[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21175.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
    6::260     2e-73  53%  267 aa  PARA_CAUCR RecName: Full=Chromosome partitioning protein parA;
    6::260     2e-73  53%  267 aa  PARA_CAUCN RecName: Full=Chromosome partitioning protein parA;
    3::250     1e-64  50%  253 aa  SOJ_BACHD RecName: Full=Sporulation initiation inhibitor protein
    8::250     6e-64  49%  253 aa  SOJ_TREPA RecName: Full=Protein soj homolog;
    3::248     4e-62  48%  253 aa  SOJ_BACSU RecName: Full=Sporulation initiation inhibitor protein
    3::234     7e-58  48%  263 aa  YGIDB_PSEPU RecName: Full=Uncharacterized protein in gidB 3'region;
    3::234     7e-58  48%  263 aa  Y002_PSEPK RecName: Full=Uncharacterized protein PP_0002;
    1::247     3e-34  33%  259 aa  Y3524_METJA RecName: Full=Uncharacterized protein MJECL24;
    1::249     2e-33  37%  255 aa  PARA_CHLPN RecName: Full=ParA family protein
    1::241     1e-31  37%  255 aa  PARA_CHLMU RecName: Full=ParA family protein TC_0871;
    1::241     9e-31  37%  255 aa  PARA_CHLTR RecName: Full=ParA family protein CT_582;
    1::247     2e-26  33%  259 aa  GP5D_CHLPS RecName: Full=Virulence plasmid parA family protein
    5::224     9e-23  32%  268 aa  GP5D_CHLMU RecName: Full=Virulence plasmid parA family protein
  119::358     2e-22  34%  404 aa  REPA_AGRRH RecName: Full=Putative replication protein A;
  121::372     3e-22  29%  407 aa  Y4CK_RHISN RecName: Full=Putative replication protein A;
    1::220     3e-20  35%  264 aa  GP5D_CHLTR RecName: Full=Virulence plasmid parA family protein
    2::202     4e-19  32%  270 aa  PARA_MYCPN RecName: Full=ParA family protein MPN_688;
  106::340     2e-18  29%  364 aa  INCC2_ECOLX RecName: Full=Protein incC;
    2::262     1e-17  28%  269 aa  PARA_MYCGE RecName: Full=ParA family protein MG470;
   22::247     2e-11  30%  268 aa  MIND_HELPY RecName: Full=Septum site-determining protein
  108::332     3e-11  29%  388 aa  SOPA_ECOLI RecName: Full=Protein sopA;AltName: Full=Plasmid
  108::332     3e-11  29%  388 aa  SOPA_ECO57 RecName: Full=Protein sopA;AltName: Full=Plasmid
   22::247     6e-11  30%  268 aa  MIND_HELPJ RecName: Full=Septum site-determining protein
  527::700     2e-10  30%  719 aa  WZC_SALTI RecName: Full=Tyrosine-protein kinase wzc;       
   18::248     2e-10  32%  284 aa  NIFH1_METTL RecName: Full=Nitrogenase iron protein 1;       
  527::700     3e-10  30%  719 aa  WZC_SALTY RecName: Full=Tyrosine-protein kinase wzc;       
  110::274     3e-10  28%  398 aa  PARA_ECOLX RecName: Full=Plasmid partition protein A;
  554::716     9e-10  31%  750 aa  EPSB2_RALSO RecName: Full=Putative tyrosine-protein kinase epsB;   
  554::716     9e-10  31%  751 aa  EPSB1_RALSO RecName: Full=Putative tyrosine-protein kinase epsB;   
  538::701     2e-09  29%  720 aa  WZC_ECOLI RecName: Full=Tyrosine-protein kinase wzc;       
  538::701     2e-09  29%  720 aa  WZC_ECO57 RecName: Full=Tyrosine-protein kinase wzc;       
   33::288     3e-09  23%  295 aa  Y949_PYRHO RecName: Full=Uncharacterized ATP-binding protein
  113::334     3e-09  27%  358 aa  INCC1_ECOLX RecName: Full=Protein incC;
    1::189     5e-09  27%  246 aa  Y2821_BORBU RecName: Full=Uncharacterized protein BBD21;
    9::237     1e-08  26%  272 aa  NIFH6_CLOPA RecName: Full=Nitrogenase iron protein 6;       
  537::704     1e-08  29%  733 aa  PTK_ACIJO RecName: Full=Tyrosine-protein kinase ptk;       
   35::155     1e-08  29%  227 aa  CPSD2_STRPN RecName: Full=Tyrosine-protein kinase cpsD;       
   34::169     2e-08  34%  298 aa  YLXH_BACSU RecName: Full=Uncharacterized protein ylxH;
   26::237     2e-08  25%  264 aa  Y547_METJA RecName: Full=Uncharacterized ATP-binding protein
   33::288     2e-08  24%  295 aa  Y1145_PYRFU RecName: Full=Uncharacterized ATP-binding protein
    9::124     2e-08  39%  274 aa  NIFH_DEHE1 RecName: Full=Nitrogenase iron protein;       
    9::85      3e-08  44%  272 aa  NIFH_CLOAB RecName: Full=Nitrogenase iron protein;       
   45::184     5e-08  32%  237 aa  YWQD_BACSU RecName: Full=Tyrosine-protein kinase ywqD;       
    9::237     5e-08  26%  272 aa  NIFH2_CLOPA RecName: Full=Nitrogenase iron protein 2;       
    9::47      9e-08  56%  279 aa  NIFH_METJA RecName: Full=Nitrogenase iron protein;       
   33::284     1e-07  20%  295 aa  Y851_PYRAB RecName: Full=Uncharacterized ATP-binding protein
    9::47      1e-07  54%  292 aa  NIFH2_METTL RecName: Full=Nitrogenase iron protein 2;       
    9::58      4e-07  46%  278 aa  NIFH_METVO RecName: Full=Nitrogenase iron protein;       
    3::120     6e-07  37%  264 aa  Y410_METJA RecName: Full=Uncharacterized ATP-binding protein
    9::237     6e-07  26%  273 aa  NIFH1_CLOPA RecName: Full=Nitrogenase iron protein 1;       
   44::186     7e-07  31%  227 aa  YVEL_BACSU RecName: Full=Putative tyrosine-protein kinase yveL;    
    9::122     7e-07  35%  273 aa  NIFH4_CLOPA RecName: Full=Nitrogenase iron protein 4;       
    9::44      1e-06  56%  274 aa  NIFH_CHLCH RecName: Full=Nitrogenase iron protein;       
    9::44      2e-06  53%  274 aa  NIFH_PELPB RecName: Full=Nitrogenase iron protein;       
    9::44      2e-06  53%  274 aa  NIFH_PELLD RecName: Full=Nitrogenase iron protein;       
    9::44      2e-06  53%  274 aa  NIFH_CHLTE RecName: Full=Nitrogenase iron protein;       
    9::44      2e-06  53%  274 aa  NIFH_CHLP8 RecName: Full=Nitrogenase iron protein;       
    9::44      2e-06  53%  274 aa  NIFH_CHLL2 RecName: Full=Nitrogenase iron protein;       
   11::255     2e-06  24%  296 aa  NIFH_ALCFA RecName: Full=Nitrogenase iron protein;       
    9::237     2e-06  25%  273 aa  NIFH5_CLOPA RecName: Full=Nitrogenase iron protein 5;       
   11::57      2e-06  43%  290 aa  NIFH2_AZOVI RecName: Full=Nitrogenase iron protein 2;       
   12::47      2e-06  50%  296 aa  NIFH_DECAR RecName: Full=Nitrogenase iron protein;       
    9::44      2e-06  47%  271 aa  NIFH_CLOCB RecName: Full=Nitrogenase iron protein;       
    1::79      2e-06  41%  289 aa  CHLL_MICAN RecName: Full=Light-independent protochlorophyllide
   11::46      3e-06  50%  292 aa  NIFH_TERTT RecName: Full=Nitrogenase iron protein;       
   11::46      3e-06  47%  296 aa  NIFH_MAGSM RecName: Full=Nitrogenase iron protein;       
   11::46      3e-06  50%  293 aa  NIFH_KLEPN RecName: Full=Nitrogenase iron protein;       
   11::46      3e-06  50%  293 aa  NIFH_KLEP3 RecName: Full=Nitrogenase iron protein;       
    9::44      3e-06  50%  275 aa  NIFH_DESAD RecName: Full=Nitrogenase iron protein;       
   11::46      3e-06  50%  290 aa  NIFH2_AZOCH RecName: Full=Nitrogenase iron protein 2;       
   11::46      3e-06  50%  290 aa  NIFH1_AZOVI RecName: Full=Nitrogenase iron protein 1;       
   11::46      3e-06  50%  291 aa  NIFH1_AZOCH RecName: Full=Nitrogenase iron protein 1;       
    9::122     4e-06  35%  274 aa  NIFH_UNCMA RecName: Full=Nitrogenase iron protein;       
   11::46      4e-06  50%  293 aa  NIFH_PSEU5 RecName: Full=Nitrogenase iron protein;       
   11::46      4e-06  47%  293 aa  NIFH_ERWCT RecName: Full=Nitrogenase iron protein;       
    9::122     4e-06  34%  272 aa  NIFH_DESRM RecName: Full=Nitrogenase iron protein;       
  533::706     4e-06  29%  726 aa  ETK_ECOLI RecName: Full=Tyrosine-protein kinase etk;       
  533::706     4e-06  29%  726 aa  ETK_ECO57 RecName: Full=Tyrosine-protein kinase etk;       
  533::706     4e-06  29%  726 aa  ETK_ECO27 RecName: Full=Tyrosine-protein kinase etk;       
   11::46      5e-06  50%  295 aa  NIFH_TOLAT RecName: Full=Nitrogenase iron protein;       
   35::119     6e-06  35%  227 aa  CPSD1_STRPN RecName: Full=Tyrosine-protein kinase cpsD;       
    1::79      6e-06  39%  288 aa  CHLL_SYNY3 RecName: Full=Light-independent protochlorophyllide
    1::79      6e-06  39%  289 aa  CHLL_CYAP8 RecName: Full=Light-independent protochlorophyllide
    9::44      8e-06  50%  274 aa  NIFH_PROVI RecName: Full=Nitrogenase iron protein;       
    9::44      8e-06  50%  274 aa  NIFH_CHLPD RecName: Full=Nitrogenase iron protein;       
    9::44      8e-06  44%  272 aa  NIFH_ALKMQ RecName: Full=Nitrogenase iron protein;       
    9::251     8e-06  23%  273 aa  NIFH2_METBA RecName: Full=Nitrogenase iron protein 2;       
   23::249     8e-06  26%  270 aa  MIND_BUCAP RecName: Full=Septum site-determining protein
   10::79      8e-06  43%  288 aa  CHLL_SYNP2 RecName: Full=Light-independent protochlorophyllide
    1::45      8e-06  44%  275 aa  BCHL_PROA2 RecName: Full=Light-independent protochlorophyllide
    1::79      8e-06  33%  275 aa  BCHL_CHLPB RecName: Full=Light-independent protochlorophyllide
   50::226     1e-05  25%  263 aa  Y169_METJA RecName: Full=Uncharacterized ATP-binding protein
   59::98      1e-05  45%  323 aa  NUBPL_DICDI RecName: Full=Nucleotide-binding protein-like;
   13::48      1e-05  53%  283 aa  CHLL_SYNJA RecName: Full=Light-independent protochlorophyllide
    8::77      1e-05  43%  282 aa  CHLL_CYAPA RecName: Full=Light-independent protochlorophyllide
   46::160     1e-05  32%  228 aa  CAPB_STAAU RecName: Full=Putative tyrosine-protein kinase capB;    
    1::45      1e-05  47%  273 aa  BCHL_CHLSY RecName: Full=Light-independent protochlorophyllide
    1::45      1e-05  47%  273 aa  BCHL_CHLAD RecName: Full=Light-independent protochlorophyllide
    1::45      1e-05  47%  273 aa  BCHL_CHLAA RecName: Full=Light-independent protochlorophyllide
  529::650     2e-05  26%  722 aa  YC06_KLEPN RecName: Full=Putative tyrosine-protein kinase in cps
    9::44      2e-05  42%  299 aa  NIFH_CYAP7 RecName: Full=Nitrogenase iron protein;       
    8::77      2e-05  41%  288 aa  CHLL_TRIEI RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  289 aa  CHLL_SCEOB RecName: Full=Light-independent protochlorophyllide
    8::77      2e-05  40%  286 aa  CHLL_PLEBO RecName: Full=Light-independent protochlorophyllide
   23::251     2e-05  30%  270 aa  MIND_SHIFL RecName: Full=Septum site-determining protein
   23::251     2e-05  30%  270 aa  MIND_ECOLI RecName: Full=Septum site-determining protein
   23::251     2e-05  30%  270 aa  MIND_ECOL6 RecName: Full=Septum site-determining protein
   23::251     2e-05  30%  270 aa  MIND_ECO57 RecName: Full=Septum site-determining protein
    8::43      2e-05  50%  281 aa  CHLL_THEEB RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  286 aa  CHLL_SYNP6 RecName: Full=Light-independent protochlorophyllide
   13::48      2e-05  50%  283 aa  CHLL_SYNJB RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  286 aa  CHLL_SYNE7 RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  288 aa  CHLL_NOSP7 RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  286 aa  CHLL_CYAP4 RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  288 aa  CHLL_ANAVT RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  288 aa  CHLL_ANASP RecName: Full=Light-independent protochlorophyllide
    8::43      2e-05  50%  286 aa  CHLL_ACAM1 RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  275 aa  BCHL_PROVI RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  275 aa  BCHL_PELPB RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  276 aa  BCHL_PELLD RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  276 aa  BCHL_CHLTE RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  275 aa  BCHL_CHLPD RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  276 aa  BCHL_CHLP8 RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  275 aa  BCHL_CHLL2 RecName: Full=Light-independent protochlorophyllide
    1::45      2e-05  42%  276 aa  BCHL_CHLCH RecName: Full=Light-independent protochlorophyllide
   10::109     3e-05  33%  275 aa  NIFH3_AZOVI RecName: Full=Nitrogenase iron protein 3;       
    8::43      3e-05  50%  288 aa  CHLL_STIHE RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  295 aa  CHLL_PHYPA RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  296 aa  CHLL_MESVI RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  289 aa  CHLL_MARPO RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  294 aa  CHLL_LEPTE RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  300 aa  CHLL_CHLVU RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  300 aa  CHLL_CHLPR RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  296 aa  CHLL_CHLAT RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  288 aa  CHLL_CHAVU RecName: Full=Light-independent protochlorophyllide
    8::43      3e-05  50%  290 aa  CHLL_ANGEV RecName: Full=Light-independent protochlorophyllide
  531::668     3e-05  29%  726 aa  AMSA_ERWAM RecName: Full=Putative tyrosine-protein kinase amsA;    
    9::44      4e-05  44%  287 aa  NIFH_FRASP RecName: Full=Nitrogenase iron protein;       
    9::44      4e-05  44%  287 aa  NIFH_FRASC RecName: Full=Nitrogenase iron protein;       
    9::44      4e-05  42%  296 aa  NIFH_CYAP8 RecName: Full=Nitrogenase iron protein;       
   13::48      4e-05  42%  296 aa  NIFH2_ANAVT RecName: Full=Nitrogenase iron protein 2;       
   36::79      4e-05  45%  333 aa  BCHX_RHOS4 RecName: Full=Chlorophyllide reductase 35.5 kDa chain;
    9::44      5e-05  39%  292 aa  NIFH_SYNJB RecName: Full=Nitrogenase iron protein;       
    9::44      5e-05  39%  292 aa  NIFH_SYNJA RecName: Full=Nitrogenase iron protein;       
   12::47      5e-05  44%  292 aa  NIFH_HERSE RecName: Full=Nitrogenase iron protein;       
   12::47      5e-05  44%  294 aa  NIFH_BRASP RecName: Full=Nitrogenase iron protein;       
   12::47      5e-05  44%  294 aa  NIFH_BRAJA RecName: Full=Nitrogenase iron protein;       
   22::226     5e-05  27%  271 aa  MIND_THEMA RecName: Full=Septum site-determining protein
    8::43      5e-05  47%  290 aa  CHLL_PORYE RecName: Full=Light-independent protochlorophyllide
    8::43      5e-05  47%  290 aa  CHLL_PORPU RecName: Full=Light-independent protochlorophyllide
    8::77      5e-05  41%  311 aa  CHLL_OLTVI RecName: Full=Light-independent protochlorophyllide
   11::46      7e-05  42%  293 aa  NIFH_AZOBR RecName: Full=Nitrogenase iron protein;       
   14::49      7e-05  42%  307 aa  NIFH2_MASLA RecName: Full=Nitrogenase iron protein 2;       
    5::48      7e-05  41%  263 aa  COOC_RHORU RecName: Full=Carbon monoxide dehydrogenase accessory
    8::43      7e-05  47%  290 aa  CHLL_ZYGCR RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  289 aa  CHLL_STAPU RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  291 aa  CHLL_PINTH RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  291 aa  CHLL_PINKO RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  291 aa  CHLL_PINCO RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  291 aa  CHLL_PICAB RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  291 aa  CHLL_LARDC RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  292 aa  CHLL_HUPLU RecName: Full=Light-independent protochlorophyllide
    8::77      7e-05  37%  275 aa  CHLL_GLOVI RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  290 aa  CHLL_CHAGL RecName: Full=Light-independent protochlorophyllide
    8::43      7e-05  47%  293 aa  CHLL_ADICA RecName: Full=Light-independent protochlorophyllide
    1::252     9e-05  23%  253 aa  Y685_METJA RecName: Full=Uncharacterized ATP-binding protein
    1::39      9e-05  44%  231 aa  VIRC1_RHIRD RecName: Full=Protein virC1;
    9::137     9e-05  35%  265 aa  NIFH2_METTH RecName: Full=Nitrogenase iron protein 2;       
   22::226     9e-05  25%  268 aa  MIND_BACSU RecName: Full=Septum site-determining protein
    8::46      9e-05  46%  287 aa  CHLL_NEPOL RecName: Full=Light-independent protochlorophyllide
   12::58      1e-04  36%  297 aa  NIFH_RHILT RecName: Full=Nitrogenase iron protein;       
   12::47      1e-04  42%  299 aa  NIFH_METNO RecName: Full=Nitrogenase iron protein;       
   10::254     1e-04  23%  275 aa  NIFH1_METBA RecName: Full=Nitrogenase iron protein 1;       
    8::43      1e-04  47%  293 aa  CHLL_CHLRE RecName: Full=Light-independent protochlorophyllide
   12::47      2e-04  42%  291 aa  NIFH_RHOSH RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  291 aa  NIFH_RHOS4 RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  291 aa  NIFH_RHOS1 RecName: Full=Nitrogenase iron protein;       
   12::72      2e-04  41%  297 aa  NIFH_RHIME RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  299 aa  NIFH_METS4 RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  298 aa  NIFH_GLUDA RecName: Full=Nitrogenase iron protein;       
   13::48      2e-04  42%  296 aa  NIFH_ACIF5 RecName: Full=Nitrogenase iron protein;       
   13::48      2e-04  42%  296 aa  NIFH_ACIF2 RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  295 aa  NIFH1_RHOCA RecName: Full=Nitrogenase iron protein 1;       
   12::47      2e-04  42%  295 aa  NIFH_ZYMMO RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  299 aa  NIFH_RHOPS RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  299 aa  NIFH_RHOP2 RecName: Full=Nitrogenase iron protein;       
   12::72      2e-04  41%  297 aa  NIFH_RHILO RecName: Full=Nitrogenase iron protein;       
   12::72      2e-04  41%  297 aa  NIFH_RHIET RecName: Full=Nitrogenase iron protein;       
   14::49      2e-04  39%  296 aa  NIFH_PLEBO RecName: Full=Nitrogenase iron protein;       
   14::49      2e-04  39%   74 aa  NIFH_NOSSN RecName: Full=Nitrogenase iron protein;       
   14::49      2e-04  39%  297 aa  NIFH_NOSCO RecName: Full=Nitrogenase iron protein;       
    9::44      2e-04  39%  289 aa  NIFH_FRASN RecName: Full=Nitrogenase iron protein;       
    9::44      2e-04  39%  287 aa  NIFH_FRASE RecName: Full=Nitrogenase iron protein;       
   12::47      2e-04  42%  296 aa  NIFH2_AZOC5 RecName: Full=Nitrogenase iron protein 2;       
   15::50      2e-04  39%  297 aa  NIFH2_ANASP RecName: Full=Nitrogenase iron protein 2;       
   12::47      2e-04  42%  296 aa  NIFH1_AZOC5 RecName: Full=Nitrogenase iron protein 1;       
    8::43      2e-04  47%  290 aa  CHLL_CYCTA RecName: Full=Light-independent protochlorophyllide
   36::79      2e-04  45%  333 aa  BCHX_RHOCA RecName: Full=Chlorophyllide reductase 35.5 kDa chain;
    9::246     3e-04  26%  280 aa  NIFH_METHJ RecName: Full=Nitrogenase iron protein;       
    9::44      3e-04  39%  287 aa  NIFH_FRAAL RecName: Full=Nitrogenase iron protein;       
   98::227     3e-04  25%  318 aa  MRP_RICBR RecName: Full=Protein mrp homolog;
   61::97      3e-04  53%  315 aa  NUP1B_XENLA RecName: Full=Cytosolic Fe-S cluster assembly factor
   61::97      3e-04  53%  315 aa  NUP1A_XENLA RecName: Full=Cytosolic Fe-S cluster assembly factor
   61::97      3e-04  53%  320 aa  NUBP1_XENTR RecName: Full=Cytosolic Fe-S cluster assembly factor
    9::44      3e-04  44%  273 aa  NIFH_ROSS1 RecName: Full=Nitrogenase iron protein;       
    9::44      3e-04  44%  273 aa  NIFH_ROSCS RecName: Full=Nitrogenase iron protein;       
   12::47      3e-04  39%  295 aa  NIFH_RHORU RecName: Full=Nitrogenase iron protein;       
   12::47      3e-04  42%  296 aa  NIFH_RHISN RecName: Full=Nitrogenase iron protein;       
   14::49      3e-04  36%  295 aa  NIFH_NOSS6 RecName: Full=Nitrogenase iron protein;       
   14::49      3e-04  36%  298 aa  NIFH_CYAP4 RecName: Full=Nitrogenase iron protein;       
   14::49      3e-04  36%  294 aa  NIFH_ANASL RecName: Full=Nitrogenase iron protein;       
   14::49      3e-04  36%  295 aa  NIFH_ANAAZ RecName: Full=Nitrogenase iron protein;       
   13::48      3e-04  36%  295 aa  NIFH1_MASLA RecName: Full=Nitrogenase iron protein 1;       
   14::49      3e-04  36%  295 aa  NIFH1_ANAVT RecName: Full=Nitrogenase iron protein 1;       
   14::49      3e-04  36%  295 aa  NIFH1_ANASP RecName: Full=Nitrogenase iron protein 1;       
   22::228     3e-04  22%  272 aa  MIND_EMIHU RecName: Full=Putative septum site-determining protein
   23::251     3e-04  25%  270 aa  MIND_BUCAI RecName: Full=Septum site-determining protein
    1::45      3e-04  40%  274 aa  BCHL_CHLT3 RecName: Full=Light-independent protochlorophyllide
    1::112     4e-04  30%  231 aa  VIRC1_AGRRH RecName: Full=Protein virC1;
   20::142     4e-04  28%  275 aa  NUBP2_MOUSE RecName: Full=Cytosolic Fe-S cluster assembly factor
   13::48      4e-04  42%  296 aa  NIFH_THIFE RecName: Full=Nitrogenase iron protein;       
   13::48      4e-04  42%  160 aa  CHLL_POLAC RecName: Full=Light-independent protochlorophyllide
    8::57      4e-04  40%  290 aa  CHLL_ANTFO RecName: Full=Light-independent protochlorophyllide
   16::52      6e-04  46%  271 aa  NUBP2_RAT RecName: Full=Cytosolic Fe-S cluster assembly factor
   12::48      6e-04  44%  303 aa  NIFH_WOLSU RecName: Full=Nitrogenase iron protein;       
   11::36      6e-04  58%   36 aa  NIFH_ENTAG RecName: Full=Nitrogenase iron protein;       
   61::97      7e-04  50%  318 aa  NUBP1_NEMVE RecName: Full=Cytosolic Fe-S cluster assembly factor
    9::45      7e-04  39%  294 aa  NIFH_TRITH RecName: Full=Nitrogenase iron protein;       
    9::45      7e-04  39%  296 aa  NIFH_TRIEI RecName: Full=Nitrogenase iron protein;       
    3::39      7e-04  49%  396 aa  ARSA1_AQUAE RecName: Full=Putative arsenical pump-driving ATPase
   16::52      0.001  46%  271 aa  NUBP2_HUMAN RecName: Full=Cytosolic Fe-S cluster assembly factor
   10::47      0.001  47%  263 aa  NIFH2_METIV RecName: Full=Nitrogenase iron protein 2;       
   60::168     0.001  31%  339 aa  LPXK_SHEB9 RecName: Full=Tetraacyldisaccharide 4'-kinase;       
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
PARA_CAUCR      LRVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQRRT-TLYDVLMGEAPV
PARA_CAUCN      LRVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQRRT-TLYDVLMGEAPV
SOJ_BACHD       -KVISIANQKGGVGKTTTAVNLSACLAHLGQRVLLVDIDPQGNATSGVGIE--KGDIDEIYDVLVEDVDT
SOJ_TREPA       ------VNQKGGVGKTTSAINLGAYLALAGKKTLLVDFDPQGNMSSGLGLAR----GLTVYDLLAGKAHI
SOJ_BACSU       -KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVE-QCXXXXXXXXXXX
YGIDB_PSEPU     -KVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHE-LEHSVYDLLIGECDL
Y002_PSEPK      -KVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHE-LEHSVYDLLIGECDL
Y3524_METJA     MVVISIANQKGGVGKTTIALNLSFTLAEKGYDTLVIDLDPQFNLSFGILGMKLLDYADKNIGILXXXXXX
PARA_CHLPN      MKTIAVNSFKGGTAKTSTTLHLGAALAQHQARVLLIDFDAQANLTSGLGLD--PDCYDSLAVVLQGEKEI
PARA_CHLMU      MKTIAVNSFKGGTAKTSTTLHLGAALAQHKARVLLIDFDAQANLTAGLGLD--PDCYDSLAVVLQGEKQI
PARA_CHLTR      MKTIAVNSFKGGTAKTSTTLHLGAALAQHKARVLLIDFDAQANLTAGLGLD--PDCYDSLAVVLQGEKNI
GP5D_CHLPS      MKTLAFCSFKGGTGKTTLSLNIGSNLAQSRKKVLLVDLDPQANLTTGLGVQIQDDHS--LNEILRHSNEI
GP5D_CHLMU      LQTLVFCSFKGGTGKTTLSLNVGCNLAQFGKRVLLIDLDPQSNLSSGLGAS-IEGNHKGLHEVMCASNDL
REPA_AGRRH      LQVISVMNFKGGSGKTTTAAHLAQYLAMRGYRVLAIDLDPQASLSALFG-SQPEGPNETLYGAIDEQVAI
Y4CK_RHISN      LQVIAVVNFKGGSGKTTTAAHLAQYMALTGHRVLAVDLDPQASLSSLHGFQPELDMSPSLYEALDQRRSI
GP5D_CHLTR      MHTLVFCSFKGGTGKTTLSLNVGCNLAQFGKKVLLADLDPQSNLSSGLGASNQKGLHDIVYT----SNDL
PARA_MYCPN      --IISFVNNKGGVLKTTMATNVAGSLVKPEQRKVILDLDGQGNVSASFG-QNPERLNNTLIDILNSSIEI
INCC2_ECOLX     MKTLVTANQKGGVGKTSTLVHLAFDFFERGLRVAVIDLDPQGNASTGLHASKLFGAVPA-----GGWTET
PARA_MYCGE      --IISFVNNKGGVLKTTMATNVAGSLVKPERRKVILDLDGQGNVSASFG-QNPERLNNTLIDILNNFIEI
MIND_HELPY      --------------------NLAIGLAESGKKVVAVDFD--------IGLRNL----DMILGLEN--RIV
SOPA_ECOLI      --VIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVENDPQGTASMYHGVPDLHHAEDTLLPFYLGEKDV
SOPA_ECO57      --VIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVENDPQGTASMYHGVPDLHHAEDTLLPFYLGEKDV
MIND_HELPJ      --------------------NLAIGLAESGKKVVAVDFD--------IGLRNL----DMILGLEN--RIV
WZC_SALTI       --VLMLTGVSSSIGKTFVCANLAAVISQTHKRVLLIDCDRKGYTHELLGTNNVDGLSD----ILAGKGEI
NIFH1_METTL     ---------KGGIGKSTTTQNTAAALAYFDKKVMIHGCDPKADSTRMI----LHGKQDTVMDVLEGEEAV
WZC_SALTY       --VLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDRKGYTHELLGTNNVDGLSD----ILAGKGEI
PARA_ECOLX      --VIFISNLKGGVSKTVSTVSLAHAMRAHDLRILVIDLDPQSSATMSIGIVNATSAQAMLQNV-SREELL
EPSB2_RALSO     -----------GVGKSFVSANLAAVIATGGKRVLLIDADRKGYLHQYFGKDRKPGLLD----LLAGNRSI
EPSB1_RALSO     -----------GVGKSFVSANLAAVIATGGKRVLLVDADRKGYLHQYFGKDRKPGLLD----LLAGDRSI
WZC_ECOLI       ------------IGKTFVCANLAAVISQTNKRVLLIDCDRKGYTHELLGTNNVNGLSE----ILIGQGDI
WZC_ECO57       ------------IGKTFVCANLAAVISQTNKRVLLIDCDRKGYTHELLGTNNVNGLSE----ILIGQGDI
Y949_PYRHO      ---IAVLSGKGGVGKSTVAVNLTAALAKMGYFVGILDADIHGNVAKMLGVDKEE-----VYAEKFDDGHF
INCC1_ECOLX     --------QKGGQGKTFATCHLAFDFLERGLRVAVIDLDTQGNASSGYLASQLTGDTDDLFGKREGE---
Y2821_BORBU     MKKIAFHIQKGGVGKTTLSGNIASYLSK-TKKVILVDCDIQ-QASSSTWFLNHEXXXXXXXXXXXXXMDV
NIFH6_CLOPA     ---------KGGIGKSTTTQNLTAGLVERGNKIMVVGCDPKADSTR-LLLGGLAQKTDTLRE--EGEDVE
PTK_ACIJO       --LITISGPAPEVGKSFISTNLATILAQSDKRVLIIDADRRGYLHKYFNLDTQPGLTE----LLNGQQSL
CPSD2_STRPN     LKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVMSGFFKSKITGLTE----FLSGTADL
YLXH_BACSU      ---LAVISGKGGVGKSNITLNMALALQDKGKKVLLIDLD--------IGMGNIDSSSATIIDVLTDRKPL
Y547_METJA      --------------------NLAVALAKFGKKVAVLDADAMANLELIMGL---EGKPVTLNDVLAGKADI
Y1145_PYRFU     ---IAVLSGKGGVGKSTVAVNLTAALAKMGYFVGILDADIHGNVAKMFGIGNTD-----IYA--------
NIFH_DEHE1      ---------KGGIGKSTTTQNTVAALAEMGRKVLVVGCDPKADSTR-LLLGGLAQKTDTLRE--EGEDVE
NIFH_CLOAB      ---------KGGIGKSTTTQNLTSGLAELGKKIMVVGCDPKADSTR-LLLGGLAQKTDTLRE--EGEDVD
YWQD_BACSU      MKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADRKPTVHTAFFLENTVGLT----SVLLKKSSM
NIFH2_CLOPA     ---------KGGIAKSTTTQNLTAGLVERGNKIMVVGCDPKADSTR-LLLGGLAQKTDTLRE--EGEDVE
NIFH_METJA      ---------KGGIGKSTTVSNIAAALAEDGKKVLVVGCDPKADTTRNL----------------------
Y851_PYRAB      ---VAVLSGKGGVGKSTVAVNLTAALAKMGYFVGILDADIHGNVAKMLGVEKEE-----IYAEKFDDGHF
NIFH2_METTL     ---------KGGIGKSTTVCNIAAALADQGKKVMVVGCDPKHDCTSNL----------------------
NIFH_METVO      ---------KGGIGKSTNVGNMAAALAEDGKKVLVVGCDPKADSTRTLMHGKINTVLDT-----------
Y410_METJA      ---IGFYNIQGGTGKTTVAANFAYILSQSVKTIL-IDCDIYGGTTAVLGLEDKEHNLNT---YLAGDSAI
NIFH1_CLOPA     ---------KGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADSTRLLGLAQ-KSVLDTLRE--EGEDVE
YVEL_BACSU      LRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVDADPTINQT--FQVDNVTGLTN----VLVGNASL
NIFH4_CLOPA     ---------KGGIGKSTTTQNLTAGLAERGNKIMVVGCDPKADSTRLLGLAQ-KSVLDTLRE--EGEDVE
NIFH_CHLCH      ---------KGGIGKSTTTQNTVAGLAEMGKKVMVIGCDPKADST-------------------------
NIFH_PELPB      ---------KGGIGKSTTTQNTVAGLAEMGKKIMVIGCDPKADST-------------------------
NIFH_PELLD      ---------KGGIGKSTTTQNTVAGLAEMGKKVMVVGCDPKADST-------------------------
NIFH_CHLTE      ---------KGGIGKSTTTQNTVAGLAEAGKKVMVVGCDPKADST-------------------------
NIFH_CHLP8      ---------KGGIGKSTTTQNTVAGLAEAGKKVMVVGCDPKADST-------------------------
NIFH_CHLL2      ---------KGGIGKSTTTQNTVAGLAEMGKKVMVVGCDPKADST-------------------------
NIFH_ALCFA      ---------KGGIGKSTTTQNLVAALAELGKKVMIVGCDPKADSTRLILHSKAQ---NTIMEMAAEAGTV
NIFH5_CLOPA     ---------KGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADSTRLLGLAQ-KSVLDTLRE--EGEDVE
NIFH2_AZOVI     ---------KGGIGKSTTTQNLVAALAEAGKKVMIVGCDPKADSTRLILHSKAQGT--------------
NIFH_DECAR      ---------KGGIGKSTTTQNLVAALAESGKKVMIVGCDPKADST-------------------------
NIFH_CLOCB      ---------KGGIGKSTTTQNLTAGLGEMGKKIMIVGCDPKADST-------------------------
CHLL_MICAN      MPLTLAVYGKGGIGKSTTSCNISAALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
NIFH_TERTT      ---------KGGIGKSTTTQNLVAALAEAGKKVMIVGCDPKADST-------------------------
NIFH_MAGSM      ---------KGGIGKSTTTQNLVAGLAEAGNKIMIVGCDPKADST-------------------------
NIFH_KLEPN      ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
NIFH_KLEP3      ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
NIFH_DESAD      ---------KGGIGKSTTTQNTVAGLATMDRKVMVVGCDPKADST-------------------------
NIFH2_AZOCH     ---------KGGIGKSTTTQNLVAALAEAGKKVMIVGCDPKADST-------------------------
NIFH1_AZOVI     ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
NIFH1_AZOCH     ---------KGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADST-------------------------
NIFH_UNCMA      ---------KGGIGKSTTTQNTVAALAESGKKVMVVGCDPKADSTRLLGL-NQKTVLDTLRD--EGDDIE
NIFH_PSEU5      ---------KGGIGKSTTTQNLVAALAELGKKVMIVGCDPKADST-------------------------
NIFH_ERWCT      ---------KGGIGKSTTTQNLVAALAEMGKKIMIVGCDPKADST-------------------------
NIFH_DESRM      ---------KGGIGKSTTTQNTVAALAEAGKKIMVVGCDPKADSTRLLGL-NQKTVLDTLRD--EGEDID
ETK_ECOLI       --ILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADRRGYSHNLFTVSNEHGLSE----YLAGKDEL
ETK_ECO57       --ILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADRRGYSHNLFTVSNEHGLSE----YLAGKDEL
ETK_ECO27       --ILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADRRGYSHNLFTVSNEHGLSE----YLAGKDEL
NIFH_TOLAT      ---------KGGIGKSTTTQNLVSALAEMGKKVMIIGCDPKADST-------------------------
CPSD1_STRPN     LKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDTRNSVMLGVFKSKITGLTE----FLSGTADL
CHLL_SYNY3      MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
CHLL_CYAP8      MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
NIFH_PROVI      ---------KGGIGKSTTTQNTVAALAEMGKKVMVVGCDPKADST-------------------------
NIFH_CHLPD      ---------KGGIGKSTTTQNTVAGLAEMGMKVMVVGCDPKADST-------------------------
NIFH_ALKMQ      ---------KGGIGKSTTTQNLTAALGESGKKIMIVGCDPKADST-------------------------
NIFH2_METBA     ---------KGGIGKSTTTQNLTASLSTMGNKIMLVGCDPKADSTRMLGGLNQKTVLDTLRSE-GDEGVD
MIND_BUCAP      ---------------------IATGLAQKGKKTVVIDFD--------IGLRNLDCERRVVYDFINDARIQ
CHLL_SYNP2      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
BCHL_PROA2      MSLILAVYGKGGIGKSTTTANISAALALQGAKVLQIGCDPKHDST-------------------------
BCHL_CHLPB      MSLILAVYGKGGIGKSTTTANISAALALKGAKVLQIGCDPKHDSTFPL--------TGTL------QKTV
Y169_METJA      -------------------------------------------------LFNMEKKKPSLHEVLSEEADV
NUBPL_DICDI     --IIAVSSAKGGVGKSTCAVNIALGLSSHNLSVGLLDVDVFG----------------------------
CHLL_SYNJA      ---------KGGIGKSTTSCNLSVALAKRGKKVLQIGCDPKHDST-------------------------
CHLL_CYAPA      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPK------------HDSTFTLTGHLIPT--I
CAPB_STAAU      -----ITSEKSASGKSILSANIAVTYAQAGYKTLIIDGDMRKDLPNNSGLSNL---------IINKT-TY
BCHL_CHLSY      MSLILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLAD      MSLILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLAA      MSLILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDST-------------------------
YC06_KLEPN      --LLMISGASPNAGKTFVSSNLSSVISQTGKKVIFIDADLRKGYTHKLNIKNTNGLSD----YLSGRVAL
NIFH_CYAP7      ---------KGGIGKSTTSQNTLAGMAQNGNRIMIVGCDPKADST-------------------------
CHLL_TRIEI      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
CHLL_SCEOB      ---------KGGIGKSTTSCNISIALAKRGKKVLQIGCDPKSDST-------------------------
CHLL_PLEBO      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
MIND_SHIFL      ---------------------IATGLAQKGKKTVVIDFD--------IGLRNL----DLIMGC--ERRVV
MIND_ECOLI      ---------------------IATGLAQKGKKTVVIDFD--------IGLRNL----DLIMGC--ERRVV
MIND_ECOL6      ---------------------IATGLAQKGKKTVVIDFD--------IGLRNL----DLIMGC--ERRVV
MIND_ECO57      ---------------------IATGLAQKGKKTVVIDFD--------IGLRNL----DLIMGC--ERRVV
CHLL_THEEB      ---------KGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDST-------------------------
CHLL_SYNP6      ---------KGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDST-------------------------
CHLL_SYNJB      ---------KGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDST-------------------------
CHLL_SYNE7      ---------KGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDST-------------------------
CHLL_NOSP7      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDST-------------------------
CHLL_CYAP4      ---------KGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDST-------------------------
CHLL_ANAVT      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDST-------------------------
CHLL_ANASP      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDST-------------------------
CHLL_ACAM1      ---------KGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDST-------------------------
BCHL_PROVI      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_PELPB      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_PELLD      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLTE      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLPD      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLP8      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLL2      MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
BCHL_CHLCH      MSLVIAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST-------------------------
NIFH3_AZOVI     ---------KGGIGKSTTTQNTAAALAYHDKKVFTHGCDPKADSTRLILGGKPEETLMDMVRDKGAEKIT
CHLL_STIHE      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_PHYPA      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_MESVI      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_MARPO      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_LEPTE      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_CHLVU      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_CHLPR      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_CHLAT      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_CHAVU      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
CHLL_ANGEV      ---------KGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDST-------------------------
AMSA_ERWAM      --ILMITGASPGIGKTFVCANLATLVAKTGEKVLFIDGDRRGYTHELLGAESKTGLSDILSGKLPFN---
NIFH_FRASP      ---------KGGIGKSTTQQNTMAAMAEMGKKVMIVGCDPKADST-------------------------
NIFH_FRASC      ---------KGGIGKSTTQQNTMAAMAEMGKKVMIVGCDPKADST-------------------------
NIFH_CYAP8      ---------KGGIGKSTTSQNTLAGMAQAGNRIMIVGCDPKADST-------------------------
NIFH2_ANAVT     ---------KGGIGKSTTSQNTIAGLAEMGERIMIVGCDPKADST-------------------------
BCHX_RHOS4      -QVIAIYG-KGGIGKSFTLANLSYMMAQIGKRVLLIGCDPKSDTTS------------------------
NIFH_SYNJB      ---------KGGIGKSTTCQNTVAGMAELGQRIMIVGCDPKADST-------------------------
NIFH_SYNJA      ---------KGGIGKSTTCQNTVAGMAELGQRIMIVGCDPKADST-------------------------
NIFH_HERSE      ---------KGGIGKSTTSQNTLAALAQMGQRILIVGCDPKADST-------------------------
NIFH_BRASP      ---------KGGIGKSTTSQNTLAALAEMGQKILIVGCDPKADST-------------------------
NIFH_BRAJA      ---------KGGIGKSTTSQNTLAALAEMGQKILIVGCDPKADST-------------------------
MIND_THEMA      --------------------NLGCALAKLGEKVCLIDAD--------IGLKNL----DIVLGLEN--RIV
CHLL_PORYE      ---------KGGIGKSTTSCNISVALSKRGKKVLQIGCDPKHDST-------------------------
CHLL_PORPU      ---------KGGIGKSTTSCNISVALSKRGKKVLQIGCDPKHDST-------------------------
CHLL_OLTVI      ---------KGGIGKSTVSCNLSIALAKRGKKVLQIGCDPK------------HDSTFTLTGFLIPT--I
NIFH_AZOBR      ---------KGGIGKSTTSQNTLAALVELDQKILIVGCDPKADST-------------------------
NIFH2_MASLA     ---------KGGIGKSTTSQNTLAAMAEMGKRILIVGCDPKADST-------------------------
COOC_RHORU      ------VTGKGGVGKSTIVGMLARALSDEGWRVMAIDADPDANLASAIGV--------------------
CHLL_ZYGCR      ---------KGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDST-------------------------
CHLL_STAPU      ---------KGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDST-------------------------
CHLL_PINTH      ---------KGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDST-------------------------
CHLL_PINKO      ---------KGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDST-------------------------
CHLL_PINCO      ---------KGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDST-------------------------
CHLL_PICAB      ---------KGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDST-------------------------
CHLL_LARDC      ---------KGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDST-------------------------
CHLL_HUPLU      ---------KGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDST-------------------------
CHLL_GLOVI      ---------KGGIGKSTTSCNISVALAKRGRRVLQIGCDPK------------HDSTFTLTGFLIPT--I
CHLL_CHAGL      ---------KGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDST-------------------------
CHLL_ADICA      ---------KGGIGKSTTSCNISIALARRGRKVLQIGCDPKHDST-------------------------
Y685_METJA      --MIIAVSGKGGVGKTAFTTLLIKALSKKTNSILVVDADPDSNETLGVEVEKTVGDIREELKKLVERDEI
VIRC1_RHIRD     MQLLTFCSFKGGAGKTTALMGLCAALANDGKRVALFDAD-------------------------------
NIFH2_METTH     ---------KGGIGKSTIVSNMAAAYSS-EHRVLVIGCDPKADTTRTLYGERL----PTVLDVLKENREV
MIND_BACSU      --------------------NLGTALAILGKRVCLVDTD--------IGLRNL----DVVMGLEN--RII
CHLL_NEPOL      ---------KGGIGKSTSSCNISIALATRGKKVLQIGADPKHDSTFAL----------------------
NIFH_RHILT      ---------KGGIGKSTTSQNTLAALVELGQKILIVGCDPKADSTRLILNSKAQGT--------------
NIFH_METNO      ---------KGGIGKSTTSQNTLAALVEKGQKILIVGCDPKADST-------------------------
NIFH1_METBA     ---------KGGIGKSTTQQNTAAAMAYHGKKIFIHGCDPKADCTR-LVLGGVAQTTDTL-RELGEDAVT
CHLL_CHLRE      ---------KGGIGKSTTSCNISIALRKRGKKVLQIGCDPKHDST-------------------------
NIFH_RHOSH      ---------KGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADST-------------------------
NIFH_RHOS4      ---------KGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADST-------------------------
NIFH_RHOS1      ---------KGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADST-------------------------
NIFH_RHIME      ---------KGGIGKSTTSQNTLAALVDLGQKILIVGCDPKADSTTVLHLAATEGSVEDL----------
NIFH_METS4      ---------KGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADST-------------------------
NIFH_GLUDA      ---------KGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADST-------------------------
NIFH_ACIF5      ---------KGGIGKSTTSQNTLAALTEMGQKILIVGCDPKADST-------------------------
NIFH_ACIF2      ---------KGGIGKSTTSQNTLAALTEMGQKILIVGCDPKADST-------------------------
NIFH1_RHOCA     ---------KGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADST-------------------------
NIFH_ZYMMO      ---------KGGIGKSTTSQNTLAALVELGQKILIVGCDPKADST-------------------------
NIFH_RHOPS      ---------KGGIGKSTTSQNTLAALVELGQKILIVGCDPKADST-------------------------
NIFH_RHOP2      ---------KGGIGKSTTSQNTLAALVELGQKILIVGCDPKADST-------------------------
NIFH_RHILO      ---------KGGIGKSTTSQNTLAALVDLGQKILIVGCDPKADSTTVLHLAAQEGSVEDL----------
NIFH_RHIET      ---------KGGIGKSTTSQNTLAALVDLGQKILIVGCDPKADSTTVLHLAAQEGSVEDL----------
NIFH_PLEBO      ---------KGGIGKSTTSQNTIAALAEMGERIMIVGCDPKADST-------------------------
NIFH_NOSSN      ---------KGGIGKSTTSQNTLAAMAEMGQRILIVGCDPKADST-------------------------
NIFH_NOSCO      ---------KGGIGKSTTSQNTLAAMAEMGQRILIVGCDPKADST-------------------------
NIFH_FRASN      ---------KGGIGKSTTQQNTMAAMAEMGRRVMIVGCDPKADST-------------------------
NIFH_FRASE      ---------KGGIGKSTTQQNTMAAMAEMGRRVMIVGCDPKADST-------------------------
NIFH2_AZOC5     ---------KGGIGKSTTSQNTLAALAEMGHRILIVGCDPKADST-------------------------
NIFH2_ANASP     ---------KGGIGKSTTSQNTLAAMAEMGQRILIVGCDPKADST-------------------------
NIFH1_AZOC5     ---------KGGIGKSTTSQNTLAALAEMGHRILIVGCDPKADST-------------------------
CHLL_CYCTA      ---------KGGIGKSTTSCNISIALARRGGKVLQIGCDPKHDST-------------------------
BCHX_RHOCA      -QIIAIYG-KGGSGKSFTLANLSHMMAEMGKRVLLIGCDPKSDTTS------------------------
NIFH_METHJ      ---------KGGIGKSTTSANLSAALVNRGLSVMQIGCDPKRDSTRML-----------MKGILIPT--V
NIFH_FRAAL      ---------KGGIGKSTTQQNTMAAMAEMGQRVMIVGCDPKADST-------------------------
MRP_RICBR       -KIILVASGKGGVGKSTISALIAQQLSLENHRVGIVDADIYG------------PSIPHIFGINEVPQTV
NUP1B_XENLA     ---ILVLSGKGGVGKSTFSAHLAHGLAQDEKEVALLDVD-------------------------------
NUP1A_XENLA     ---ILVLSGKGGVGKSTFSAHLAHGLAQDEKEVALLDVD-------------------------------
NUBP1_XENTR     ---ILVLSGKGGVGKSTFSAHLAHGLAQDEKEVALLDVD-------------------------------
NIFH_ROSS1      ---------KGGIGKSTTQQNTAAALASMGYRLMVVGCDPKADCT-------------------------
NIFH_ROSCS      ---------KGGIGKSTTQQNTAAALASMGYRLMVVGCDPKADCT-------------------------
NIFH_RHORU      ---------KGGIGKSTTSQNTLAALVEMGQRILIVGCDPKADST-------------------------
NIFH_RHISN      ---------KGGIGKSTTSQNTLAALVDLGQKILIVGCDPKADST-------------------------
NIFH_NOSS6      ---------KGGIGKSTTSQNTLAAMAEMGQRIMIVGCDPKADST-------------------------
NIFH_CYAP4      ---------KGGIGKSTTSQNTIAAMAEMGQRIMIVGCDPKADST-------------------------
NIFH_ANASL      ---------KGGIGKSTTSQNTLAAMAEMGQRIMIVGCDPKADST-------------------------
NIFH_ANAAZ      ---------KGGIGKSTTSQNTLAAMAEMGQRIMIVGCDPKADST-------------------------
NIFH1_MASLA     ---------KGGIGKSTTSQNTLAAMAEMGQRIMIVGCDPKADST-------------------------
NIFH1_ANAVT     ---------KGGIGKSTTSQNTLAAMAEMGQRIMIVGCDPKADST-------------------------
NIFH1_ANASP     ---------KGGIGKSTTSQNTLAAMAEMGQRIMIVGCDPKADST-------------------------
MIND_EMIHU      --------------------NIGIALAKLEQRVLLLDAD------VGXXXXXXXXXXENRI-VYNGLDVL
MIND_BUCAI      ---------------------IGTGLAQKGKKTIVIDFD--------IGLRNL----DLIMGC--ERRVV
BCHL_CHLT3      MGIVIAVYGKGGIGKSTNSANLSTALAMKGASVLQIGCDPKHDST-------------------------
VIRC1_AGRRH     MKLLTFCSFKGGAGKTTALMGLCAALASDGRRVALFDADENRPL----------------------TRWK
NUBP2_MOUSE     --IILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHM----LRAQGKAVHQCDNGVPVF
NIFH_THIFE      ---------KGGIGKSTTSQKHLAALAEMGQKILIVGCDPKADST-------------------------
CHLL_POLAC      ---------KGGIGKSTTSCNTSIALARRGRRILQIGCDPKHDST-------------------------
CHLL_ANTFO      ---------KGGIGKSTTSCNTSIASARRGKRVLQIGCDPKHDSTFTLTGSLIPTIIDT-----------
NUBP2_RAT       --IILVLSGKGGVGKSTISTELALALRHQGKKVGILDVD-------------------------------
NIFH_WOLSU      ---------KGGIGKSTTSQNTLAAMAYYGKKILIVGCDPKADST-------------------------
NIFH_ENTAG      ---------KGGIGKSTTTQNLVAALAEMNKKVMI-----------------------------------
NUBP1_NEMVE     ---ILVLSGKGGVGKSTFTAHLAHGLAADERQVAVLDID-------------------------------
NIFH_TRITH      ---------KGGIGKSTTSQNTLAAMARHGQRIMIVGCDPKADST-------------------------
NIFH_TRIEI      ---------KGGIGKSTTSQNTLAAMARHGQRIMIVGCDPKADST-------------------------
ARSA1_AQUAE     ---IILFSGKGGVGKTTISAATGYKLSQLGKKVIVVSLDP------------------------------
NUBP2_HUMAN     --IILVLSGKGGVGKSTISTELALALRHAGKKVGILDVD-------------------------------
NIFH2_METIV     ---------KGGIGKSTIVSNIAAAYSK-DYNVLVIGCDPKADTTRTL----------------------
LPXK_SHEB9      ----------GGSGKTPTVIYLIELLRQHGFTPGVISVDIQGVRTVNLGASAVEVGDEPAMIVAR-----


                         .         .         *         .         .         .         .:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
PARA_CAUCR      VDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIR--ANGPYTYVLIDCPPSLNVLTVN
PARA_CAUCN      VDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIR--ANGPYTYVLIDCPPSLNVLTVN
SOJ_BACHD       QDVIRTTNMENLDVLPSTIQLSGAEIELVSTISREVRLKRAL----DQVGRKYDFIFIDCPPSLGLLTIN
SOJ_TREPA       NSVLRTTPVHNLFAIPASIDLSGATVELVDEQDRELYLKKILA----EVKDTYDFILIDCPPSLGILTLN
SOJ_BACSU       XXXXKATTVENLDVIPATIQLAGAEIELVPTISREVRLKRALEAV----KQNYDYIIIDCPPSLGLLTIN
YGIDB_PSEPU     AQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPI----RDNYDYILIDCPPSLSMLTLN
Y002_PSEPK      AQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPI----RDNYDYILIDCPPSLSMLTLN
Y3524_METJA     XXXXXXXXXDKLDLIPSHLQLSAVEKML----VNAYAREMKLKNIINQIKENYDYIIIDNAPSLGLFLIN
PARA_CHLPN      QEVIRPIQDTQLDLIPADTWLERIEVS---GNLAADRYSHERLKYLGSVQDKYDYVIIDTPPSLCWLTES
PARA_CHLMU      SEVIRSIDSSGLDLIPADTWLERVEVS---GSLAADRYSHELKTILSTIEHQYDYVIIDTPPSLCWLTES
PARA_CHLTR      EEVIRPIDSSGLDLIPADTWLERVEVS---GSLAADRYSHELKIILSKIEHRYDYVIIDTPPSLCWLTES
GP5D_CHLPS      RRAIHKTKIENLDIIPSSVDFRGLDKDIS-------LSVNHLHLALQKVQDQYDVCILDTPPSLGILSQE
GP5D_CHLMU      KSIICKTKKTGVDIIPASF-LSEQFREFSTNGIPSSNLRLFLDEYCSP---LYDVCIVDTPPSLGGLTKE
REPA_AGRRH      ERVVRGTYIPDLHLIPGNLEL----MEFEHDTPRALMNRKEISQVIEDIADNYDVVVIDCPPQLGYLTLS
Y4CK_RHISN      SEIIQPTNFPGLDIVPANLELQEYEYDTSSNDGKTFFTR--ISRALSEVNDRYDVVVIDCPPQLGYLTIT
GP5D_CHLTR      KSIICETKKDSVDLIPASF---------LSEQFRELDIHRNLKLFLNEYCAPYDICIIDTPPSLGGLTKE
PARA_MYCPN      DDCLLPV-YEGLDILPCNFELNFADIDIARKKYKA----SDIAEIVKQLTRRYDFVLLDTPPNMATLVST
INCC2_ECOLX     APAAGDGQAARLALIESNPVLANAERLSLDDARELF--GANIKALANQG---FDVCLIDTAPTLGVGXXX
PARA_MYCGE      DDCLLSV-YEGLDILPCNFELNFADIDISRKKYKA----SDIAEIVKQLAKRYEFVLLDTPPNMATLVST
MIND_HELPY      YDVVDVME-KNCNLLITDKKTKNLSFLAASQSKDKNILDKEKVAILNALRADFDYILIDSPAGIESGFEH
SOPA_ECOLI      TYAIKPTCWPGLDIIPSCLALHRIETELMDEGKLPTDPHLMLRLAIETVAHDYDVIVIDSAPNLGIGTIN
SOPA_ECO57      TYAIKPTCWPGLDIIPSCLALHRIETELMDEGKLPTDPHLMLRLAIETVAHDYDVIVIDSAPNLGIGTIN
MIND_HELPJ      YDVVDVME-KNCNLLITDKKTKNLSFLAASQSKDKNILDKEKVAILNALRADFDYILIDSPAGIESGFEH
WZC_SALTI       ASCAKPTAIANFDLIPRG------QVPPNPSELLMSERFGELIAW---ASSRYDLVLIDTPPILA-VTDA
NIFH1_METTL     TEKVRKIGFKDILCVESGVGCAGRGVITAVDMM------RELEGYPDDLDNLFFDVLGDVVCGGFAMPLR
WZC_SALTY       ASCAKPTAIANFDLIPRG------QVPPNPSELLMSERFGELIAW---ASSRYDLVLIDTPPILA-VTDA
PARA_ECOLX      EEFIVPSVVPGVDVMPASIDDAFIASDWRE-LCNEHLPGQNIHAVLKENKSDYDFILVDSGPHLDAFLKN
EPSB2_RALSO     EQVVHREVVPGLDFIA-----TGLFPHNPSE----LLLNPRMVELMDTFRSQYDLVLVDTPPVLAVADT-
EPSB1_RALSO     EQVVHREVVPGLDFIA-----TGLFPHNPSE----LLLNPRMVELMDTFRAQYDLVLIDTPPVLA-VTDT
WZC_ECOLI       TTAAKPTSIAKFDLIPRG---------QVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILA-VTDA
WZC_ECO57       TTAAKPTSIAKFDLIPRG---------QVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILA-VTDA
Y949_PYRHO      EMIPPTTDFMGQVTPIKVMSMGMMVPEDQPVIWRGPLVTKAIKQLLGDVKGSLDFMIIDFPPGTEILTVV
INCC1_ECOLX     ---------SXXXXXXXXXXXXXXKMELSQXXXXXXXXXXXLGEF-------FDVCLIDTAPSLGVAMTA
Y2821_BORBU     DQVVRQIQFYILPCVPSGTFRRDVQHELQDFPIDDFCLELE--------KLGFEFAIFDLSPSFELWERR
NIFH6_CLOPA     LDSILKTGYAGIRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDDLDFVFYDVLGDVVCGGFAMPIR
PTK_ACIJO       ETVIRHTEVPGLSVISRG---------KSPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVTD--
CPSD2_STRPN     SHGLCDTNIENLFVVQSG---------TVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAP--------
YLXH_BACSU      LQSL-SVGPKGLRYISGG---TGLDVMFQLDQRKWTFFANELSHALSQ----FDYVLFDMGAGLSKDQLP
Y547_METJA      KDAIYEGP-------------EGVLVIPAGVSLEKFRRAKKLEEVLKAIHDLVEILIIDCPAGIGKETLI
Y1145_PYRFU     ----EKFEDGHFEMIPPTVDFMGQVTPIKVMSMRGSLVTKAIKQLLGDVMGELDFMIIDFPPGTEILTVV
NIFH_DEHE1      LDLVRKTGFGNTLCVESGGPEPGVGC-AGRGIITAVNLMEQLGGYESDS--PLDYVFYD-----------
NIFH_CLOAB      LDTIMKTGFGNIKCVES-----------------------------------------------------
YWQD_BACSU      EQAVQASNEKHLDVLTSG---------PIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQ
NIFH2_CLOPA     LDSILKTGYAGIRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDDLDFVFYDVLGDVVCGGFAMPIR
NIFH_METJA      ----------------------------------------------------------------------
Y851_PYRAB      EMIPPMADFMGQVTPIKVMSMGMMVPEDQPIIWRGALVTKAIKQLLGDVKGSLDFMIIDFPPGTEILTVV
NIFH2_METTL     ----------------------------------------------------------------------
NIFH_METVO      ----------------------------------------------------------------------
Y410_METJA      EDII--YHYDDLAIIHTDV------------SSKVFGYKSDLNRFVKELEEEYDVIIYDFPPNIT-----
NIFH1_CLOPA     LDSILKEGYGGIRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDD----LDYVFYDVLGDVGFAMPI
YVEL_BACSU      SETVQKTPIDNLYVLTSG---------PTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVAQIL
NIFH4_CLOPA     LDSILKEGFGGIRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDD----LDYVFYD-----------
NIFH_CHLCH      ----------------------------------------------------------------------
NIFH_PELPB      ----------------------------------------------------------------------
NIFH_PELLD      ----------------------------------------------------------------------
NIFH_CHLTE      ----------------------------------------------------------------------
NIFH_CHLP8      ----------------------------------------------------------------------
NIFH_CHLL2      ----------------------------------------------------------------------
NIFH_ALCFA      EDLVLKTGYGDIKCVESGVGCAGRGVITAINFL------EEKAAYEDDLDFVFYDVLGDVVCGGFAMPIR
NIFH5_CLOPA     LDSILKEGYGGIRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDD----LDYVFYDVLGDVGFAMPI
NIFH2_AZOVI     ----------------------------------------------------------------------
NIFH_DECAR      ----------------------------------------------------------------------
NIFH_CLOCB      ----------------------------------------------------------------------
CHLL_MICAN      IDTLQEKDFHYEDIWPEDVIYDG-----------------------------------------------
NIFH_TERTT      ----------------------------------------------------------------------
NIFH_MAGSM      ----------------------------------------------------------------------
NIFH_KLEPN      ----------------------------------------------------------------------
NIFH_KLEP3      ----------------------------------------------------------------------
NIFH_DESAD      ----------------------------------------------------------------------
NIFH2_AZOCH     ----------------------------------------------------------------------
NIFH1_AZOVI     ----------------------------------------------------------------------
NIFH1_AZOCH     ----------------------------------------------------------------------
NIFH_UNCMA      LESILKTGFGETRCVESGGPEPGVGC-AGRGIITSINMLEQLGAYTDD----LDYVFYD-----------
NIFH_PSEU5      ----------------------------------------------------------------------
NIFH_ERWCT      ----------------------------------------------------------------------
NIFH_DESRM      LEDVLKTGYGDTKCVESGGPEPGVGC-AGRGIITSINLLESLGAYTND----LDYVFYD-----------
ETK_ECOLI       NKVIQHFGKGGFDVITRG------QVPPNPSELLMRDRMRQLLEWANDH---YDLVIVDTPPMLAVSD--
ETK_ECO57       NKVIQHFGKGGFDVITRG------QVPPNPSELLMRDRMRQLLEWANDH---YDLVIVDTPPMLAVSD--
ETK_ECO27       NKVIQHFGKGGFDVITRG------QVPPNPSELLMRDRMRQLLEWANDH---YDLVIVDTPPMLAVSD--
NIFH_TOLAT      ----------------------------------------------------------------------
CPSD1_STRPN     SHGLCDTNIENLFVVQS-----------------------------------------------------
CHLL_SYNY3      IDTLQEKDFHYEDIWPEDVIYKG-----------------------------------------------
CHLL_CYAP8      IDTLQEKDFHYEDIWPEDVIYKG-----------------------------------------------
NIFH_PROVI      ----------------------------------------------------------------------
NIFH_CHLPD      ----------------------------------------------------------------------
NIFH_ALKMQ      ----------------------------------------------------------------------
NIFH2_METBA     LDVVMQRGFGDIKCVESGGPEPGVGC-AGRGIITSIGLLENLGAYTDD----LDYVFYDVLGDVGFAMPI
MIND_BUCAP      QALIKDKKTKNLFILPAS--------QTRDESLTYSGVEKVLNQLIN---MEFDFIICDSPAGIETGAIL
CHLL_SYNP2      IDTLQEKDFHYEDIWPEDVIYKG-----------------------------------------------
BCHL_PROA2      ----------------------------------------------------------------------
BCHL_CHLPB      IEALEEVDFHHEELTEEDIILTG-----------------------------------------------
Y169_METJA      RDAIYKHK-TGVYVLPTSLSLEGYKKSDID----------LLPDVVNEVADDFDYVIIDAPAGLNREMAT
NUBPL_DICDI     ----------------------------------------------------------------------
CHLL_SYNJA      ----------------------------------------------------------------------
CHLL_CYAPA      IDTLQEKDFHYEDIWPEDVIYKG-----------------------------------------------
CAPB_STAAU      SDSIKETRVENLNVLTAG---------PTPPNPSELIASSKFATIFNELLNHYDFIVIDTPP--------
BCHL_CHLSY      ----------------------------------------------------------------------
BCHL_CHLAD      ----------------------------------------------------------------------
BCHL_CHLAA      ----------------------------------------------------------------------
YC06_KLEPN      DKIINNLQTEGFDYISRG---------SVPPNPAELLMHNRLAELLEWANKSYDIVILDTPPILAV----
NIFH_CYAP7      ----------------------------------------------------------------------
CHLL_TRIEI      IDTLQEKDYHYEDIWPEDVIYKG-----------------------------------------------
CHLL_SCEOB      ----------------------------------------------------------------------
CHLL_PLEBO      IDTLQEKDYHYEDVWAEDVIYKG-----------------------------------------------
MIND_SHIFL      YDVIQGDATLNQALI-KDKRTENLYILPASQTRDKDALTREVAKVLDDLKADFEFIVCDSPAGIETGALM
MIND_ECOLI      YDVIQGDATLNQALI-KDKRTENLYILPASQTRDKDALTREVAKVLDDLKADFEFIVCDSPAGIETGALM
MIND_ECOL6      YDVIQGDATLNQALI-KDKRTENLYILPASQTRDKDALTREVAKVLDDLKADFEFIVCDSPAGIETGALM
MIND_ECO57      YDVIQGDATLNQALI-KDKRTENLYILPASQTRDKDALTREVAKVLDDLKADFEFIVCDSPAGIETGALM
CHLL_THEEB      ----------------------------------------------------------------------
CHLL_SYNP6      ----------------------------------------------------------------------
CHLL_SYNJB      ----------------------------------------------------------------------
CHLL_SYNE7      ----------------------------------------------------------------------
CHLL_NOSP7      ----------------------------------------------------------------------
CHLL_CYAP4      ----------------------------------------------------------------------
CHLL_ANAVT      ----------------------------------------------------------------------
CHLL_ANASP      ----------------------------------------------------------------------
CHLL_ACAM1      ----------------------------------------------------------------------
BCHL_PROVI      ----------------------------------------------------------------------
BCHL_PELPB      ----------------------------------------------------------------------
BCHL_PELLD      ----------------------------------------------------------------------
BCHL_CHLTE      ----------------------------------------------------------------------
BCHL_CHLPD      ----------------------------------------------------------------------
BCHL_CHLP8      ----------------------------------------------------------------------
BCHL_CHLL2      ----------------------------------------------------------------------
BCHL_CHLCH      ----------------------------------------------------------------------
NIFH3_AZOVI     NDDVIKKGFLDIQCVESGVGCAGRGVITAIDLM-------------------------------------
CHLL_STIHE      ----------------------------------------------------------------------
CHLL_PHYPA      ----------------------------------------------------------------------
CHLL_MESVI      ----------------------------------------------------------------------
CHLL_MARPO      ----------------------------------------------------------------------
CHLL_LEPTE      ----------------------------------------------------------------------
CHLL_CHLVU      ----------------------------------------------------------------------
CHLL_CHLPR      ----------------------------------------------------------------------
CHLL_CHLAT      ----------------------------------------------------------------------
CHLL_CHAVU      ----------------------------------------------------------------------
CHLL_ANGEV      ----------------------------------------------------------------------
AMSA_ERWAM      TDLVQRGDYGFDFIARGQVPPNPSEL----------LMNSRMKELVHWASQNYDLVLIDTPPILAVASII
NIFH_FRASP      ----------------------------------------------------------------------
NIFH_FRASC      ----------------------------------------------------------------------
NIFH_CYAP8      ----------------------------------------------------------------------
NIFH2_ANAVT     ----------------------------------------------------------------------
BCHX_RHOS4      ----------------------------------------------------------------------
NIFH_SYNJB      ----------------------------------------------------------------------
NIFH_SYNJA      ----------------------------------------------------------------------
NIFH_HERSE      ----------------------------------------------------------------------
NIFH_BRASP      ----------------------------------------------------------------------
NIFH_BRAJA      ----------------------------------------------------------------------
MIND_THEMA      YTMIDVVNGKPQEALVKHKMLKNLYLLPASQATKEMISPNDMKAIVKELIPHFDYIIIDSPAGIERGFRN
CHLL_PORYE      ----------------------------------------------------------------------
CHLL_PORPU      ----------------------------------------------------------------------
CHLL_OLTVI      IDTLQSKDYHYEDIWPEDVIYAG-----------------------------------------------
NIFH_AZOBR      ----------------------------------------------------------------------
NIFH2_MASLA     ----------------------------------------------------------------------
COOC_RHORU      ----------------------------------------------------------------------
CHLL_ZYGCR      ----------------------------------------------------------------------
CHLL_STAPU      ----------------------------------------------------------------------
CHLL_PINTH      ----------------------------------------------------------------------
CHLL_PINKO      ----------------------------------------------------------------------
CHLL_PINCO      ----------------------------------------------------------------------
CHLL_PICAB      ----------------------------------------------------------------------
CHLL_LARDC      ----------------------------------------------------------------------
CHLL_HUPLU      ----------------------------------------------------------------------
CHLL_GLOVI      IDTLEEKDYHYEDVYAEDVIYEG-----------------------------------------------
CHLL_CHAGL      ----------------------------------------------------------------------
CHLL_ADICA      ----------------------------------------------------------------------
Y685_METJA      PAGMTKLDYKIFEILVETKYYDLLVMGRPEGSGCYCSVNNWLRQIIDNLAKDYEFVVIDTEAGLEHLSRR
VIRC1_RHIRD     ----------------------------------------------------------------------
NIFH2_METTH     SEVIH-TGFGGVRCVESGGPEPGVGC-----AGRGVIVAMNLLERLGVFREDIDVVIYD---------VL
MIND_BACSU      YDLVDVVECKMHQALVKDKRFDDLLMPAAQTSDKTAVAPEQIKNMVQELKQEFDYVIIDCPAGIEQGYKN
CHLL_NEPOL      ----------------------------------------------------------------------
NIFH_RHILT      ----------------------------------------------------------------------
NIFH_METNO      ----------------------------------------------------------------------
NIFH1_METBA     AENVINTGFDGIKCVESGGPEPGVGC-AGRGVITAINLMEEMGAYSEDLDFIHFDVLGDVVCGGFAMPIR
CHLL_CHLRE      ----------------------------------------------------------------------
NIFH_RHOSH      ----------------------------------------------------------------------
NIFH_RHOS4      ----------------------------------------------------------------------
NIFH_RHOS1      ----------------------------------------------------------------------
NIFH_RHIME      ----------------------------------------------------------------------
NIFH_METS4      ----------------------------------------------------------------------
NIFH_GLUDA      ----------------------------------------------------------------------
NIFH_ACIF5      ----------------------------------------------------------------------
NIFH_ACIF2      ----------------------------------------------------------------------
NIFH1_RHOCA     ----------------------------------------------------------------------
NIFH_ZYMMO      ----------------------------------------------------------------------
NIFH_RHOPS      ----------------------------------------------------------------------
NIFH_RHOP2      ----------------------------------------------------------------------
NIFH_RHILO      ----------------------------------------------------------------------
NIFH_RHIET      ----------------------------------------------------------------------
NIFH_PLEBO      ----------------------------------------------------------------------
NIFH_NOSSN      ----------------------------------------------------------------------
NIFH_NOSCO      ----------------------------------------------------------------------
NIFH_FRASN      ----------------------------------------------------------------------
NIFH_FRASE      ----------------------------------------------------------------------
NIFH2_AZOC5     ----------------------------------------------------------------------
NIFH2_ANASP     ----------------------------------------------------------------------
NIFH1_AZOC5     ----------------------------------------------------------------------
CHLL_CYCTA      ----------------------------------------------------------------------
BCHX_RHOCA      ----------------------------------------------------------------------
NIFH_METHJ      LDLIRERGEENLDVVFTGVEAGGPEVGCAGRGIIATFQLLERLSAFDEDIIVYD-VLGDVVCG-GFAMPM
NIFH_FRAAL      ----------------------------------------------------------------------
MRP_RICBR       GGRIIPVRAKNIEVISIGFFVKNYSAIIWRGPMASKTIYQLLSVTKWDN---LDYLIIDMPPGTGDIHLS
NUP1B_XENLA     ----------------------------------------------------------------------
NUP1A_XENLA     ----------------------------------------------------------------------
NUBP1_XENTR     ----------------------------------------------------------------------
NIFH_ROSS1      ----------------------------------------------------------------------
NIFH_ROSCS      ----------------------------------------------------------------------
NIFH_RHORU      ----------------------------------------------------------------------
NIFH_RHISN      ----------------------------------------------------------------------
NIFH_NOSS6      ----------------------------------------------------------------------
NIFH_CYAP4      ----------------------------------------------------------------------
NIFH_ANASL      ----------------------------------------------------------------------
NIFH_ANAAZ      ----------------------------------------------------------------------
NIFH1_MASLA     ----------------------------------------------------------------------
NIFH1_ANAVT     ----------------------------------------------------------------------
NIFH1_ANASP     ----------------------------------------------------------------------
MIND_EMIHU      NGECRLTQALIQDKRQPNLTFFPL----SSNQLKLPVTKEQINDLVDQLKNNYDFILIDSPAGIDEGFQV
MIND_BUCAI      YDVIQGDATLNQAIITNNLFILPASQTRDKDALTRIGVEKVLTELI---KMNFDFIICDSPAGIETGAIL
BCHL_CHLT3      ----------------------------------------------------------------------
VIRC1_AGRRH     ENALRSNTWDSFCEVYAAEEMSLLEAAYEDAELQGF-----------------DYALADTHGGSSELNNT
NUBP2_MOUSE     VDQEQSISLMSVGFLLENPD----EAVVWRGPKKHALIKQ----FVSDAWGQLDYLVVDTPPGTS-----
NIFH_THIFE      ----------------------------------------------------------------------
CHLL_POLAC      ----------------------------------------------------------------------
CHLL_ANTFO      ----------------------------------------------------------------------
NUBP2_RAT       ----------------------------------------------------------------------
NIFH_WOLSU      ----------------------------------------------------------------------
NIFH_ENTAG      ----------------------------------------------------------------------
NUBP1_NEMVE     ----------------------------------------------------------------------
NIFH_TRITH      ----------------------------------------------------------------------
NIFH_TRIEI      ----------------------------------------------------------------------
ARSA1_AQUAE     ----------------------------------------------------------------------
NUBP2_HUMAN     ----------------------------------------------------------------------
NIFH2_METIV     ----------------------------------------------------------------------
LPXK_SHEB9      TQVPMVVGAKRVDAANALIAEFGVDVIICDDGLQHYALGRDIELVVIDGQ--------------------


                         +         .         .         .         .         *         .:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNE
PARA_CAUCR      AMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPRLEIQGVVLTMYDRRNSLSEQVAKDVRAHFGD
PARA_CAUCN      AMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPRLEIQGVVLTMYDRRNSLSEQVAKDVRAHFGD
SOJ_BACHD       ALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEGVLLTMLDARTNLGIQVIDEVKKYFRE
SOJ_TREPA       GLAAANEVFIPLQCEYFALEGLTLLLQTVKRVQSGLNTALSIGGIFFTMYDTRTKLAQEVVKQVTTYFGD
SOJ_BACSU       ALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGVLLTMLDARTNLGIQVIEEVKKYFRD
YGIDB_PSEPU     ALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEGLLRTMYDPRLSLNNDVSAQLKEHFGP
Y002_PSEPK      ALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEGLLRTMYDPRLSLNNDVSAQLKEHFGP
Y3524_METJA     SLVASDYIIIPCEPSYFSIAGVQLMLDTVEEIKSNLNPKLKVLGFIFNKYSKQSKIPQKRLEQLKQLYPN
PARA_CHLPN      ALIAADYALICATPEFYSVKGLERLAGFIQGI--SARHPLTILGVALSFWNCRGKNNSAFAELIHKTFPG
PARA_CHLMU      ALIAAQHALICATPEFYSVKGLERLATFIQGI--SSRHPLNILGVTLSFWNYRGKNNAAFTELIQKTFPG
PARA_CHLTR      ALIAAQHALICATPEFYSVKGLERLATFIQGI--SSRHPLNILGVTLSFWNYRGKNNAAFTELIQKTFPG
GP5D_CHLPS      AFLASDYLVVCLTPEPFSILGLQKIKEFCSTIGNNLD----ILGIVFSFWDERNSTNSTYMDIIETIYEG
GP5D_CHLMU      AFIAGDKLIVCLIPEPFSILGLQKIREFL--ISIGKPEEEHILGVALSFWDDRSSTNQTYIDIIESIYEN
REPA_AGRRH      ALTAATSILVTVHPQMLDVMSMNQFLSNLLREIENAGAKFKFNWMLITRFEPSDGPQNQMVGYLRSIFGE
Y4CK_RHISN      ALTAATSVLITIHPQMLDVMSMGQILKPIRDVGAAVN--LEWYRYLITRYEPTDGPQAQMVGFMQTLFHQ
GP5D_CHLTR      AFVAGDKLIACLTPEPFSILGLQKIREFLS--SVGKPEEEHILGIALSFWDDRNSTNQMYIDIIESIYKN
PARA_MYCPN      AMSLSDVIVIPFEPDQYSMLGLMRIVETIDTFK-EKNPNLKTI-LVPTKVNMRTRLHNDV----------
INCC2_ECOLX     XXXXXDYVLSPIELEAYSIQGIKKMVTTIANVR-QKNAKLQFLGMVPSKVDARNPRHARHQAELLAAYPK
PARA_MYCGE      AMSLSDVIVIPFEPDQYSMLGLMRIVETIDTFK-EKNTNLK-----TILVPTKVNVRTRLHNEVIDLAKT
MIND_HELPY      AILHADMALVVVTPEVSSLRDSDRVVGIIDAKSNRAKKGMEVHKHLII-----NRLKPELVANGEMISIE
SOPA_ECOLI      VVCAADVLIVPTPAELFDYTSALQFFDMLRDLLKNVDPDVR---ILLTKYSNSNSQSPWMEEQIRDAWGS
SOPA_ECO57      VVCAADVLIVPTPAELFDYTSALQFFDMLRDLLKNVDPDVR---ILLTKYSNSNSQSPWMEEQIRDAWGS
MIND_HELPJ      AILHADMALVVVTPEVSSLRDSDRVIGIIDAKSNRAKSGEEVHKHLII-----NRLKPELVANGEMISIE
WZC_SALTI       AIVGRH-VGTTLMVARYAVNTLKEVETSLSRFDQN---GIQVKGVILNSIFRR-----------------
NIFH1_METTL     DGLAQEIYIV-TSGEMMALYAANNIAKGI--LKYAEQSGVRLGGIIC------NARNVDGEKELMDEFCD
WZC_SALTY       AIVGRHA-GTTLMVARYAVNTLKEVETSLSRFDQN---GIQVKGVILNSIFRR-----------------
PARA_ECOLX      ALASANILFTPL----------------------------------------------------------
EPSB2_RALSO     AILAARAGLVLLVTR-FERSTLGEIRETIKQLQ---HANVDVRGVVFNALD-------------------
EPSB1_RALSO     AILAARAGTVLMVTR-FERSTLGEIRETIKQLQ---HANVEVRGVVFNALD-------------------
WZC_ECOLI       AIVGRH-VGTTLMVARYAVNTLKEVETSLSRFEQNGIP---VKGVILNSIFRR-----------------
WZC_ECO57       AIVGRH-VGTTLMVARYAVNTLKEVETSLSRFEQNGIP---VKGVILNSIFRR-----------------
Y949_PYRHO      QSIKLDAAIIVTTPQEVALLDTGKAVNMMKKMEVPYVAVVENMSYLICP-HCGNKIEKLAQKEGVDFLGK
INCC1_ECOLX     AVLTADYMLSPIEMEAYSLQGMKKMVAVISNLR-KQNPKLRFLGMVPNKVDARKPRHVNNLATLQQAYPQ
Y2821_BORBU     IILAMCEVITPLTPEFLSLEGINIFKEEFESLLKSYRKKVKHEKIICNMLNKSFK---------------
NIFH6_CLOPA     E-GKAQEIYIVASGEMMALYAANNISKGIQ--KYAKSGGVRLGGIIC------NSRKVANEYELLDAFAK
PTK_ACIJO       GIIISQYTGVNLVIARYAKTQMKELELTLNRFE---QAGVKVNGFIL-----------------------
CPSD2_STRPN     ----------------------------------------------------------------------
YLXH_BACSU      FILSAEDILI------------------------------------------------------------
Y547_METJA      AISSADGLIVVVNPEISSISDALKIIAITKRLGTD---------IIGAIVNRVSNESTELGVKAIETILE
Y1145_PYRFU     QSIQLDAAIVVTTPQEVALLDTGKAVNMMKKMEVPYIAVIENMSYLICPHGNKIDIFXXXXXXXXXXXXX
NIFH_DEHE1      ----------------------------------------------------------------------
NIFH_CLOAB      ----------------------------------------------------------------------
YWQD_BACSU      ILVADGSVLV------------------------------------------------------------
NIFH2_CLOPA     E-GKAQEIYIVASGEMMALYAANNISKGIQ--KYAKSGGVRLGGIIC------NSRKVANEYELLDAFAK
NIFH_METJA      ----------------------------------------------------------------------
Y851_PYRAB      QSIQLDAAIIVTTPQEVALLDTGKAVNMMKKMEVPYIAVVENMSYLICPHGNKIDIFXXXXXXXXXXXXX
NIFH2_METTL     ----------------------------------------------------------------------
NIFH_METVO      ----------------------------------------------------------------------
Y410_METJA      ----------------------------------------------------------------------
NIFH1_CLOPA     REGKAQEIYIVASGEMMALYAANNISKGIQ--KYAKSGGVRLGGIIC------NSRKVANEYELLDAFAK
YVEL_BACSU      ANQTDGSVLVVL----------------------------------------------------------
NIFH4_CLOPA     ----------------------------------------------------------------------
NIFH_CHLCH      ----------------------------------------------------------------------
NIFH_PELPB      ----------------------------------------------------------------------
NIFH_PELLD      ----------------------------------------------------------------------
NIFH_CHLTE      ----------------------------------------------------------------------
NIFH_CHLP8      ----------------------------------------------------------------------
NIFH_CHLL2      ----------------------------------------------------------------------
NIFH_ALCFA      E-NKAQEIYVVCSGEMMAMYAANNISKGI--VKYANSGSVRLGGLIC------NSRNTDREDELIMALAD
NIFH5_CLOPA     REGKAQEIYIVASGEMMALYAANNISKGIQ--KYAKSGGVRLGGIIC------NSRKVANEYELLDAFAK
NIFH2_AZOVI     ----------------------------------------------------------------------
NIFH_DECAR      ----------------------------------------------------------------------
NIFH_CLOCB      ----------------------------------------------------------------------
CHLL_MICAN      ----------------------------------------------------------------------
NIFH_TERTT      ----------------------------------------------------------------------
NIFH_MAGSM      ----------------------------------------------------------------------
NIFH_KLEPN      ----------------------------------------------------------------------
NIFH_KLEP3      ----------------------------------------------------------------------
NIFH_DESAD      ----------------------------------------------------------------------
NIFH2_AZOCH     ----------------------------------------------------------------------
NIFH1_AZOVI     ----------------------------------------------------------------------
NIFH1_AZOCH     ----------------------------------------------------------------------
NIFH_UNCMA      ----------------------------------------------------------------------
NIFH_PSEU5      ----------------------------------------------------------------------
NIFH_ERWCT      ----------------------------------------------------------------------
NIFH_DESRM      ----------------------------------------------------------------------
ETK_ECOLI       AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLE---QAGVNIKGAILNGVIKR-----------------
ETK_ECO57       AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLE---QAGVNIKGAILNGVIKR-----------------
ETK_ECO27       AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLE---QAGVNIKGAILNGVIKR-----------------
NIFH_TOLAT      ----------------------------------------------------------------------
CPSD1_STRPN     ----------------------------------------------------------------------
CHLL_SYNY3      ----------------------------------------------------------------------
CHLL_CYAP8      ----------------------------------------------------------------------
NIFH_PROVI      ----------------------------------------------------------------------
NIFH_CHLPD      ----------------------------------------------------------------------
NIFH_ALKMQ      ----------------------------------------------------------------------
NIFH2_METBA     REGKAKEIYIVASGELMAIYAANNICKGLAKF---AKGGARLGGIIC------NSRNVDGERELLDAFAK
MIND_BUCAP      AIYFADEAIVTTNPEVSSVRDSDRILGIIKRSEKNITPIKEY--LLLTRYN-----PTRVKKGEMLSMKD
CHLL_SYNP2      ----------------------------------------------------------------------
BCHL_PROA2      ----------------------------------------------------------------------
BCHL_CHLPB      ----------------------------------------------------------------------
Y169_METJA      HLAIADKLLLVVTPEMFSIIDAVRLKESAEMAGTPL------MGVVL------NRVGRDFGEMGRDEIEM
NUBPL_DICDI     ----------------------------------------------------------------------
CHLL_SYNJA      ----------------------------------------------------------------------
CHLL_CYAPA      ----------------------------------------------------------------------
CAPB_STAAU      ----------------------------------------------------------------------
BCHL_CHLSY      ----------------------------------------------------------------------
BCHL_CHLAD      ----------------------------------------------------------------------
BCHL_CHLAA      ----------------------------------------------------------------------
YC06_KLEPN      ----------------------------------------------------------------------
NIFH_CYAP7      ----------------------------------------------------------------------
CHLL_TRIEI      ----------------------------------------------------------------------
CHLL_SCEOB      ----------------------------------------------------------------------
CHLL_PLEBO      ----------------------------------------------------------------------
MIND_SHIFL      ALYFADEAIITTNPEVSSVRDSDRILGILEPIKEHLNPGRVSRGDMLSMEDVLEILRIKL----------
MIND_ECOLI      ALYFADEAIITTNPEVSSVRDSDRILGILEPIKEHLNPGRVSRGDMLSMEDVLEILRIKL----------
MIND_ECOL6      ALYFADEAIITTNPEVSSVRDSDRILGILEPIKEHLNPGRVSRGDMLSMEDVLEILRIKL----------
MIND_ECO57      ALYFADEAIITTNPEVSSVRDSDRILGILEPIKEHLNPGRVSRGDMLSMEDVLEILRIKL----------
CHLL_THEEB      ----------------------------------------------------------------------
CHLL_SYNP6      ----------------------------------------------------------------------
CHLL_SYNJB      ----------------------------------------------------------------------
CHLL_SYNE7      ----------------------------------------------------------------------
CHLL_NOSP7      ----------------------------------------------------------------------
CHLL_CYAP4      ----------------------------------------------------------------------
CHLL_ANAVT      ----------------------------------------------------------------------
CHLL_ANASP      ----------------------------------------------------------------------
CHLL_ACAM1      ----------------------------------------------------------------------
BCHL_PROVI      ----------------------------------------------------------------------
BCHL_PELPB      ----------------------------------------------------------------------
BCHL_PELLD      ----------------------------------------------------------------------
BCHL_CHLTE      ----------------------------------------------------------------------
BCHL_CHLPD      ----------------------------------------------------------------------
BCHL_CHLP8      ----------------------------------------------------------------------
BCHL_CHLL2      ----------------------------------------------------------------------
BCHL_CHLCH      ----------------------------------------------------------------------
NIFH3_AZOVI     ----------------------------------------------------------------------
CHLL_STIHE      ----------------------------------------------------------------------
CHLL_PHYPA      ----------------------------------------------------------------------
CHLL_MESVI      ----------------------------------------------------------------------
CHLL_MARPO      ----------------------------------------------------------------------
CHLL_LEPTE      ----------------------------------------------------------------------
CHLL_CHLVU      ----------------------------------------------------------------------
CHLL_CHLPR      ----------------------------------------------------------------------
CHLL_CHLAT      ----------------------------------------------------------------------
CHLL_CHAVU      ----------------------------------------------------------------------
CHLL_ANGEV      ----------------------------------------------------------------------
AMSA_ERWAM      GKLAGTSLMV------------------------------------------------------------
NIFH_FRASP      ----------------------------------------------------------------------
NIFH_FRASC      ----------------------------------------------------------------------
NIFH_CYAP8      ----------------------------------------------------------------------
NIFH2_ANAVT     ----------------------------------------------------------------------
BCHX_RHOS4      ----------------------------------------------------------------------
NIFH_SYNJB      ----------------------------------------------------------------------
NIFH_SYNJA      ----------------------------------------------------------------------
NIFH_HERSE      ----------------------------------------------------------------------
NIFH_BRASP      ----------------------------------------------------------------------
NIFH_BRAJA      ----------------------------------------------------------------------
MIND_THEMA      AVAPAERVLVVTTPELPAISDADRVIGLLENFKINVKPHMVKKGEMLTTDDIKHTLSLEI----------
CHLL_PORYE      ----------------------------------------------------------------------
CHLL_PORPU      ----------------------------------------------------------------------
CHLL_OLTVI      ----------------------------------------------------------------------
NIFH_AZOBR      ----------------------------------------------------------------------
NIFH2_MASLA     ----------------------------------------------------------------------
COOC_RHORU      ----------------------------------------------------------------------
CHLL_ZYGCR      ----------------------------------------------------------------------
CHLL_STAPU      ----------------------------------------------------------------------
CHLL_PINTH      ----------------------------------------------------------------------
CHLL_PINKO      ----------------------------------------------------------------------
CHLL_PINCO      ----------------------------------------------------------------------
CHLL_PICAB      ----------------------------------------------------------------------
CHLL_LARDC      ----------------------------------------------------------------------
CHLL_HUPLU      ----------------------------------------------------------------------
CHLL_GLOVI      ----------------------------------------------------------------------
CHLL_CHAGL      ----------------------------------------------------------------------
CHLL_ADICA      ----------------------------------------------------------------------
Y685_METJA      TTQNVDVMIV-------ITDASKRGLGTAKRIKKLANEEVKFKDIYVV----ANKVKPEYE-ELIDNYAK
VIRC1_RHIRD     ----------------------------------------------------------------------
NIFH2_METTH     GDVVCGGFAVPLREDF------------------------------------------------------
MIND_BACSU      AVSGADKAIVVTTPEISAVRDADRIIGLLEQEENIEPPRLVVNRI-------RNHLMKNGDTMDIDEIVQ
CHLL_NEPOL      ----------------------------------------------------------------------
NIFH_RHILT      ----------------------------------------------------------------------
NIFH_METNO      ----------------------------------------------------------------------
NIFH1_METBA     E-GKAQEVYIVASGEMMATYAANNICKGL--LKYAEQSGVRLGGIICNSRRVDNELE-MMEEFASALGTQ
CHLL_CHLRE      ----------------------------------------------------------------------
NIFH_RHOSH      ----------------------------------------------------------------------
NIFH_RHOS4      ----------------------------------------------------------------------
NIFH_RHOS1      ----------------------------------------------------------------------
NIFH_RHIME      ----------------------------------------------------------------------
NIFH_METS4      ----------------------------------------------------------------------
NIFH_GLUDA      ----------------------------------------------------------------------
NIFH_ACIF5      ----------------------------------------------------------------------
NIFH_ACIF2      ----------------------------------------------------------------------
NIFH1_RHOCA     ----------------------------------------------------------------------
NIFH_ZYMMO      ----------------------------------------------------------------------
NIFH_RHOPS      ----------------------------------------------------------------------
NIFH_RHOP2      ----------------------------------------------------------------------
NIFH_RHILO      ----------------------------------------------------------------------
NIFH_RHIET      ----------------------------------------------------------------------
NIFH_PLEBO      ----------------------------------------------------------------------
NIFH_NOSSN      ----------------------------------------------------------------------
NIFH_NOSCO      ----------------------------------------------------------------------
NIFH_FRASN      ----------------------------------------------------------------------
NIFH_FRASE      ----------------------------------------------------------------------
NIFH2_AZOC5     ----------------------------------------------------------------------
NIFH2_ANASP     ----------------------------------------------------------------------
NIFH1_AZOC5     ----------------------------------------------------------------------
CHLL_CYCTA      ----------------------------------------------------------------------
BCHX_RHOCA      ----------------------------------------------------------------------
NIFH_METHJ      RKGYAQEIYLVTSGELMSLYAANNICKAISRISQNVRQVCRLGGVIC------NSRNLPDEEKLVGAFAS
NIFH_FRAAL      ----------------------------------------------------------------------
MRP_RICBR       MLENYH----------------------------------------------------------------
NUP1B_XENLA     ----------------------------------------------------------------------
NUP1A_XENLA     ----------------------------------------------------------------------
NUBP1_XENTR     ----------------------------------------------------------------------
NIFH_ROSS1      ----------------------------------------------------------------------
NIFH_ROSCS      ----------------------------------------------------------------------
NIFH_RHORU      ----------------------------------------------------------------------
NIFH_RHISN      ----------------------------------------------------------------------
NIFH_NOSS6      ----------------------------------------------------------------------
NIFH_CYAP4      ----------------------------------------------------------------------
NIFH_ANASL      ----------------------------------------------------------------------
NIFH_ANAAZ      ----------------------------------------------------------------------
NIFH1_MASLA     ----------------------------------------------------------------------
NIFH1_ANAVT     ----------------------------------------------------------------------
NIFH1_ANASP     ----------------------------------------------------------------------
MIND_EMIHU      AIHTAKEAIVVVTPEVTSIRDADKVIGLLE-AKGITDISLIINRLRPEMVKAENMMSV---TDVKDILGI
MIND_BUCAI      AIYFADEAIITTNPEVSSVRDSDRILGIIKRAEKNITPIKEY--LLLTRYNPRRVKKGEMMTDVLDILQI
BCHL_CHLT3      ----------------------------------------------------------------------
VIRC1_AGRRH     IIASSNLLLIP-----------------------------------------------------------
NUBP2_MOUSE     ----------------------------------------------------------------------
NIFH_THIFE      ----------------------------------------------------------------------
CHLL_POLAC      ----------------------------------------------------------------------
CHLL_ANTFO      ----------------------------------------------------------------------
NUBP2_RAT       ----------------------------------------------------------------------
NIFH_WOLSU      ----------------------------------------------------------------------
NIFH_ENTAG      ----------------------------------------------------------------------
NUBP1_NEMVE     ----------------------------------------------------------------------
NIFH_TRITH      ----------------------------------------------------------------------
NIFH_TRIEI      ----------------------------------------------------------------------
ARSA1_AQUAE     ----------------------------------------------------------------------
NUBP2_HUMAN     ----------------------------------------------------------------------
NIFH2_METIV     ----------------------------------------------------------------------
LPXK_SHEB9      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KVYLTVIPRNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQEQTIxxxx
PARA_CAUCR      KVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQAYLKLAREVISRER------
PARA_CAUCN      KVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQAYLKLAREVISRER------
SOJ_BACHD       KVFDTIIPRNVRLGEAPSHGEPIIRYDAKSRGAEVYLDLAKEVV----------
SOJ_TREPA       KVFNTIIPRNVKLSEAPSHGLPISSYDAQCAGARSYEKLAREIVARD-------
SOJ_BACSU       KVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAEVYLDLAKE------------
YGIDB_PSEPU     QLYDTVIPRNIRLAEAPSFGMPALAYDK--------------------------
Y002_PSEPK      QLYDTVIPRNIRLAEAPSFGMPALAYDK--------------------------
Y3524_METJA     IPVIGVIPRTITVEKAEREGKPVFKFDANNPASVAF------------------
PARA_CHLPN      KLLNTKIRRDITVSEAAIHGKPVFATSPSARASEDYFNLTKELL----------
PARA_CHLMU      KLLNTRIRRDITISEAAIHGKPVFSTAPSARASEDY------------------
PARA_CHLTR      KLLNTRIRRDITISEAAIHGKPVFSTAPSARASEDY------------------
GP5D_CHLPS      KILSSKIRRDVTVSRSLLKESSVINAYPNSRAAKDILNLTKEIENK--------
GP5D_CHLMU      KIFSTKIRRDISLSRS--------------------------------------
REPA_AGRRH      NVLNFPMLKTTAVSDA--------------------------------------
Y4CK_RHISN      FVLKNQMLKSTAVSDAGITKQTLYEVDKS-------------------------
GP5D_CHLTR      KLFSTKIRRDISLSRS--------------------------------------
PARA_MYCPN      ------------------------------------------------------
INCC2_ECOLX     MMIPATVGLRSSIADALASGVPVWKIKKT-------------------------
PARA_MYCGE      KAKKNNVAFSKNFVSLTSKSSAAVGYEKSSPSKKEYLEITKEILN---------
MIND_HELPY      EVLIGIIPEDHHIISATNKGEPVIRTD--CESAKAYQRITRRILGEE-------
SOPA_ECOLI      MVLKNVV-----------------------------------------------
SOPA_ECO57      MVLKNVV-----------------------------------------------
MIND_HELPJ      EVLIGIIPEDHHIISATNKGEPVIRTD--CESAKAYQRITRRILGEE-------
WZC_SALTI       ------------------------------------------------------
NIFH1_METTL     KLLIHYVPRDNIVQKAEFNKMTVIEFDPECNQAKEY------------------
WZC_SALTY       ------------------------------------------------------
PARA_ECOLX      ------------------------------------------------------
EPSB2_RALSO     ------------------------------------------------------
EPSB1_RALSO     ------------------------------------------------------
WZC_ECOLI       ------------------------------------------------------
WZC_ECO57       ------------------------------------------------------
Y949_PYRHO      ------IPIDLKAREASDLGIPIVLYEDT-PAAKAFMELAEKLVNKLKEI----
INCC1_ECOLX     LILPFSIGARDSIAEALGEQMPVWKIKKT-------------------------
Y2821_BORBU     ------------------------------------------------------
NIFH6_CLOPA     ELLIHFVPRSPSVTKAEINKKTVIEYDPTCEQANEY------------------
PTK_ACIJO       ------------------------------------------------------
CPSD2_STRPN     ------------------------------------------------------
YLXH_BACSU      ------------------------------------------------------
Y547_METJA      VPVIGVVPEDPHVRKAAAFGTPLVIMYPDSPAAQAIMEIAAKLI----------
Y1145_PYRFU     VDFLGKVPIDLKAREASDLGIPIVLYGDT-PAAKAFMEIAEKLVNKLKEI----
NIFH_DEHE1      ------------------------------------------------------
NIFH_CLOAB      ------------------------------------------------------
YWQD_BACSU      ------------------------------------------------------
NIFH2_CLOPA     ELLIHFVPRSPSVTKAEINKKTVIEYDPTCEQANEY------------------
NIFH_METJA      ------------------------------------------------------
Y851_PYRAB      VDFLGKIPIDLKAREASDLGIPIVLYGDT-PAAKAFMEIAEKLVNK--------
NIFH2_METTL     ------------------------------------------------------
NIFH_METVO      ------------------------------------------------------
Y410_METJA      ------------------------------------------------------
NIFH1_CLOPA     ELLIHFVPRSPMVTKAEINKQTVIEYDPTCEQAEEY------------------
YVEL_BACSU      ------------------------------------------------------
NIFH4_CLOPA     ------------------------------------------------------
NIFH_CHLCH      ------------------------------------------------------
NIFH_PELPB      ------------------------------------------------------
NIFH_PELLD      ------------------------------------------------------
NIFH_CHLTE      ------------------------------------------------------
NIFH_CHLP8      ------------------------------------------------------
NIFH_CHLL2      ------------------------------------------------------
NIFH_ALCFA      KLMIHFVPRDNVVQRAEIRRMTVIEYDPAAKQADEYRTLAKKIVENKKLV----
NIFH5_CLOPA     ELLIHFVPRSPMVTKAEINKQTVIEFDPTCEQAEEY------------------
NIFH2_AZOVI     ------------------------------------------------------
NIFH_DECAR      ------------------------------------------------------
NIFH_CLOCB      ------------------------------------------------------
CHLL_MICAN      ------------------------------------------------------
NIFH_TERTT      ------------------------------------------------------
NIFH_MAGSM      ------------------------------------------------------
NIFH_KLEPN      ------------------------------------------------------
NIFH_KLEP3      ------------------------------------------------------
NIFH_DESAD      ------------------------------------------------------
NIFH2_AZOCH     ------------------------------------------------------
NIFH1_AZOVI     ------------------------------------------------------
NIFH1_AZOCH     ------------------------------------------------------
NIFH_UNCMA      ------------------------------------------------------
NIFH_PSEU5      ------------------------------------------------------
NIFH_ERWCT      ------------------------------------------------------
NIFH_DESRM      ------------------------------------------------------
ETK_ECOLI       ------------------------------------------------------
ETK_ECO57       ------------------------------------------------------
ETK_ECO27       ------------------------------------------------------
NIFH_TOLAT      ------------------------------------------------------
CPSD1_STRPN     ------------------------------------------------------
CHLL_SYNY3      ------------------------------------------------------
CHLL_CYAP8      ------------------------------------------------------
NIFH_PROVI      ------------------------------------------------------
NIFH_CHLPD      ------------------------------------------------------
NIFH_ALKMQ      ------------------------------------------------------
NIFH2_METBA     KLLIHFIPRDNIVQRAEINRKTVIDFDPESNQAKEYLTLAHNVQNNDKLV----
MIND_BUCAP      VIIIGVIPEDASVLRASNQGESIILDQNSNAGS-AYFDTVNRLLGE--------
CHLL_SYNP2      ------------------------------------------------------
BCHL_PROA2      ------------------------------------------------------
BCHL_CHLPB      ------------------------------------------------------
Y169_METJA      LIVLVEVPEDENVRSAALKKMSVIEYRKNSPASQAY------------------
NUBPL_DICDI     ------------------------------------------------------
CHLL_SYNJA      ------------------------------------------------------
CHLL_CYAPA      ------------------------------------------------------
CAPB_STAAU      ------------------------------------------------------
BCHL_CHLSY      ------------------------------------------------------
BCHL_CHLAD      ------------------------------------------------------
BCHL_CHLAA      ------------------------------------------------------
YC06_KLEPN      ------------------------------------------------------
NIFH_CYAP7      ------------------------------------------------------
CHLL_TRIEI      ------------------------------------------------------
CHLL_SCEOB      ------------------------------------------------------
CHLL_PLEBO      ------------------------------------------------------
MIND_SHIFL      ---VGVIPEDQSVLRASNQGEPVIL-DINADAGKAYADTVERLLGEER------
MIND_ECOLI      ---VGVIPEDQSVLRASNQGEPVIL-DINADAGKAYADTVERLLGEER------
MIND_ECOL6      ---VGVIPEDQSVLRASNQGEPVIL-DINADAGKAYADTVERLLGEER------
MIND_ECO57      ---VGVIPEDQSVLRASNQGEPVIL-DINADAGKAYADTVERLLGEER------
CHLL_THEEB      ------------------------------------------------------
CHLL_SYNP6      ------------------------------------------------------
CHLL_SYNJB      ------------------------------------------------------
CHLL_SYNE7      ------------------------------------------------------
CHLL_NOSP7      ------------------------------------------------------
CHLL_CYAP4      ------------------------------------------------------
CHLL_ANAVT      ------------------------------------------------------
CHLL_ANASP      ------------------------------------------------------
CHLL_ACAM1      ------------------------------------------------------
BCHL_PROVI      ------------------------------------------------------
BCHL_PELPB      ------------------------------------------------------
BCHL_PELLD      ------------------------------------------------------
BCHL_CHLTE      ------------------------------------------------------
BCHL_CHLPD      ------------------------------------------------------
BCHL_CHLP8      ------------------------------------------------------
BCHL_CHLL2      ------------------------------------------------------
BCHL_CHLCH      ------------------------------------------------------
NIFH3_AZOVI     ------------------------------------------------------
CHLL_STIHE      ------------------------------------------------------
CHLL_PHYPA      ------------------------------------------------------
CHLL_MESVI      ------------------------------------------------------
CHLL_MARPO      ------------------------------------------------------
CHLL_LEPTE      ------------------------------------------------------
CHLL_CHLVU      ------------------------------------------------------
CHLL_CHLPR      ------------------------------------------------------
CHLL_CHLAT      ------------------------------------------------------
CHLL_CHAVU      ------------------------------------------------------
CHLL_ANGEV      ------------------------------------------------------
AMSA_ERWAM      ------------------------------------------------------
NIFH_FRASP      ------------------------------------------------------
NIFH_FRASC      ------------------------------------------------------
NIFH_CYAP8      ------------------------------------------------------
NIFH2_ANAVT     ------------------------------------------------------
BCHX_RHOS4      ------------------------------------------------------
NIFH_SYNJB      ------------------------------------------------------
NIFH_SYNJA      ------------------------------------------------------
NIFH_HERSE      ------------------------------------------------------
NIFH_BRASP      ------------------------------------------------------
NIFH_BRAJA      ------------------------------------------------------
MIND_THEMA      ---IAVIPDSEDIIVASNTGIPVSLNGNS-------------------------
CHLL_PORYE      ------------------------------------------------------
CHLL_PORPU      ------------------------------------------------------
CHLL_OLTVI      ------------------------------------------------------
NIFH_AZOBR      ------------------------------------------------------
NIFH2_MASLA     ------------------------------------------------------
COOC_RHORU      ------------------------------------------------------
CHLL_ZYGCR      ------------------------------------------------------
CHLL_STAPU      ------------------------------------------------------
CHLL_PINTH      ------------------------------------------------------
CHLL_PINKO      ------------------------------------------------------
CHLL_PINCO      ------------------------------------------------------
CHLL_PICAB      ------------------------------------------------------
CHLL_LARDC      ------------------------------------------------------
CHLL_HUPLU      ------------------------------------------------------
CHLL_GLOVI      ------------------------------------------------------
CHLL_CHAGL      ------------------------------------------------------
CHLL_ADICA      ------------------------------------------------------
Y685_METJA      ELGLNLIPYNKEIAEYDLKGIPLWNLPENNEVYKKVEEIAEKIINKK-------
VIRC1_RHIRD     ------------------------------------------------------
NIFH2_METTH     ------------------------------------------------------
MIND_BACSU      HLLLGIVADDDEVIKASNHGEPIAMDPKN-------------------------
CHLL_NEPOL      ------------------------------------------------------
NIFH_RHILT      ------------------------------------------------------
NIFH_METNO      ------------------------------------------------------
NIFH1_METBA     LLYF--VPRDNIVQKAEFNKKTVVEYDPTCNQALEYKELAKKILENDMFV----
CHLL_CHLRE      ------------------------------------------------------
NIFH_RHOSH      ------------------------------------------------------
NIFH_RHOS4      ------------------------------------------------------
NIFH_RHOS1      ------------------------------------------------------
NIFH_RHIME      ------------------------------------------------------
NIFH_METS4      ------------------------------------------------------
NIFH_GLUDA      ------------------------------------------------------
NIFH_ACIF5      ------------------------------------------------------
NIFH_ACIF2      ------------------------------------------------------
NIFH1_RHOCA     ------------------------------------------------------
NIFH_ZYMMO      ------------------------------------------------------
NIFH_RHOPS      ------------------------------------------------------
NIFH_RHOP2      ------------------------------------------------------
NIFH_RHILO      ------------------------------------------------------
NIFH_RHIET      ------------------------------------------------------
NIFH_PLEBO      ------------------------------------------------------
NIFH_NOSSN      ------------------------------------------------------
NIFH_NOSCO      ------------------------------------------------------
NIFH_FRASN      ------------------------------------------------------
NIFH_FRASE      ------------------------------------------------------
NIFH2_AZOC5     ------------------------------------------------------
NIFH2_ANASP     ------------------------------------------------------
NIFH1_AZOC5     ------------------------------------------------------
CHLL_CYCTA      ------------------------------------------------------
BCHX_RHOCA      ------------------------------------------------------
NIFH_METHJ      EVIIAYIPRSGLVQYAELNNQTVIEFAPDSSLSATYQSLAEEIM----------
NIFH_FRAAL      ------------------------------------------------------
MRP_RICBR       ------------------------------------------------------
NUP1B_XENLA     ------------------------------------------------------
NUP1A_XENLA     ------------------------------------------------------
NUBP1_XENTR     ------------------------------------------------------
NIFH_ROSS1      ------------------------------------------------------
NIFH_ROSCS      ------------------------------------------------------
NIFH_RHORU      ------------------------------------------------------
NIFH_RHISN      ------------------------------------------------------
NIFH_NOSS6      ------------------------------------------------------
NIFH_CYAP4      ------------------------------------------------------
NIFH_ANASL      ------------------------------------------------------
NIFH_ANAAZ      ------------------------------------------------------
NIFH1_MASLA     ------------------------------------------------------
NIFH1_ANAVT     ------------------------------------------------------
NIFH1_ANASP     ------------------------------------------------------
MIND_EMIHU      PL-IGVVPDSEQVITASNRGEPLVLDDKSIPG----------------------
MIND_BUCAI      PI-IGVIPEDQSVLRASNQGESIILDINSNAGC-AYSDTVNRLLGEER------
BCHL_CHLT3      ------------------------------------------------------
VIRC1_AGRRH     ------------------------------------------------------
NUBP2_MOUSE     ------------------------------------------------------
NIFH_THIFE      ------------------------------------------------------
CHLL_POLAC      ------------------------------------------------------
CHLL_ANTFO      ------------------------------------------------------
NUBP2_RAT       ------------------------------------------------------
NIFH_WOLSU      ------------------------------------------------------
NIFH_ENTAG      ------------------------------------------------------
NUBP1_NEMVE     ------------------------------------------------------
NIFH_TRITH      ------------------------------------------------------
NIFH_TRIEI      ------------------------------------------------------
ARSA1_AQUAE     ------------------------------------------------------
NUBP2_HUMAN     ------------------------------------------------------
NIFH2_METIV     ------------------------------------------------------
LPXK_SHEB9      ------------------------------------------------------