRKTGKEFTPLQLLATDSGKFLVYDSPLSEFAAVGFEYGYSVGNPDA
OGDHL_PONAB     IRVRLSGQDVERGTFSHRHHVLHDQEDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASPNA
ODO1_BUCAP      ISCRLSGEDISRGTFFHRHAFIHDQNNGSIYVPLQNIEKNQGKFEIWDSVLSEEAVLAFEYGYSLFPSNN
KGD_MYCLE       KLVRLSGQDTKRGTFSQRHSVIIDRHTGEEFTPLQLLANNPGKFLVYNSPLSEYAAVGFEYGYTVGNPDA
KGD_MYCVP       KTIRFTGQDTRRGTFTQRHSVIIDRQTGREFTPLDLLTVDSGKFMAYDSALSEFAAVGFEYGYSVGNPNA
KGD_MYCS2       KLVRLSGQDTQRGTFTQRHAVIVDRKTGEEFTPLQLLATNPGKFLVYNSALSEFAAVGFEYGYSVGNPDA
KGD_MYCPA       KLVRLSGQDTRRGTFSQRHSVIIDRNTGEEFTPLQLLATNPGKFLVYDSPLSEYAAVGFEYGYTVGNPDA
KGD_MYCBP       KLVRLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSGKFLVYDSPLSEYAAVGFEYGYTVGNPDA
KGD_MYCBO       KLVRLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSGKFLVYDSPLSEYAAVGFEYGYTVGNPDA
KGD_MYCTU       KLVRLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSGKFLVYDSPLSEYAAVGFEYGYTVGNPDA
KGD_MYCTA       KLVRLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSGKFLVYDSPLSEYAAVGFEYGYTVGNPDA
KGD_MYCUA       KLVRFSGQDTRRGTFSQRHSVIIDRHTREEFTPLQLLTTNKGKFLVYDSPLSEYAAVGFEYGYTVGNPDA
ODO1_CORGL      RLVRLAGEDSRRGTFTQRHAVAIDPATAEEFNPLHELAQNNGKFLVYNSALTEYAGMGFEYGYSVGNEDS
ODO1_OCEIH      TPIRLTGQDTERGTFAHRHIVLHDVETGEKYSPLHGLSDVEASFDVRNSPLSEAGVLGFEYGYSVQSPDT
ODO1_BACSU      TPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCSTSFAVHNSPLSEGSVLGFEYGYNVHSPET
ODO1_STAAU      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAN      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAW      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAT      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAS      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAE      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAC      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAA8      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAA3      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAAM      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAA9      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAA2      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_STAA1      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_BUCBP      ISCRLSGEDVCRGTFFHRHAVIHDQKNDSKYIPLKNIKLKQGNFYIWDSVLSEEATLAFEYGYSIDQKNT
DHTK1_XENLA     FNIRISGQDVGRGTFSQRHAMLVCQETNDTYIPLNHMTPDQKGFEVSNSALSEEAVLGFEYGMSIESPKL
ODO1_STAAR      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_GEOSW      VPIRLTGQDSQRGTFAQRHLVLHDMKTGEEFVPLHHISDANASFVVYNSPLTEAAVLGYEYGYNVFAPET
ODO1_BACA2      TPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCAASFTVHNSPLSEGSVLGFEYGYNVYSPET
ODO1_BACSK      TPVRLSGQDSERGTFAHRHFVLHDRETNETHVPLQTIKDANASFAVYNSPLTEQACVGFEYGYNVFSKET
DHTK1_DROME     HNVRISGEDVGRGTFSHRHAMLVDQQTNEMFIPLNSMGGNGGKLELAHSILSEEAVLGFEYGMAIDNPNN
ODO1_STAES      TSIRLTGQDSERGTFSHRHAVLHDEENGNTFTPLHHVPQQQATFDIHNSPLSEAAVVGFEYGYNVENKGN
ODO1_STAEQ      TSIRLTGQDSERGTFSHRHAVLHDEENGNTFTPLHHVPQQQATFDIHNSPLSEAAVVGFEYGYNVENKGN
DHTK1_DANRE     FNIRISGQDVGRGTFSQRHAMVVCQETNDMFIPLNHISSEQKGHEVCNSALSEEAVLGFEYGMSIAQPRL
ODO1_EXISA      TPVRLSGQDSERGTFAQRNIMLNDVESGKKFSPLHELSTAKASFSVYNSPLSEGSVLGFEYGYNVFAQDT
ODO1_BACLD      TPLRLTGQDSERGTFAHRNLVLHDSKTGDEFIALHHLADTKASFAVHNSPLSEGSVLGFEYGYNVSSPET
ODO1_BACHD      TPIRLTGQDSERGTFAHRHLVLHDSRTNDVHSPLQSFRHANASFAVHNSPLSEMAIVGFEYGYNVFAPET
ODO1_STAS1      RPIRLTGQDSERGTFSHRHAVLHDPDTGAQYVPLHNVPDQKATFEVRNSPLSEAAVVGFEYGYNIQNKSC
ODO1_STAAB      TPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPNQKATFDIHNSPLSEAAVVGFEYGYNVENKKS
ODO1_BACHK      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACCQ      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACC7      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACC4      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACAN      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACAC      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACAA      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACCR      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACC1      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
DHTK1_PONAB     FNVRLSGQDVGRGTFSQRHAMVVCQETDDTYIPLNHMDPNQKGFEVSNSPLSEEAVLGFEYGMSIESPKL
ODO1_BACC3      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACC0      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACCZ      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_BACC2      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
DHTK1_MOUSE     FNVRLSGQDVGRGTFSQRHAMVVCQDTDDAYIPLNHMDPNQKGFEVSNSPLSEEAVLGFEYGMSIESPTL
ODO1_BACP2      TPIRMTGQDSERGTFAQRNLVLHDSQTGNEFIALHELSDANASFTVHNSPLSEGSVIGFEYGYNVYSPET
ODO1_STAHJ      ISVRLTGQDSERGTFSHRHAVLHDEENGDTFTPLHHVPNQKATFEVHNSPLSEAAVVGFEYGYNVENKNS
ODO1_BACWK      TPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPNINASFSVHNSPLSEAAVVGYEYGYNVFAPET
ODO1_GEOKA      VPIRLTGQDSQRGTFAQRHLVLHDVKTGEEYVPLHHISGAKASFVVYNSPLTEAAVLGYEYGYNVYAPET
DHTK1_CAEEL     NDVRISGQDVGRGTFCHRHAMMVDQSTDHIHIPLNELVEEQKQLEVANNLLSEEAILGFEWGFSSENPRR
DHTK1_HUMAN     FNVRLSGQDVGRGTFSQRHAIVVCQETDDTYIPLNHMDPNQKGFEVSNSPLSEEAVLGFEYGMSIESPKL
ODO1_BACCN      TPIRLTGQDSQRGTFAQRHIVLHDTETNETYSPLHRLPNINASFSVHNSPLSEAAVVGFEYGYNVFAPET
DHTK1_RAT       FNVRLSGQDVGRGTFSQRHAMVVCQNTDDVYIPLNHMDPNQKGFEVSNSPLSEEAVLGFEYGMSIESPKL
ODPAT_RAT       ----------------------------------------------------------------------
ODPAT_MOUSE     ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
ODPA_PANTR      ----------------------------------------------------------------------
ODPA_HUMAN      ----------------------------------------------------------------------
ODPA_PIG        ----------------------------------------------------------------------
ODPA_MACFA      ----------------------------------------------------------------------
ODPA_SCHPO      ----------------------------------------------------------------------
ODPA_SMIMA      ----------------------------------------------------------------------
ODPA_RAT        ----------------------------------------------------------------------
ODPA_MOUSE      ----------------------------------------------------------------------
ODPA_BOVIN      ----------------------------------------------------------------------
ODPAT_HUMAN     ----------------------------------------------------------------------
ODPA2_ARATH     ----------------------------------------------------------------------
ODPA_PONAB      ----------------------------------------------------------------------
ODPA_PEA        ----------------------------------------------------------------------
ODPA1_ARATH     ----------------------------------------------------------------------
ODPA_SOLTU      ----------------------------------------------------------------------
ODPA_KLULA      ----------------------------------------------------------------------
ODPA_YEAST      ----------------------------------------------------------------------
ODPA_ASCSU      ----------------------------------------------------------------------
ODPT_ASCSU      ----------------------------------------------------------------------
ODPA_CAEEL      ----------------------------------------------------------------------
ODPA_RICBR      ----------------------------------------------------------------------
ODPA_ZYMMO      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
ODPA_DICDI      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ACOA_RALEH      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
ODO1_BRUC2      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUSU      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUSI      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUAB      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUA2      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUA1      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUME      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUMB      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_BRUO2      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQV
ODO1_OCHA4      LVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSSARLERWLQMCAEDNMQV
ODO1_RALEH      LVIWEAQFGDFVNGAQVVIDQFISSGEVKWGRASGLTLMLPHGYEGQGPEHSSARIERFLQLCADHNMQV
ODO1_AZOVI      LVIWEASSGDFANGAQVVIDQFISSGETKWGALCGLTMLLPHGYEGQGPEHSSARLERYLQLCAEQNIQV
ODO1_RICFE      LVLWEAQFGDFANGAQIIFDQFISSSETKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAEDNMYV
ODO1_ECOLI      LTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQV
ODO1_ECOL6      LTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQV
ODO1_ECO57      LTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQV
ODO1_RICBR      LVLWEAQFGDFANGAQIIFDQFISSSETKWLRMSGLVVLLPHGFEGQGPEHSSARLERFLQLAAEDNMYV
ODO1_RICCN      LVLWEAQFGDFANGAQIIFDQFISSSETKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAENNMYV
ODO1_RICPR      LVLWEAQFGDFANGAQIIFDQFISSSATKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAEENMYI
ODO1_LEPIN      LVMWEAQFGDFANSAQVIFDQFISSSEVKWQRLSGLIMLLPHGYEGQGPEHSSARLERFLQLCALDNMQV
ODO1_LEPIC      LVMWEAQFGDFANSAQVIFDQFISSSEVKWQRLSGLIMLLPHGYEGQGPEHSSARLERFLQLCALDNMQV
ODO1_DICDI      LILWEAQFGDFSNGAQVIIDQFISSGEQKWMRQSGLTMLLPHGYDGAGPEHSSCRIERYLQLCDSDNMQV
ODO1_HAEIN      LTIWEAQFGDFANGAQIVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQV
ODO1_RICTY      LVLWEAQFGDFANGAQIIFDQFISSSATKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAEENMYI
ODO1_CAEBR      LVIWEAQFGDFSNTAQCIIDQFVSSGQSKWIRQSGLVMLLPHGYEGMGPEHSSARPERFLQMCNEDNWIV
ODO1_YEAST      LVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDNFQV
ODO1_SCHPO      LVVWEAQFGDFANNAQCIIDQFIAAGETKWLQRTGIVLSLPHGYDGQGPEHSSARMERYLQLCNEDNIQA
ODO1_CAEEL      LVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMGPEHSSARPERFLQMCNEDNWIV
ODO1_COXBU      LVIWEAQFGDFANVAQVIVDQFISSGWQKWNRLSGIVLFLPHGYEGKGPEHSSARLERYLQLCAQNNMQV
OGDHL_XENLA     LVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDNWIV
ODO1_MOUSE      LVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNWIV
ODO1_MACFA      LVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNWVV
ODO1_HUMAN      LVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNWVV
ODO1_RAT        LVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNLQV
ODO1_PONAB      LVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNWVV
ODO1_BUCAI      LTIWEAQFGDFINGAQIVIDQFISSGEQKWNKKSNLVVLLPHGYEGQGPEHSSSRIERFLQLCAEENMQI
ODO1_BOVIN      LVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNWVV
ODO1_XENLA      LVLWEAQFGDFHNTAQCIIDQFVCPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDNWIV
OGDHL_HUMAN     LVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDNWIV
KGD_MYCSS       MVLWEAQFGDFINGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTI
KGD_MYCSK       MVLWEAQFGDFINGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTI
KGD_MYCSJ       MVLWEAQFGDFINGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTI
OGDHL_PONAB     LVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDNWIV
ODO1_BUCAP      LTIWEAQFGDFANGAQVVIDQFISSSEQKWNQKSNLVLFLPHGYEGQGPEHSSARLERFLQLCAENNIQV
KGD_MYCLE       VVLWEAQFGDFVNGAQSIIDEFINSGEAKWGQLSTVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTF
KGD_MYCVP       LVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLLLWAEGSMTI
KGD_MYCS2       MVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTI
KGD_MYCPA       LVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSNVVLLLPHGHEGQGPD