[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21098.1

[Show Plain Result]


## Summary of Sequence Search
    1::422
   15::347     3e-26  30%  350 aa  GLCE_ECOLI RecName: Full=Glycolate oxidase subunit glcE;
  140::458     5e-16  29%  470 aa  GLCD_BACSU RecName: Full=Glycolate oxidase subunit glcD;
  120::294     1e-09  29%  535 aa  D2HDH_RAT RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  120::294     1e-09  29%  535 aa  D2HDH_MOUSE RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  213::303     2e-09  34%  544 aa  D2HDH_BOVIN RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  156::342     6e-09  25%  587 aa  DLD1_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 1,
  149::316     7e-09  28%  576 aa  DLD1_KLULA RecName: Full=D-lactate dehydrogenase [cytochrome],
  190::280     9e-09  33%  521 aa  D2HDH_HUMAN RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  164::494     2e-07  24%  496 aa  DLD3_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 3;   
   64::241     7e-07  24%  484 aa  LDHD_MOUSE RecName: Full=Probable D-lactate dehydrogenase,
  192::311     3e-06  25%  530 aa  DLD2_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 2,
   57::373     4e-06  26% 1018 aa  YDIJ_ECOLI RecName: Full=Uncharacterized protein ydiJ;
  238::312     4e-06  31%  597 aa  ADAS_CAEEL RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  155::242     2e-05  31%  499 aa  GLCD_ECOLI RecName: Full=Glycolate oxidase subunit glcD;
  155::242     2e-05  31%  499 aa  GLCD_ECOL6 RecName: Full=Glycolate oxidase subunit glcD;
  147::314     2e-05  26%  611 aa  ADAS_DICDI RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  296::370     4e-05  28%  645 aa  ADAS_MOUSE RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  201::291     8e-05  27%  533 aa  D2HDH_DANRE RecName: Full=D-2-hydroxyglutarate dehydrogenase,
  309::383     8e-05  29%  658 aa  ADAS_HUMAN RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  309::383     8e-05  28%  658 aa  ADAS_CAVPO RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  296::369     1e-04  27%  644 aa  ADAS_RAT RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  262::340     2e-04  29%  631 aa  ADAS_DROME RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  598::822     0.001  24%  831 aa  SYL_NEOSM RecName: Full=Leucyl-tRNA synthetase;       
    1::422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxQDSNNTYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
GLCE_ECOLI      --------------------------VNQAISDKTPLVIQGSNSKAFLGRPV-TGQTLDVRCHRGIVNYD
GLCD_BACSU      ----------------------------------------------------------------------
D2HDH_RAT       ----------------PQTSEEVSQILRHCYKRNLAVNPQG-GNTGMVGGSVPVFDELSTALMNQVISFH
D2HDH_MOUSE     ----------------PQTSEEVSQILRHCYKRNLAVNPQG-GNTGMVGGSVPVFDELSTALMNQVISFH
D2HDH_BOVIN     ----------------------------------------------------------------------
DLD1_YEAST      ---------------FPHTTEEVSKILKICHDNNMPVVPFSGGTSHFLPTRIGDTITVDLSKMNNVVKFD
DLD1_KLULA      ---------------YPRNTEDVSKLLKICHKYSIPVIPFSGGTSHFLPTRPGSCVVLDISKLNKIIQLN
D2HDH_HUMAN     ----------------------------------------------------------------------
DLD3_YEAST      ----------------------------------------------------------------------
LDHD_MOUSE      --------QPPDAVVWPQNVDQVSRVASLCYNQGVPIIPFGTGTGVEGGVAVQGGVCINLTHMDQITELN
DLD2_YEAST      ----------------------------------------------------------------------
YDIJ_ECOLI      ---------------FPRSTADVA-LIARLAAQERYSSLIFTPRGGGTGTNGQALNQVDMSRMNRIIEIN
ADAS_CAEEL      ----------------------------------------------------------------------
GLCD_ECOLI      ----------------------------------------------------------------------
GLCD_ECOL6      ----------------------------------------------------------------------
ADAS_DICDI      ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
ADAS_MOUSE      ----------------------------------------------------------------------
D2HDH_DANRE     ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
SYL_NEOSM       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEELYIKVKANTPXXXXXXXXXXXXXXXAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
GLCE_ECOLI      PTELVITARVGTPLVTIEAALESAGQMLPCEPPHYG-------EEATWGGMVACGLAGPRRPWSGSVRDF
GLCD_BACSU      ----------------------------------------------TIGGNINENSGGLRGLKYGVTRDY
D2HDH_RAT       DVSGILVCQAGCVLEELSRYVQERDFIM---PLDLGA-------KGSIGGNVATNAGGLRFLRYGSLRGT
D2HDH_MOUSE     DVSGILVCQAGCVLEELSRYVQERDFIM---PLDLGA-------KGSIGGNVATNAGGLRFLRYGSLRGT
D2HDH_BOVIN     -------------------------------------LDLGAKGSCHIGGNVATNAGGLRVLRYGSLRGT
DLD1_YEAST      KLDLDITVQAGLPWEDLNDYLSDHGLMFGCDP----------GPGAQIGGCIANSCSGTNAYRYGTMKEN
DLD1_KLULA      KEDLDVVVQGGVPWEELNEYLN-----------DHGLLFGCDPGPGAIAGCIANSCSGTNAYRYGTMKEN
D2HDH_HUMAN     -------------------------------------LDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGT
DLD3_YEAST      -------------------------------------------NNCQVGGVVSTNAGGLNFLRYGSLHGN
LDHD_MOUSE      TEDFSVVVE---PGVTRKALNTHLRDSGLWFPVDPGA-------DASLCGMAATGASGTNAVRYGTMRDN
DLD2_YEAST      -------------------------------------LDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGS
YDIJ_ECOLI      PEEGWVRVEAGV---------IKDQLNQYLKPFGYFFAELSTSNRATLGGMINTDASGQGSLVYGKTSDH
ADAS_CAEEL      ----------------------------------------------TLGGWVSTRASGMKKNKYGNIEDL
GLCD_ECOLI      ----------------------------------------------SIGGNVAENAGGVHCLKYGLTVHN
GLCD_ECOL6      ----------------------------------------------SIGGNVAENAGGVHCLKYGLTVHN
ADAS_DICDI      RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
ADAS_MOUSE      ----------------------------------------------TVGGWISTRASGMKKNIYGNIEDL
D2HDH_DANRE     -------------------------------------LDLGAKGSCHIGGNVSTNAXXXXXXXXXXXXXT
ADAS_HUMAN      ----------------------------------------------TVGGWVSTRASGMKKNIYGNIEDL
ADAS_CAVPO      ----------------------------------------------TVGGWISTRASGMKKNIYGNIEDL
ADAS_RAT        -----------------------------------------------VGGWISTRASGMKKNVYGNIEDL
ADAS_DROME      ----------------------------------------------TLGGWVATRASGMKKNVYGNIEDL
SYL_NEOSM       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDKKLV
GLCE_ECOLI      VLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVXXXXXXXXXXXXEISLQEAM
GLCD_BACSU      VIGLEVVLANGDIIRTGGKLAKDVAGYDLTRLFVGSEGTLGIVTEAIVKLVPK----------PETKKTL
D2HDH_RAT       VLGLEVVLADGTILNCLTSLRKDNTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVN------------
D2HDH_MOUSE     VLGLEVVLADGTILNCLTSLRKDNTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVN------------
D2HDH_BOVIN     VLGLEVVLADGTVLNCLTSLRKDNTGYDLKQLFIGSEGTLGVITAVSILCPPKPSTVN------------
DLD1_YEAST      IINMTIVLPDGTIVKTKKRPRKSSAGYNLNGLFVGSEGTLGIVTEATVKCHVKPKAETVAVVSFDTIK--
DLD1_KLULA      VVNITMCMADGTIVKTKRRPRKSSAGYNLNGLIIGSEGTLGIVTEATIK---------------------
D2HDH_HUMAN     VLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVN------------
DLD3_YEAST      VLGLEVVLPNGEIISNINALRKDNTGYDLKQLFIGAEXXXXXXXXXXXXXXXKPKALNAVFFGIENFDTV
LDHD_MOUSE      VINLEVVLPDGRLLHTAGRYRKSAAGYNLTGLFVGSEGTLGIITSTTLRLHP------------------
DLD2_YEAST      VLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFXXXXXXXXXXXXXXXLTVPKPKAFNVSYLSVESFEDV
YDIJ_ECOLI      VLGVRAVLLGGDILKSNTTIGREMTEFDLTRILTGSEGTLAFITEARLDITRLPKVRRLVNVKYDSDSAL
ADAS_CAEEL      VVHLNFVCPKG-IIQKQCQVPRMSSGPDIHQIILGSEGTLGVVSEVTIKIFP------------------
GLCD_ECOLI      LLKIEVQTLDGEALTLGSDALDS-PGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFD-----
GLCD_ECOL6      LLKIEVQTLDGEALTLGSDALDS-PGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFD-----
ADAS_DICDI      AVSFRTVTPTGTLELRNGA--RSGAGINYKHIILGSEGTLGIITEAVMKV--------------------
ADAS_MOUSE      VVHMKMVTPRG-VIEKSSQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRP------------------
D2HDH_DANRE     VLGLEVVLADGHVLNCLATLRKDNTGYDLKQLFIGSEGTLGVITAVSILCPRKPKAVN------------
ADAS_HUMAN      VVHIKMVTPRG-IIEKSCQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRP------------------
ADAS_CAVPO      VVHMKVVTPRG-VIEKSCQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRP------------------
ADAS_RAT        VVHMKMVTPRG-VIEKSSQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRP------------------
ADAS_DROME      VVRVRMVTPSGTLEREC-SAPRVSCGPDFNHVILGSEGTLGVITEVVLKVRPLPSL--------------
SYL_NEOSM       ----------------------------------------------------EKVLVGKIEKMSKSKKNV


                         .         .         .         +         .         .         .:280
query           KNLFDKIXXXXXEVSGAVYIPEEPKDENYDQNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKALTNE
GLCE_ECOLI      SEIAE-WQLQPLPISG-------------------------LCYFDNALWIRLEGGEGSVKAARELLGGE
GLCD_BACSU      LALYENIDAAAQTVSDIIAAKIIPATEFLDQPTLLVIKIGLPTSAKAVLLIEQDGPFETVEEKIEAICKK
D2HDH_RAT       ----------------------------------------------------------------------
D2HDH_MOUSE     ----------------------------------------------------------------------
D2HDH_BOVIN     ----------------------------------------------------------------------
DLD1_YEAST      ----------------------------------------------------------------------
DLD1_KLULA      ----------------------------------------------------------------------
D2HDH_HUMAN     ----------------------------------------------------------------------
DLD3_YEAST      QKLFVKAKSELSEILSAFEFMDRGSIETIEYLKDLPFPLEN--QHNFYVLIETSGNKRHDDEKLTAFLKD
LDHD_MOUSE      ----------------------------------------------------------------------
DLD2_YEAST      QKVFVRARQELSEILSA-----------------------------------------------------
YDIJ_ECOLI      RNFMVEARALSVETVDSKVLNLAREDIVWHSVSELITDVPDQEMLGLNIVEFAGDDEALIDERVNALCAR
ADAS_CAEEL      ----------------------------------------------------------------------
GLCD_ECOLI      ----------------------------------------------------------------------
GLCD_ECOL6      ----------------------------------------------------------------------
ADAS_DICDI      ----------------------------------------------------------------------
ADAS_MOUSE      ----------------------------------------------------------------------
D2HDH_DANRE     ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
SYL_NEOSM       VDLEEIVSKYGADAARFFILSDNPPENSFDRGINASFKFLQLSSKNSGEVQTGQNVKIQINKIICDMTKY


                         .         *         .         .         .         .         +:350
query           LELSKLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWI
GLCE_ECOLI      -------------EVAGQFWQQLREQQLFFSLPGTLWRISL-PSDAP-MMDLPGEQ---LIDWGGALRWL
GLCD_BACSU      GDAVSVQTTEEEAFALTEXXXXXXXXXXXXKPTTILEDATVPRSEIANMVKAINDAAKYDISICGNLHTT
D2HDH_RAT       ----------------------------------------------------------------------
D2HDH_MOUSE     ----------------------------------------------------------------------
D2HDH_BOVIN     ----------------------------------------------------------------------
DLD1_YEAST      ----------------------------------------------------------------------
DLD1_KLULA      ----------------------------------------------------------------------
D2HDH_HUMAN     ----------------------------------------------------------------------
DLD3_YEAST      TTDSKLISEGMMAKDKADFWRKMYKYDMSLQLK-DLYSVSAAVTERLNAAGLIGDAPKPVVKSCGYGHVG
LDHD_MOUSE      ----------------------------------------------------------------------
DLD2_YEAST      ----------------------------------------------------------------------
YDIJ_ECOLI      LD--------------------------------------------------------------------
ADAS_CAEEL      ----------------------------------------------------------------------
GLCD_ECOLI      ----------------------------------------------------------------------
GLCD_ECOL6      ----------------------------------------------------------------------
ADAS_DICDI      ----------------------------------------------------------------------
ADAS_MOUSE      ----------------------------------------------------------------------
D2HDH_DANRE     ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
SYL_NEOSM       MDEIKLNCAVAKIHELVNLLSASGALS--KETIHVLLRILEP--FAPHLAEYLASKLENNVILYGS-PWV


                         .         .         .         .         *         .         .:420
query           EVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYx
GLCE_ECOLI      ----KSTAEDNQIHRIARNAGGHATRFSAGD-----GGFAPLSAPLFRYHQQLKQQLDPCGVFNPGRMY-
GLCD_BACSU      DIRNKDEMEFAEIFEKAIELGGTITGEHGVGEMKAPYLEMKLKKEGIDAMKALKAAFDPRNILNPGKMF-
D2HDH_RAT       ----------------------------------------------------------------------
D2HDH_MOUSE     ----------------------------------------------------------------------
D2HDH_BOVIN     ----------------------------------------------------------------------
DLD1_YEAST      ----------------------------------------------------------------------
DLD1_KLULA      ----------------------------------------------------------------------
D2HDH_HUMAN     ----------------------------------------------------------------------
DLD3_YEAST      DGNIHLNIAVREFTKQIEDLFVYEYIASKKGSISAEHGIYTRSDIEIRFMKDIKNHYDPNGILNPYK---
LDHD_MOUSE      ----------------------------------------------------------------------
DLD2_YEAST      ----------------------------------------------------------------------
YDIJ_ECOLI      ----------------------------------------------------------------------
ADAS_CAEEL      ----------------------------------------------------------------------
GLCD_ECOLI      ----------------------------------------------------------------------
GLCD_ECOL6      ----------------------------------------------------------------------
ADAS_DICDI      ----------------------------------------------------------------------
ADAS_MOUSE      ----------------------------------------------------------------------
D2HDH_DANRE     ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
SYL_NEOSM       -AYNEVLTQSDAVTLMVRKNGKFVQLLEVKKDSSEEEIISQAKRL-------IKNAVVDKVIYVPGKM--


                         .         .         +         .         .         .         .:490
query           xx
GLCE_ECOLI      --
GLCD_BACSU      --
D2HDH_RAT       --
D2HDH_MOUSE     --
D2HDH_BOVIN     --
DLD1_YEAST      --
DLD1_KLULA      --
D2HDH_HUMAN     --
DLD3_YEAST      --
LDHD_MOUSE      --
DLD2_YEAST      --
YDIJ_ECOLI      --
ADAS_CAEEL      --
GLCD_ECOLI      --
GLCD_ECOL6      --
ADAS_DICDI      --
ADAS_MOUSE      --
D2HDH_DANRE     --
ADAS_HUMAN      --
ADAS_CAVPO      --
ADAS_RAT        --
ADAS_DROME      --
SYL_NEOSM       --