[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21174.1

[Show Plain Result]


## Summary of Sequence Search
    1::213
    1::202     6e-94 100%  213 aa  RSMG_PELUB RecName: Full=Ribosomal RNA small subunit
   37::185     9e-13  28%  199 aa  RSMG_ROSDO RecName: Full=Ribosomal RNA small subunit
   36::184     2e-11  36%  195 aa  RSMG_DINSH RecName: Full=Ribosomal RNA small subunit
    3::178     2e-10  26%  191 aa  RSMG_RICRS RecName: Full=Ribosomal RNA small subunit
    4::179     2e-10  26%  192 aa  RSMG_RICRO RecName: Full=Ribosomal RNA small subunit
    4::179     2e-09  26%  192 aa  RSMG_RICFE RecName: Full=Ribosomal RNA small subunit
    8::194     3e-09  28%  207 aa  RSMG_MARMM RecName: Full=Ribosomal RNA small subunit
   35::182     4e-09  24%  193 aa  RSMG_PARDP RecName: Full=Ribosomal RNA small subunit
   12::192     8e-09  25%  198 aa  RSMG_ORITI RecName: Full=Ribosomal RNA small subunit
    6::186     8e-09  23%  205 aa  RSMG_MAGSA RecName: Full=Ribosomal RNA small subunit
    3::193     8e-09  27%  205 aa  RSMG_AGRRK RecName: Full=Ribosomal RNA small subunit
    4::179     2e-08  26%  192 aa  RSMG_RICCN RecName: Full=Ribosomal RNA small subunit
    4::179     2e-08  26%  192 aa  RSMG_RICAE RecName: Full=Ribosomal RNA small subunit
   10::189     5e-08  21%  204 aa  RSMG_SILPO RecName: Full=Ribosomal RNA small subunit
   12::192     9e-08  24%  198 aa  RSMG_ORITB RecName: Full=Ribosomal RNA small subunit
    3::178     1e-07  25%  191 aa  RSMG_RICAH RecName: Full=Ribosomal RNA small subunit
   51::196     6e-07  26%  207 aa  RSMG_ERYLH RecName: Full=Ribosomal RNA small subunit
   16::195     1e-06  25%  210 aa  RSMG_RHILO RecName: Full=Ribosomal RNA small subunit
   11::197     2e-06  21%  211 aa  RSMG_JANSC RecName: Full=Ribosomal RNA small subunit
   55::202     5e-06  30%  213 aa  RSMG_BART1 RecName: Full=Ribosomal RNA small subunit
    3::175     6e-06  24%  191 aa  RSMG_RICTY RecName: Full=Ribosomal RNA small subunit
    5::180     8e-06  24%  193 aa  RSMG_RICM5 RecName: Full=Ribosomal RNA small subunit
    3::180     8e-06  23%  192 aa  RSMG_RICBR RecName: Full=Ribosomal RNA small subunit
    3::180     8e-06  23%  192 aa  RSMG_RICB8 RecName: Full=Ribosomal RNA small subunit
   11::184     2e-05  23%  207 aa  RSMG_HYPNA RecName: Full=Ribosomal RNA small subunit
   24::201     3e-05  29%  217 aa  RSMG_ACICJ RecName: Full=Ribosomal RNA small subunit
   16::202     4e-05  23%  221 aa  RSMG_ZYMMO RecName: Full=Ribosomal RNA small subunit
   37::155     5e-05  25%  182 aa  RSMG_CAMFF RecName: Full=Ribosomal RNA small subunit
   38::175     7e-05  25%  191 aa  RSMG_RICPR RecName: Full=Ribosomal RNA small subunit
   11::190     9e-05  20%  205 aa  RSMG_SILST RecName: Full=Ribosomal RNA small subunit
   55::202     9e-05  29%  215 aa  RSMG_BARQU RecName: Full=Ribosomal RNA small subunit
  116::216     1e-04  29%  233 aa  RSMG_SPHAL RecName: Full=Ribosomal RNA small subunit
    9::200     1e-04  26%  213 aa  RSMG_SINMW RecName: Full=Ribosomal RNA small subunit
   88::193     1e-04  28%  205 aa  RSMG_RHILW RecName: Full=Ribosomal RNA small subunit
   51::187     1e-04  25%  210 aa  RSMG_MESSB RecName: Full=Ribosomal RNA small subunit
  102::198     1e-04  29%  216 aa  RSMG_CAUCR RecName: Full=Ribosomal RNA small subunit
  102::198     1e-04  29%  216 aa  RSMG_CAUCN RecName: Full=Ribosomal RNA small subunit
    3::193     2e-04  27%  205 aa  RSMG_RHIE6 RecName: Full=Ribosomal RNA small subunit
    3::193     3e-04  28%  205 aa  RSMG_RHIL3 RecName: Full=Ribosomal RNA small subunit
   13::193     4e-04  22%  208 aa  RSMG_RHOS5 RecName: Full=Ribosomal RNA small subunit
   12::181     5e-04  21%  201 aa  RSMG_RHORT RecName: Full=Ribosomal RNA small subunit
   87::189     5e-04  26%  210 aa  RSMG_GLUDA RecName: Full=Ribosomal RNA small subunit
    6::125     6e-04  22%  206 aa  RSMG_RHOS1 RecName: Full=Ribosomal RNA small subunit
   40::166     6e-04  26%  193 aa  RSMG_GLUOX RecName: Full=Ribosomal RNA small subunit
   49::229     8e-04  24%  275 aa  RSMG_AZOC5 RecName: Full=Ribosomal RNA small subunit
    1::213

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQXXXXXXXXXXXXTAKNEVIRERHIVDSAQIIEFVDLNS
RSMG_PELUB      MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQXXXXXXXXXXXXTAKNEVIRERHIVDSAQIIEFVDLNS
RSMG_ROSDO      ------------------------------------------------EDVWSRHIWDSAQVVDCV-AKA
RSMG_DINSH      ----------------------------------------------------ERHILDSAQLYDFLPSTA
RSMG_RICRS      ---------------VPREIIEKLEIFQKLVKKWNKSINLVSDNTIHN--FWQRHILDSLQLIQYIDNKE
RSMG_RICRO      ---------------VPREIIEKLEIFQKLVKKWNKSINLVSDNTIHN--FWQRHILDSLQLIQYIDNKE
RSMG_RICFE      ---------------VPREIIEKLEIFQKLVKKWNKSINLVSDNTIHN--FWQRHILDSLQLMQYIDNKE
RSMG_MARMM      -----------RETGVSRETLDGFETWRALLVETNAHTNLVGRSTL--DQFWARHAMDSYQLLEHVGADV
RSMG_PARDP      --------------------------------------------------IEARHIADSLHLVEIAKNAQ
RSMG_ORITI      ------------NYNVSRETFNKFKEYYSLLSKWNSTINLVSATTLQN--FWQRHIFDSIQLLNYIHNKD
RSMG_MAGSA      ---------LLTKSGVSRETLERLRLYADLLVKWQARINLVGPDTVPD--LWSRHMLDSVQLFPLIKVGA
RSMG_AGRRK      ----------LNGVRVSRETQGRLQHFAELFQKWAKTINLVAPSTVDD--LWRRHIADSAQIFQLHPKPA
RSMG_RICCN      ---------------VPREIIEKLEIFQKLVKKWNKSINLVSDNTIHN--FWQRHILDSLQLIQYIDNKE
RSMG_RICAE      ---------------VPREIIEKLEIFQKLVKKWNKSINLVSDNTIHN--FWQRHILDSLQLIQYIDNKE
RSMG_SILPO      --------------NVSRETFERLKIFADLVHKWNPRINLVSKRSLED--LWTRHIIDSIQVFRNAP-KG
RSMG_ORITB      ------------NYNVSRETFNKFKEYYSLLSKWNSTINLVSATTLQN--FWQRHIFDSIQLLNYIHNKD
RSMG_RICAH      ---------------VSREIIEKLEIFQKLVKKWNKSINLVSGNTIHN--FWQRHILDSLQLMQYIDNKE
RSMG_ERYLH      ----------------------------------------------------QRHIADSAQLLDHVSRET
RSMG_RHILO      ---------------VSRETFDRLVAFEAMFQKWNRSINLVAQSTAGD--VWQRHILDSAQLAR-IEPNA
RSMG_JANSC      ------------SDRVSRETMDRLELYHTLLTRWQKTINLIAPSTIDSVWVR--HIMDSAQLFDLASKPA
RSMG_BART1      -----------------------------------------------------RHILDSAQILQWCDLGS
RSMG_RICTY      ---------------VPSEIIQKLDILQNLIKKWNKSINLISDNTIPN--FWQRHILDSLQLMQYISNKE
RSMG_RICM5      ---------------VPREIIEKLEIFQKLVKKWNKSINLVSDNTIHN--FWQRHILDSLQLIQYIDNKE
RSMG_RICBR      --------------DVPHEVIEKLQIFQDLVQKWNKAINLISENSTQN--FWKRHILDSLQLIQYINDKE
RSMG_RICB8      --------------DVPHEVIEKLQIFQDLVQKWNKAINLISENSTQN--FWKRHILDSLQLIQYINDKE
RSMG_HYPNA      ----------LAANDVSRETLDRLDRVIDTLDVWRQKSNLIGPKEWPQ--IWTRHVGDSWQLLDHIPETA
RSMG_ACICJ      ---------------VSRETLSRLEAFAALILRWTARINLVSRKDAAPAEIWNRHILDSLQMLPLVPQGA
RSMG_ZYMMO      ---------------ISRETVEKLDAFVACLHAEMAHQNLIARSTVDD--LWGRHIIDSAQLLPLARFNK
RSMG_CAMFF      -------------------------------------------------------VEDSMKPLEFLDFNP
RSMG_RICPR      ----------------------------------------------------QRHILDSLQLMQYISNKE
RSMG_SILST      --------------DVSRETLERLMVFSEVLKKWNPKINLVSRKSIDD--LWTRHILDSIQVFDAAP-EG
RSMG_BARQU      -----------------------------------------------------RHILDSAQIYP---LHS
RSMG_SPHAL      ----------------------------------------------------------------------
RSMG_SINMW      ----------LNGLRVSRETVEKLEHFASLFQKWARSINLVAPSTLDD--LWRRHILDSIQLFQWVDLGS
RSMG_RHILW      ----------------------------------------------------------------------
RSMG_MESSB      ----------------------------------------------------ERHILDSAQLIRIAPAAR
RSMG_CAUCR      ----------------------------------------------------------------------
RSMG_CAUCN      ----------------------------------------------------------------------
RSMG_RHIE6      ----------LNGLRVSRETQARLQHFAALFQKWAKTINLVAPSTLDD--LWHRHIADSSQIIRWADLGS
RSMG_RHIL3      ----------LNGLRVSRETQERLQHFAALFQKWAKAINLVAPSTLDD--LWHRHIADSSQVITWVDLGS
RSMG_RHOS5      --------------NVSRETLGKLEQYADLVRKWNSAINLIGRSTEGQIWIR--HIQDSAQLWGLRAAPF
RSMG_RHORT      ---------------VSRETVERLEAYLAVLEKWQRRINLVGKTTLDDPW--RRHFLDSAQLLALLPTPT
RSMG_GLUDA      ----------------------------------------------------------------------
RSMG_RHOS1      ---------VLAQLDVSRETSEKLSHFVALVEKWNKAVNLIGRSTVDS--IWTRHVLDSAQLRTHLTSQP
RSMG_GLUOX      -----------------------------------------------------RHIEDSLQLAELIP-EG
RSMG_AZOC5      ---------------VSRETLARLDTIAEQLTRWQKTINLVAPNTLPD--LWHRHIADSLQLVWLVPETV


                         .         .         *         .         .         .         .:140
query           NIITDXXXXXXXXXXXXXXXXKNQKNLAKVHLYEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSG
RSMG_PELUB      NIITDXXXXXXXXXXXXXXXXKNQKNLAKVHLYEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSG
RSMG_ROSDO      KTWVDLGSGGGMPGIVVAIFAKNIDPDRRVILVESDQRKAAFLRTVIRELSLNARVIVERIEDVAPLRAD
RSMG_DINSH      DKVIDXXXXXXXXXXXXXXXAKHRGCRIKFTAIESDARKCAFLRTAARELQINLSVITSRIEAANVEPGN
RSMG_RICRS      IHLVDIGSGAGLPGIVL-----SIAGVAQVSLIEADLRKCIFLEKASKISNNNVQIINQRI-EKVEIDCS
RSMG_RICRO      IHLVDIGSGAGLPGIVL-----SIAGVAQVSLIEADLRKCIFLEKASKISNNNVQIINQRI-EKVEIDCS
RSMG_RICFE      IHLVDIGSGAGFPGIVLSIA-----GVAKVSLIEADLRKCIFLEKASKXXXXXXXXXXXRIEKVE-IDCS
RSMG_MARMM      TKIADLGAGAGFPGIALALGLRDRQQAAHVTLVDSVGKKVAFLRKTIAALALDADVRVETLDPAEGFD--
RSMG_PARDP      GSWVDLGSGGGLPGIVVAIMRPD----LELSMVESDQRKGAFLRNAIRELALHAKVLCKRIEALDRLDAA
RSMG_ORITI      IIVADLGSGAGFPGVVLSI-----SGIKNVILIESDSRKAAFLLQVAQLSDQKIEIINDRI-QNLKVKCD
RSMG_MAGSA      RRLVDLGSGAGFPGLVLAVM-----GAPDVHLVESDSRKCAFLREVARVTETPVTVINKRIEQVAPLGAD
RSMG_AGRRK      RWV-DLGSGGGFPGIITAILLAEQKD-GHVDLVESNQKKAAFLRVCLRECEARGAVHAVRIEEAPKIDCD
RSMG_RICCN      IHLVDIGSGSGLPGIVL-----SIAGVAQVSLIEADLRKCIFLEKASKXXXXXXXXXXXRI-EKVEIDCS
RSMG_RICAE      IHLVDIGSGSGLPGIVL-----SIAGVAQVSLIEADLRKCIFLEKASKXXXXXXXXXXXRI-EKVEIDCS
RSMG_SILPO      DLWVDLGSGGGFPGLICAILAAEEKPETQFICVESDQRKSAFLRSAARECGIACQVISERIEHLDPLDAD
RSMG_ORITB      IIVADLGSGAGFPGVVLSI-----SGIKNVILIESDSRKAAFLLQAAQLSDQKIEIINDRI-QNLKVKCD
RSMG_RICAH      IHLVDIGSGAGFPGIVL-----SIAGVAKVSLIEADLRKCIFLEKASKXXXXXXXXXXXRI-EKVAIDCS
RSMG_ERYLH      GLWLDLGSGAGFPGLVVAAMQPEKPVL----LVESRRKRVEWLTDMVKALKLNCDVAGMRLELLEAREAG
RSMG_RHILO      THWVDIGSGGGFPGLVMAFLLAERAG-ASIDLVECNRKKASFLQTVIGQFNLPARVVARRIKDSHALQPQ
RSMG_JANSC      HRWLDLGSGGGFPGLVVAAMAKDVCPNLTVTLVESDIRKCGFLREAARQMDLSVKILSRRIGDVPAQTAD
RSMG_BART1      G---------GGFPAIVIAIFLKEKRSGHINLVESNGKKVAFLRTVIAQLNLPATVYHEDIYQKIPI-SD
RSMG_RICTY      IHLVDIGSGAGFPGIVL-----SIAGVAKVSLIEADLRKCIFLEKASKXXXXXXXXXXXRI-EKIEIDCN
RSMG_RICM5      IHLVDIGSGSGLPGIVL-----SIAGVAQVSLIEADLRKCIFLEK-AXXXXXXXXXXXXXXXXXXXXDCS
RSMG_RICBR      IHLVDIGSGAGFPGIIL-----SIAGVASTSLIEADLRKCIFLEKAAKXXXXXXXXXXXRI-EKTEISCN
RSMG_RICB8      IHLVDIGSGAGFPGIIL-----SIAGVASTSLIEADLRKCIFLEKAAKXXXXXXXXXXXRI-EKTEISCN
RSMG_HYPNA      HLVD-----LGSGAGFPGLIIAAARSLGHVTMIESVGKKCAFLRAAIQEADLSAAVHQGRVEAAPPIKAE
RSMG_ACICJ      FRAADXXXXXXXXXXXXAIARPE----IGFTLIESDRRKAAFLQTAIAELKLNATVLPVRIEQARLEPSP
RSMG_ZYMMO      KASPKSWLDLGSGAGFPGIIIAILSEMA-VTLVESRRKRVEFLEKAAEAAGTPVTILGQRLENIEPQAFD
RSMG_CAMFF      KIVIDVGSGAGFPAIFLSLIL----NSSEFHLYEPIAKKSSFLSYVGAALNLNITVHPSKIESCQKIKAD
RSMG_RICPR      IHLIDIGSGAGFPGIVL-----SIAGVTKVSLIEADLRKCIFLAKASKXXXXXXXXXXXRI-EKIEIDCS
RSMG_SILST      GAWLDIGSGGGLPGIIVAILAAEKSPDTRITLMESDLRKCAFLRNAARECGVSVTVKSKRIESAPEENCD
RSMG_BARQU      NFLCDLGSGGGFPAIVIAIFLKTKK-AGHIDLVESNGKKIAFLRTVISQLNLPATVHHEDVYQKIKKPD-
RSMG_SPHAL      -------------------------------LVESRRRRCDFLRAVVAELALDVEVAEAPLERVATRPAA
RSMG_SINMW      G---------GGFPGVITAICLSETESGWVHLVESNNKKAAFLRVALRETAARGTVHPIRIEEAEIPTCD
RSMG_RHILW      -----------------------------VHLVESNHKKAAFLRTALRETNARGSVHSSRIEDAEIGECG
RSMG_MESSB      RWL-DLGSGGGFPGAVIAILMKEHAP-AQVDLVESNRKKAAFLQTSLASLKAPCMIHPQRIEDCQIPPPE
RSMG_CAUCR      ---------------------------AKVHLVESMIKRCRFLEVVAKDLDLPVQIHNARA-EDLKLKVD
RSMG_CAUCN      ---------------------------AKVHLVESMIKRCRFLEVVAKDLDLPVQIHNARA-EDLKLKVD
RSMG_RHIE6      G-------GGFPGVITAIFLAELQDGWA--HLVESNHKKAAFLMTALRETEARGSVHAIRIEDAEIGECG
RSMG_RHIL3      GVITAIFLAELQGGW--------------VHLVESNHKKAAFLRTALRETNARGSVHSIRIEDAEVRECS
RSMG_RHOS5      GTWLDLGSGGGLPGIVLATIATEKAPESRFVLVESDQRKATFLRTAARTLCLNVTVHAARVEQLPPQRAD
RSMG_RHORT      RVLLDLGSGAGFPGLVLAIL-----GVPEVHLVEADGRKSAFLIEAARITNTRIVLHTLRLEALPVFPVD
RSMG_GLUDA      ---------------------------ADVTLIESDQRKAAFLREAARAVGARVTIIARRIEDADIPPVQ
RSMG_RHOS1      RLWLDLGSGSGFPGIVVAIMAADESPESRFVLVESDQRKATFLRTACRELKLSAAVLAARI---------
RSMG_GLUOX      KTITDLGSGGGFPGIILAIATGNP-----VTLIESDQRKCAFLREAGRICEARVTVIAKRIEAASPPPAD
RSMG_AZOC5      LNWADLGSGGGFPGLVVAAVLAEREG-AHVTLVESDTRKXXXXXXXXXXXXXPTRIVPERIEQAQRLAAG


                         +         .         .         .         .         *         .:210
query           TIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLEETLMNWDFDFEKKKSITSEDSFxxxxxxxx
RSMG_PELUB      TIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLEETLMNWDFDFEKKKSITSEDSF--------
RSMG_ROSDO      VVSARALADLSVLLSFAQRHLSAQGTALFMKGQSWEKEVSSAQETWSFDLKAHRSKTS------------
RSMG_DINSH      VITARALAPVSKLLEFAEPLRVAGGTCLFLKGENVQNEVSEAKNSWQFEAKYYPSVTSEKS---------
RSMG_RICRS      ILTCRAFSNLNTIFNCI-KNISVREKFLLLKGKNYLTEIVEAKERWLFGYLIHQSITCEE----------
RSMG_RICRO      ILTCRAFSNLNTIFNCI-KNISVREKFLLLKGKNYLTEIVEAKERWLFGYLIHQSITCEE----------
RSMG_RICFE      ILTCRAFSKLNTIFNCI-KNISVQEKFLLLKGKNYLTEIVEAKEMWLFDYLIHQSITCEE----------
RSMG_MARMM      LITARAFAPLNKLLGYASPLLKNRAQGLFFKGQNYRDELTEARKHWTFDCEVIPSRTSD-----------
RSMG_PARDP      NLSARALAPLPQLMAYVERHLSPSGTAWLMKGRNWQAEVSQAQSDWKFDLKTHQSATDPDA---------
RSMG_ORITI      IVTVRALANLSTILSHT-KQFTVKDKYLILKGKNYQHEITQALLHNKFNYRLYKSCTDDSSW--------
RSMG_MAGSA      VVTARALAPLDRLLGWAFPHLAEGGECLFLKGRGAEDELTASAKEWNITASRVPSLT-------------
RSMG_AGRRK      VISARALAELDMLLDYAWVERNENLRLLLHKGRDYEREVHKARGRWEFDLVKHNSVVESDS---------
RSMG_RICCN      ILTCRAFSNLNTIFNCI-KNISVREKFLLLKGKNYLTEIVEAKERWLFGYLIHQSITCEE----------
RSMG_RICAE      ILTCRAFSNLNTIFNCI-KNISVREKFLLLKGKNYLTEIVEAKERWLFGYLIHQSITCEE----------
RSMG_SILPO      ILSARALTDLTGLLGFAERHLKIGGTALFPKGAAWKKELQDAAKQWNFSYDAVTSLT-------------
RSMG_ORITB      LVTVRALANLSTILSHT-KQFTVKDKYLILKGKNYQHEITQALLHNKFNYTLYQSCTDDSSW--------
RSMG_RICAH      ILTCRAFSKLNTIFNCI-KNISVQEKVLLLKGKNYLTEIVAAKEMWLFDYLIHQSITCEE----------
RSMG_ERYLH      VISARAFAPLEKLLRLSARFSTDTTTWVLPKGRSAAQELQGVSRKWQKLFHVEQSVTSEEA---------
RSMG_RHILO      IVTARALASLSVLLELTAPWLTSGARGLFHKGRDYRAEVQESVNRWAFDLVEHPSVT-------------
RSMG_JANSC      VISARALSSLSNLIGHARPHMTPKTCLLFPKGMSYVAELETLPDDWQVNAEVIESVTDSDA---------
RSMG_BART1      IITARGLAPLNELLQLIFPLLTEKTIALLQKGRDYATEVKNASANWHFDLLKHTSKIDENS---------
RSMG_RICTY      ILTCRAFSNLNTIFNCT-QNISVREKFLLLKGKNYLTEIVKAKEKWLFDYLIHQSIT-------------
RSMG_RICM5      ILTCRAFSNLNTIFNCI-KNISVREKFLLLKGKNYLTEIVEAKERWLFGYLIHQSITCEE----------
RSMG_RICBR      ILTCRAFSNLNTIFDCT-KNISVQNKFLLPKGKSYLSEIKEARKKWLFKCLINQSITSKES---------
RSMG_RICB8      ILTCRAFSNLNTIFDCT-KNISVQNKFLLPKGKSYLSEIKEARKKWLFKCLINQSITSKES---------
RSMG_HYPNA      FVTARAFAPLPELLDYAAPWLRKGAVGVFPKGERWNEELTAARQRWNFAYE-------------------
RSMG_ACICJ      LVTARALAALPVLFGYAAPLLAPGGVCLFLKGRGADAELTAAAEGWQMRAERFPSQT-------------
RSMG_ZYMMO      IITARAFAPLDKLWRLAFPFSHNESLWLLPKGQNARTELEETRKLWQGDTRIEGSVTDPQS---------
RSMG_CAMFF      LITSRALSKTLFLIEICRGFYDENTTFLLYKGDGAKE---------------------------------
RSMG_RICPR      ILTCRAFSNLNTIFNYT-QNISVREKFLLLKGKSYLTEIVEAKERWSFDYLIHQSIT-------------
RSMG_SILST      VLSARALADLDNLLGFAERHLAENGTAMFPKGANWKKEVDNARKRWRFECDEITSVT-------------
RSMG_BARQU      VITARGLACLDELLQLIFPLLTQKTIALLQKGRDYAIEITNASANWQFDLLKHKSKIDKNS---------
RSMG_SPHAL      TISARAFAPLDRLIDLSARFSTESTRWLLPKGRNAVKELALLPEPWQRMFHVEQSRTDAES---------
RSMG_SINMW      AISARALSDLSQLLEYCWMTVEASRTIAFFKGRDYQLEIDKAVSRFQFDLVKHASVVEPDS---------
RSMG_RHILW      AISARALADLDGLLEYSAPWMLGEKDCRGFFGRDYLREIDKARGRWEFDLLEHSSAVEQES---------
RSMG_MESSB      VITARALAPLPVLFGLAEPWMKAGARALLHKGRDYRREIEESRDAWGFN---------------------
RSMG_CAUCR      IVTARACAPMTKLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTFESELRTS---------------
RSMG_CAUCN      IVTARACAPMTKLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTFESELRTS---------------
RSMG_RHIE6      AISARALADLDGLIGYAAPWMLGKENCRGFFGRDYLREIDEARGRWEFDLVEHKSAVEQES---------
RSMG_RHIL3      AISARALTDLDGLIGYSSPWMLGKENCRGFFGRDYLREIDKARGRWEFDLLEHKSAVEQES---------
RSMG_RHOS5      VISARALAPLTDLCALAAPHLAPEGMCLFPKGANYASEIAAARLSWNMEPEIHPSVT-------------
RSMG_RHORT      VVTARAFAPLARILEGAAPFLLAGAQGVFLKGQSVDDELTEAQSQWTMSVER------------------
RSMG_GLUDA      VVTARALAALPQLLEW-SSHFLAPDGFCLFLGRNVEDELTAAAADWHMAVSRLPSRTNAD----------
RSMG_RHOS1      ----------------------------------------------------------------------
RSMG_GLUOX      IITARALAPLNRLLEWARPLLKEDGFCLFLKGQKAQAELTEASADW------------------------
RSMG_AZOC5      VVSARALAPLPKLLDLTEPFLQAGALGVFPKGRDWERELTDARKGWTLDLNLHRSV--------------


                         .         .         .         +         .         .         .:280
query           xxx
RSMG_PELUB      ---
RSMG_ROSDO      ---
RSMG_DINSH      ---
RSMG_RICRS      ---
RSMG_RICRO      ---
RSMG_RICFE      ---
RSMG_MARMM      ---
RSMG_PARDP      ---
RSMG_ORITI      ---
RSMG_MAGSA      ---
RSMG_AGRRK      ---
RSMG_RICCN      ---
RSMG_RICAE      ---
RSMG_SILPO      ---
RSMG_ORITB      ---
RSMG_RICAH      ---
RSMG_ERYLH      ---
RSMG_RHILO      ---
RSMG_JANSC      ---
RSMG_BART1      ---
RSMG_RICTY      ---
RSMG_RICM5      ---
RSMG_RICBR      ---
RSMG_RICB8      ---
RSMG_HYPNA      ---
RSMG_ACICJ      ---
RSMG_ZYMMO      ---
RSMG_CAMFF      ---
RSMG_RICPR      ---
RSMG_SILST      ---
RSMG_BARQU      ---
RSMG_SPHAL      ---
RSMG_SINMW      ---
RSMG_RHILW      ---
RSMG_MESSB      ---
RSMG_CAUCR      ---
RSMG_CAUCN      ---
RSMG_RHIE6      ---
RSMG_RHIL3      ---
RSMG_RHOS5      ---
RSMG_RHORT      ---
RSMG_GLUDA      ---
RSMG_RHOS1      ---
RSMG_GLUOX      ---
RSMG_AZOC5      ---