[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21176.1

[Show Plain Result]


## Summary of Sequence Search
    1::282
    5::290     5e-51  40%  290 aa  PARB_PSEPU RecName: Full=Probable chromosome-partitioning protein
    5::290     5e-51  40%  290 aa  PARB_PSEPK RecName: Full=Probable chromosome-partitioning protein
    3::284     7e-51  40%  286 aa  PARB_NEIMA RecName: Full=Probable chromosome-partitioning protein
   27::282     1e-50  44%  286 aa  PARB_RICTY RecName: Full=Probable chromosome-partitioning protein
    3::284     2e-50  40%  286 aa  PARB_NEIMB RecName: Full=Probable chromosome-partitioning protein
   29::273     1e-49  44%  287 aa  PARB_RICBR RecName: Full=Probable chromosome-partitioning protein
   30::290     2e-49  40%  290 aa  PARB_COXBU RecName: Full=Probable chromosome-partitioning protein
    3::288     1e-47  40%  293 aa  PARB_VIBCH RecName: Full=Probable chromosome-partitioning protein
   30::272     1e-47  44%  286 aa  PARB_RICCN RecName: Full=Probable chromosome-partitioning protein
    3::277     4e-47  40%  282 aa  SP0J_BACSU RecName: Full=Stage 0 sporulation protein J;
   27::282     6e-47  41%  286 aa  PARB_RICPR RecName: Full=Probable chromosome-partitioning protein
   38::272     1e-46  45%  286 aa  PARB_RICFE RecName: Full=Probable chromosome-partitioning protein
   39::286     1e-45  42%  294 aa  PARB_CAUCR RecName: Full=Chromosome-partitioning protein parB;
   39::286     1e-45  42%  294 aa  PARB_CAUCN RecName: Full=Chromosome-partitioning protein parB;
    5::270     9e-45  40%  290 aa  PARB_HELPY RecName: Full=Probable chromosome-partitioning protein
    5::270     1e-44  39%  290 aa  PARB_HELPJ RecName: Full=Probable chromosome-partitioning protein
    4::282     4e-43  38%  288 aa  PARB1_DEIRA RecName: Full=Probable chromosome 1-partitioning
    8::328     3e-42  38%  333 aa  PARB_MYCLE RecName: Full=Probable chromosome-partitioning protein
   46::306     6e-42  37%  310 aa  PARB_XYLFA RecName: Full=Probable chromosome-partitioning protein
    7::257     6e-42  44%  278 aa  PARB_CAMJE RecName: Full=Probable chromosome-partitioning protein
   29::269     6e-42  40%  290 aa  NOC_BACHK RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACCZ RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACC3 RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACC1 RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACC0 RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACAN RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACAH RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACAC RecName: Full=Nucleoid occlusion protein;       
   29::269     6e-42  40%  290 aa  NOC_BACAA RecName: Full=Nucleoid occlusion protein;       
   31::269     7e-42  40%  290 aa  NOC_BACWK RecName: Full=Nucleoid occlusion protein;       
   29::269     1e-41  40%  290 aa  NOC_BACCR RecName: Full=Nucleoid occlusion protein;       
   29::269     1e-41  40%  290 aa  NOC_BACC4 RecName: Full=Nucleoid occlusion protein;       
   29::269     1e-41  40%  290 aa  NOC_BACC2 RecName: Full=Nucleoid occlusion protein;       
   29::269     2e-41  40%  290 aa  NOC_BACCQ RecName: Full=Nucleoid occlusion protein;       
   29::269     2e-41  40%  290 aa  NOC_BACC7 RecName: Full=Nucleoid occlusion protein;       
   28::253     1e-40  40%  281 aa  NOC_GEOTN RecName: Full=Nucleoid occlusion protein;       
   26::254     1e-40  42%  283 aa  NOC_BACSK RecName: Full=Nucleoid occlusion protein;       
   30::256     2e-40  39%  283 aa  NOC_BACLD RecName: Full=Nucleoid occlusion protein;       
   32::256     2e-40  40%  283 aa  NOC_BACA2 RecName: Full=Nucleoid occlusion protein;       
   20::254     7e-40  40%  283 aa  NOC_BACHD RecName: Full=Nucleoid occlusion protein;       
   32::256     1e-39  39%  283 aa  NOC_BACSU RecName: Full=Nucleoid occlusion protein;       
   28::251     2e-39  42%  281 aa  NOC_GEOSW RecName: Full=Nucleoid occlusion protein;       
   28::251     3e-39  40%  281 aa  NOC_GEOKA RecName: Full=Nucleoid occlusion protein;       
   37::235     1e-38  43%  291 aa  NOC_BACP2 RecName: Full=Nucleoid occlusion protein;       
   35::226     2e-38  42%  298 aa  NOC_LYSSC RecName: Full=Nucleoid occlusion protein;       
    8::217     8e-38  45%  281 aa  PARB_CHLTR RecName: Full=Probable chromosome-partitioning protein
   66::333     1e-37  37%  344 aa  PARB_MYCTU RecName: Full=Probable chromosome-partitioning protein
   66::333     1e-37  37%  344 aa  PARB_MYCBO RecName: Full=Probable chromosome-partitioning protein
   48::223     1e-37  46%  290 aa  NOC_BACCN RecName: Full=Nucleoid occlusion protein;       
   29::218     2e-37  42%  286 aa  NOC_OCEIH RecName: Full=Nucleoid occlusion protein;       
   49::306     2e-37  35%  310 aa  PARB_XYLFT RecName: Full=Probable chromosome-partitioning protein
    3::222     4e-37  41%  324 aa  PARB_TREPA RecName: Full=Probable chromosome-partitioning protein
    1::223     9e-37  43%  280 aa  PARB_CHLMU RecName: Full=Probable chromosome-partitioning protein
   19::255     2e-35  36%  260 aa  PARB_BORBU RecName: Full=Probable chromosome-partitioning protein
   26::213     1e-34  39%  284 aa  NOC_LISMF RecName: Full=Nucleoid occlusion protein;       
   26::213     1e-34  39%  284 aa  NOC_LISMC RecName: Full=Nucleoid occlusion protein;       
   12::229     1e-34  40%  286 aa  PARB_CHLPN RecName: Full=Probable chromosome-partitioning protein
   29::216     2e-34  39%  287 aa  NOC_LISMH RecName: Full=Nucleoid occlusion protein;       
   26::213     3e-34  39%  284 aa  NOC_LISMO RecName: Full=Nucleoid occlusion protein;       
   26::213     3e-34  40%  284 aa  NOC_LISIN RecName: Full=Nucleoid occlusion protein;       
   26::213     3e-34  41%  284 aa  NOC_LISW6 RecName: Full=Nucleoid occlusion protein;       
   28::200     3e-24  43%  293 aa  PARB2_DEIRA RecName: Full=Probable chromosome 2-partitioning
    6::134     6e-23  43%  291 aa  PARB3_DEIRA RecName: Full=Probable plasmid-partitioning protein
   37::198     1e-22  37%  401 aa  PARB2_XYLFA RecName: Full=Probable plasmid-partitioning protein
   67::207     2e-13  37%  358 aa  KORB2_ECOLX RecName: Full=Transcriptional repressor protein korB;
   69::172     9e-08  33%  312 aa  REPB_AGRRH RecName: Full=Putative replication protein B;
   49::170     1e-07  32%  326 aa  Y4CJ_RHISN RecName: Full=Putative replication protein B;
   59::150     1e-07  38%  349 aa  KORB1_ECOLX RecName: Full=Transcriptional repressor protein korB;
   26::200     5e-07  25%  652 aa  YUBM_ECO57 RecName: Full=Uncharacterized protein yubM;
   26::200     6e-07  23%  652 aa  YUBM_ECOLI RecName: Full=Uncharacterized protein yubM;
   15::135     5e-04  26%  186 aa  ATPD_MYCAP RecName: Full=ATP synthase subunit delta;AltName:
   23::76      6e-04  35%   87 aa  YNAK_ECOLI RecName: Full=Uncharacterized protein ynaK;
    1::282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
PARB_PSEPU      ------KRGLGRGLDALLSEQAVKIDQKELQVELVQRGKYQPRRDMDPEALEELAHSIRNHGVMQPIVVR
PARB_PSEPK      ------KRGLGRGLDALLSEQAVKIDQKELQVELVQRGKYQPRRDMDPEALEELAHSIRNHGVMQPIVVR
PARB_NEIMA      ----KVKGGLGRGLDSLLADNSSGDRLTTVAVKDIRPGRYQARVQIDDEALQELADSIKAQGVIQPVIVR
PARB_RICTY      --------------------------VQIINIDKIKPNENQPRKHFEYNKIKELADSILNNGLLQPIIV-
PARB_NEIMB      ----KVKGGLGRGLDSLLADNSSGDRLTTVAVKDIRPGRYQARVQIDDEALQELADSIKAQGVIQPVIVR
PARB_RICBR      --------------------------VQIINIDRIKPNENQPRKHFEYDKIKELSDSILNNGLLQPIII-
PARB_COXBU      -----------------LADSKTELK--KLTIDVIQPGRYQPRRQMDKDALEELANSIRAQGIIQPIVVR
PARB_VIBCH      ------KRGLGKGLDALLATSSLEGELADLSISNLKPGIYQPRKDLSPEALEELAASIQSQGIIQPIVVR
PARB_RICCN      -----------------------------INIDKIRPNENQPRKNFEYDKIKELADSILNNGLLQPIIV-
SP0J_BACSU      -------KGLGKGINALFNQVDLEETVEEIKIADLRPNPYQPRKHFDDEALAELKESVLQHGILQPLIVR
PARB_RICPR      --------------------------VQIINIDKIKPNENQPRKHFEYNKIKELADSILNNGLLQPIII-
PARB_RICFE      -------------------------------------NENQPRKNFEYDKIKELADSILNNGLLQPIIV-
PARB_CAUCR      -------------------------------IEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVR
PARB_CAUCN      -------------------------------IEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVR
PARB_HELPY      -------KVLGRGLADIFPEINEVYEVVELGIDEVMPNPYQPRKVFSEDSLEELAQSIKEHGLLQPVLV-
PARB_HELPJ      -------KVLGRGLADIFPEINEVYEVVELGIDEVMPNPYQPRKIFSEDSLEELAQSIKEHGLLQPVLV-
PARB1_DEIRA     ------KSSLGRGLDALLGEPVAQAGVQTLKIERIAQAAYQPRQVFEPESLAELAQSIREKGVLQPLLVR
PARB_MYCLE      ------KGGLGRGLASLIGNTAADVLIGEIALSDITENPCQPRQVFDDEAMSELVHSIREFGLLQPIVVR
PARB_XYLFA      -----------------------------LQITQLQPSKYQPRREMSEPKLAELADSIKAQGVIQPIIVR
PARB_CAMJE      -----------RGLSSLISDMDTELGFDKIEIDQISPNPFQPRKNFDQEALDELANSIKEFGLIQPIIVF
NOC_BACHK       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACCZ       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACC3       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACC1       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACC0       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACAN       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACAH       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACAC       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACAA       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACWK       ---------------------KVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACCR       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIDELALTIRTHGLIQPIVVR
NOC_BACC4       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIDELALTIRTHGLIQPIVVR
NOC_BACC2       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIDELALTIRTHGLIQPIVVR
NOC_BACCQ       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_BACC7       -------------------DKKVYEEIQEIPIVNITPNRYQPRTVFDDARIEELALTIRTHGLIQPIVVR
NOC_GEOTN       --------------------------VRNIPVASIIPNRFQPRTVFDEEKIAELALTIRTHGIIQPIVVR
NOC_BACSK       --------------------------VQQLAIKDIVPNRFQPRTLFDEDRIAELAQTIRTHGVIQPIVVR
NOC_BACLD       --------------------------IQEIPVGDIIPNRFQPRTIFSEEKIKELAATIHTHGIIQPIVVR
NOC_BACA2       ----------------------------EIPVHAIVPNRFQPRTIFSDEKIKELAMTIHTHGIIQPIVVR
NOC_BACHD       -------------------ETGKQEEVHQLPIKEIVPNRFQPRTIFDDERIEELAQTIRTHGIIQPIVVR
NOC_BACSU       ----------------------------EIPVNAIVPNRFQPRTIFSDEKIKELAMTIHTHGIIQPIVVR
NOC_GEOSW       --------------------------VRKIPVSKIVPNRFQPRTIFDEEKIEELALTIHTHGIIQPIVVR
NOC_GEOKA       --------------------------VRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVR
NOC_BACP2       --------------------------IQELPVDTIMPNRFQPRTIFSEEKIHELATTIHTHGIIQPIVVR
NOC_LYSSC       --------------------------VIKLPIDQIVPNRFQPRTIFDDEKIEELSRTIHTHGVIQPIVVR
PARB_CHLTR      -------------------DTLLEVNIEDIRVSP-----FQPRRTFLEEDLKELVLSIKTVGLIHPPVVR
PARB_MYCTU      --------------------------------SAIEANPRQPRQVFDEEALAELVHSIREFGLLQPIVVR
PARB_MYCBO      --------------------------------SAIEANPRQPRQVFDEEALAELVHSIREFGLLQPIVVR
NOC_BACCN       --------------------------------------RYQPRTVFDDARIDELALTIRTHGLIQPIVVR
NOC_OCEIH       --------------------------VIQIKVDNIHPNRYQPRTIFQEEKIKELAQTIHTHGMIQPIVVR
PARB_XYLFT      --------------------------------TQLQPSKYQPRREMSEAKLAELADSIKAQGVIQPIIVR
PARB_TREPA      ------KDKLGKGIDALLQESSDRYDVRDLDPTLLQANPHQARRTFAQESLEELAASIREHGVIQPVLAE
PARB_CHLMU      -------------MSKLPGETLLEVNIDDIRVSP-----FQPRRIFFEEDLKELILSIKAVGLIHPPVVR
PARB_BORBU      ----------------------------------------QPRKSVSLVELEELSISIKENGILQPLIVC
NOC_LISMF       --------------------------VQELPMDKIFPNQFQPRTVFDQDKIDELARTIRIHGVIQPIVVR
NOC_LISMC       --------------------------VQELPMDKIFPNQFQPRTVFDQDKIDELARTIRIHGVIQPIVVR
PARB_CHLPN      ----------------------------EVAIDDIRVSPFQPRRVFSNEELQELIASIKAVGLIHPPVVR
NOC_LISMH       --------------------------VQELPMDKIFPNQFQPRTVFDQDKIDELARTIRIHGVIQPIVVR
NOC_LISMO       --------------------------VQELPMDKIFPNQFQPRTVFDQDKIDELARTIRIHGVIQPIVVR
NOC_LISIN       --------------------------VLELPMDKIFPNQFQPRTVFDQDKIDELARTIRIHGVIQPIVVR
NOC_LISW6       --------------------------VLELPMDKIFPNQFQPRTVFDQDKIDELARTIRIHGVIQPIVVR
PARB2_DEIRA     -------------------------DIRALPVNELKVGSTQPRRSFDLERLSELAESIRAHGVLQPLLVR
PARB3_DEIRA     ------------GLAALLGESAVVGHTSTLRVDQLRAGSQQPRRQFGTEGLTELAASIQSQGILQPLLVR
PARB2_XYLFA     ---------LGAGIDALFADQGAQYSLIPL---DMIQVKTQIRESFEDETLEDLAASIKVRGVLQPILLR
KORB2_ECOLX     ----------------------------------------QPRTAFSPESIAEIGATIKERGVKSPISVR
REPB_AGRRH      --------------------------------------------------IDGLLTSIREQGQQVPILVR
Y4CJ_RHISN      ----------------LEGETVVELDPETLDGSFV-----SDRMGDSSEQFEELKQAIAERGQDTPILVR
KORB1_ECOLX     ----------------------------------------QPRTAFSPESIAEIGETIKARGVKSPISVR
YUBM_ECO57      -------------LSALLAQTE-EVSV---PLASLIKSPLNVRTVYSAESVSELADSIKGVGLLQNLVVH
YUBM_ECOLI      -------------LSALLAQTE-EVSV---PLASLIKSPLNVRTVYSAESVSELADSIKGVGLLQNLVVH
ATPD_MYCAP      ----------------------------------------------------------------------
YNAK_ECOLI      -------------------------------------------RTHSTEQVAQLVESIKQFGWTNPVLI-


                         .         .         *         .         .         .         .:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEE
PARB_PSEPU      PIGDN--RYEIIAGERRWRATQQAGLDTIPAMVREVPDEAAIAMALIENIQREDLNPLEEAMALQRLQQE
PARB_PSEPK      PIGDN--RYEIIAGERRWRATQQAGLDTIPAMVREVPDEAAIAMALIENIQREDLNPLEEAMALQRLQQE
PARB_NEIMA      EHGL--SRYELIAGERRWRAAQIAGLTEIPAVIKTISDETALAMGLIENLQRENLNPIEEAQGLKRLADE
PARB_RICTY      -----DNNFQIIAGERRWRACKLAQVLEIPVIIKNFDTRESMETALIENIQRTDLTVMEEARGFKYLVDN
PARB_NEIMB      EHGL--SRYELIAGERRWRAAQIAGLTEIPAVIKTISDETALAMGLIENLQRENLNPIEEAQGLKRLADE
PARB_RICBR      ----DNS-FQIIAGERRWRACKLAKISEIPVIIKNLDAKESMEIALIENIQRSDLTVMEEARGFKYLVEN
PARB_COXBU      PVGQ---RYEIIAGERRWRAAQLAGLKEVPAVIRPITDEAAITMSLIENIQRQNLNAIEEAAALQRLLDE
PARB_VIBCH      HLPTGG--YEIIAGERRWRAAKQAGLKQVPCLIKQVEDRGAIAMALIENIQREDLNAMEEAQALERLQNE
PARB_RICCN      -----DNNFQIIAGERRWRACKLAKVLEIPVIIKNLDARESMEIALIENIQRTDLTVMEEARGFKYLIEN
SP0J_BACSU      KSLKG---YDIVAGERRFRAAKLAGLDTVPAIVRELSEALMREIALLENLQREDLSPLEEAQAYDSLLKH
PARB_RICPR      -----DNNFQIIVGERRWRACKLAKVLEIPVIIKNFDTRESMEVALIENIQRTDLTVMEEARGFKYLVEN
PARB_RICFE      -----DNNFQIIAGERRWRACKLAKVLEIPVIIKNLDARESMEIALIENIQRTDLTVMEEARGFKYLVEN
PARB_CAUCR      PSPDTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEK
PARB_CAUCN      PSPDTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEK
PARB_HELPY      --VSENGRYHLIAGERRLRASKLAKMPTIKAIVVDIEQEKMREVALIENIQREDLNPLELARSYKELLES
PARB_HELPJ      --VSENGRYHLIAGERRLRASKLAKMPTIKAIVVDIEQEKMREVALIENIQREDLNPLELARSYKELLES
PARB1_DEIRA     PRGD---AFEIVAGERRWRASQLAGLTELPVMIRDLGDREALEIAIVENLQREDLGPLEEARAYQALLDQ
PARB_MYCLE      PASGSDTRYQIVMGERRWRAAQQAGLSFIPAIVRATGDDSMLRDALLENIHRVQLNPLEEAAAYQQLLDE
PARB_XYLFA      ELDVD--MFEIVAGERRWRASQLAGLTEVPVLVRELDDRTVVAMALIENIQREDLNPLEEAQALQRLIDE
PARB_CAMJE      KK---NNKFILIAGERRLRAVKALGKKEILAFIADIDENKLRELALIENIQRENLNPIELANSYKDLMQV
NOC_BACHK       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACCZ       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACC3       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACC1       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACC0       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACAN       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACAH       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACAC       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACAA       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACWK       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACCR       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACC4       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACC2       QYEDD--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACCQ       QYEDE--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_BACC7       QYEDE--KYEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_GEOTN       EC--DNGQFEIIAGERRWRAVQKLGWTEIPAIIKNLNDKETASVALIENLQREELTPIEEAMAYARLIEL
NOC_BACSK       VRDD---KYEIIAGERRWRAVTSLQWETIPAIVKEFNDSQTASIALIENLQREGLTAIEEATAYAKLIEI
NOC_BACLD       KT-EREGQYELIAGERRWRAVQTLDWEKVPAIIKDFSDTETASVALIENLQREELSSIEEAHAYARLLEL
NOC_BACA2       HT-EDEGQYELIAGERRWRAVQTLEWEKIPAIIKDFSDTETASVALIENLQREELSSIEEAHAYARLLEL
NOC_BACHD       QRE---GKYEIIAGERRFRAVTLLGWETIPAIIKEFNDSQTASVALIENLQREGLTAVEEAVAYQKLIEL
NOC_BACSU       HTEEEG-QYELIAGERRWRAVQSLEWEKIPAIIKDFSDTETASVALIENLQREELSSIEEAHAYARLLEL
NOC_GEOSW       EC--EDGKFEIIAGERRWRAVQKLGWSEIPAIIKNLNDKETASVALIENLQREELTPIEEAMAYAKLLEL
NOC_GEOKA       ECG--NGRFEIIAGERRWRAVQKLGWTEIPAIIKNLNDKETASVALIENLQREELTPIEEAMAYAKLIEL
NOC_BACP2       -PTEEEGKYELIAGERRWRAVQTLQWEKIPAIIKDFTDTETASVALIENLQREELSAIEEAHAYARLLEL
NOC_LYSSC       KTSEN--QYEIIAGERRYRAMKKLQWTEVPAIVRNLTDKETASIALIENLQREELTAIEEAVAYQKLLEL
PARB_CHLTR      RNGDKVLYYELIAGERRWRALQLAGYKTVPVVLKQVDDMAA-EATLIENIQRVNLNPLEMAEAFRRLIVV
PARB_MYCTU      SGSQTGVRYQIVMGERRWRAAQEAGLATIPAIVRETGDDNLLRDALLENIHRVQLNPLEEAAAYQQLLDE
PARB_MYCBO      SGSQTGVRYQIVMGERRWRAAQEAGLATIPAIVRETGDDNLLRDALLENIHRVQLNPLEEAAAYQQLLDE
NOC_BACCN       QYEEDC--YEIIAGERRFRAATKLGWEKVPAIIKNLNDTETASVALIENLQREELTAIEEAVAYQKLIEL
NOC_OCEIH       KL-EDEDTYELIAGERRWRAVQHLGWEQVSAIIRDMTDTETASVALIENLQREELTVIEEAIAYSKLLEL
PARB_XYLFT      ELDVD--MFEIVAGERRWRASQLAGLTEVPVIVRELDDRTVVAMALIENIQREDLNPLEEAQALQRLIDE
PARB_TREPA      KNQDGS--WVIIAGERRTRAAILAGLNRIPVIVRTCDHEKKLAIALIENVQRENLNPLEEARAYQHIMDL
PARB_CHLMU      RNGDKVLYYELIAGERRWRALQSAGYKTIPVVLKQVDDLAA-EATLIENIQRVNLNPLEMAEAFRRLIVV
PARB_BORBU      KA---NDRYKIIVGERRFRAAKLIQLTNIPVIEVDIKESCKDFMPLVENIQRENFTPVEEAYAYKNIMNK
NOC_LISMF       EMEPDY--YEIIAGERRFRAVLSLEMEKIPAIIQNLDDEEVAAIALIENLQREELTPIEEAKAYRSLLDM
NOC_LISMC       EMEPDY--YEIIAGERRFRAVLSLEMEKIPAIIQNLDDEEVAAIALIENLQREELTPIEEAKAYRSLLDM
PARB_CHLPN      ETGDRVLYYELIAGERRWRAMQLAGATTIPVILKHIADGTAAEATLIENIQRVNLNPIEMAEAFKRLIHV
NOC_LISMH       EMEPDY--YEIIAGERRFRAVLSLEMEKIPAIIQNLDDEEVAAIALIENLQREELTPIEEAKAYRSLLDM
NOC_LISMO       EMEPDY--YEIIAGERRFRAVLSLEMEKIPAIIQNLDDEEVAAIALIENLQREELTPIEEAKAYRSLLDM
NOC_LISIN       EMEPDY--YEIIAGERRFRAVLSLKLEKIPAIIQNLDDEEVAAIALIENLQREELTPIEEAKAYRSLLDM
NOC_LISW6       EMEPDY--YEIIAGERRFRAVLSLELEKIPAIIQNLDDEEVAAIALIENLQREELTPIEEAKAYRSLLDM
PARB2_DEIRA     SV---DGQYEIVAGERRWRAAQLAGLAEVPVVVRQLSNEQARAAALIENLQRDNLNVIDEVDGKLELIEE
PARB3_DEIRA     AVGDT---YEIVAGERRWRAAQLAGLTEVPVIVKSLTDQEAAVIALIENLQRENLNLIDEVEGKLLLV--
PARB2_XYLFA     SNSEG---YELIAGERRYRASKLAGLEQIPAYIREMSDEEAEDAQMAENIHRKNLTQIEEAKKIQRDLDK
KORB2_ECOLX     ENQEQPGRYIINHGARRYRGSKWAGKKSIPAFIDN--DYNEAD-QVIENLQRNELTPREIADFIGR---E
REPB_AGRRH      PHPSQPGRYQVAFGHRRLRAVSELGL-PVRAVVRELTDEQVVVAQGQENNEREDLTFIEKARFAHRLNRQ
Y4CJ_RHISN      PHPSAADRYQIVFGHRRARVARELG-RKVKAVVKALDDRTHVIAQGQENSARANLSFIERA-NFASHLEK
KORB1_ECOLX     ENPDAPGRYLINHGARRYRGSKWAHKTTIPAFIDN--DYNEAD-QVIENLQRNELTAREIA---------
YUBM_ECO57      ALPGDXXXXXXXXXERDIIPA------DWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQE
YUBM_ECOLI      ALPGDXXXXXXXXXXXXXXXXXERDIIQVPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQE
ATPD_MYCAP      ----------------------------------------------------------------------
YNAK_ECOLI      -----DEKGEIIAGHGRVMAAEMLKMDSVPVIV-------------------------------------


                         +         .         .         .         .         *         .:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVR
PARB_PSEPU      FELTQQQVADAVGKSRVTVANLLRLITLPDAIKTMLAHGDLEMGHARALLGLDRQEEGARHVVARGLTVR
PARB_PSEPK      FELTQQQVADAVGKSRVTVANLLRLITLPDAIKTMLAHGDLEMGHARALLGLDRQEEGARHVVARGLTVR
PARB_NEIMA      FGLTHETIAQAVGKSRSAISNSLRLLSLPEPVQEMLYQRRLEMGHARALLTLPVVEELAQKAVKNGWSVR
PARB_RICTY      FNYTVEKLAERLGKSRSHIANLLRLNNLPQSIQDKLNENILSMGHARCLINHEYAEEIANHIINHDLNVR
PARB_NEIMB      FGLTHETIAQAVGKSRSAISNSLRLLSLPEPVQEMLYQRRLEMGHARALLTLPVVEELAQKAVKNGWSVR
PARB_RICBR      FNYTAEKLAERLGKSRSHIANLLRLNNLPQSIQNKLDENTLSMGHARCLINHEHAEIIANYVIDNDLNVR
PARB_COXBU      FKMTHEEIAEAVGKSRTSVTNSLRLLKLNPDVKALLEQGHLDMGHARALLALEGFQEAANIIIKRALSVR
PARB_VIBCH      FNLTHQQVAEVIGKSRTTVTNLLRLNQLSDDVKRLLETKQLEMGHARALLMLEGEQQVAQQVAKKQLTVR
PARB_RICCN      FNYTAEKLAERLGKSRSHIANLLRLNNLPQSIQDKVNENILSMGQARCLINHEHAEVIADYIINNDLNVR
SP0J_BACSU      LDLTQEQLAKRLGKSRPHIANHLRLLTLPENIQQLIAEGTLSMGHGRTLLGLKNLEPLVQKVIAEQLNVR
PARB_RICPR      FNYTVEKLAERLGKSRSHIANLLRLNNLPQSIQDKLNENILSMGHARCLINHEYAEEIADHIINHDLNVR
PARB_RICFE      FNYTTEKLAERLGKSRSHIANLLRLNNLPQSIQDKVNENILSMGQARCLINHEHAEVMADHIISNDLNVR
PARB_CAUCR      FERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYLVSGELXXXXXXXXXXXXXXXXXXXXIIEGGLSVR
PARB_CAUCN      FERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYLVSGELXXXXXXXXXXXXXXXXXXXXIIEGGLSVR
PARB_HELPY      YQMTQEELSKIVKKSRAHVANIMRLLTLSSKVQNALLEEKITSGHAKVLVGLDKQELILNSIIGQKLSVR
PARB_HELPJ      YQMTQEELSKIVKKSRAHVANIMRLLTLSSKVQNALLEEKITSGHAKVLVGLEKQELILNSIIGQKLSVR
PARB1_DEIRA     -GLNQEGVAQAVGKGRSTVTNALRLLTLPEPVLRALDEGSISASHARAVLTQPEADWAFEQIRSRGLNVR
PARB_MYCLE      FEVTHDELASRIGRSRPLITNMIRLLKLPIPVQRRVAAGVLSAGHARALLSLEAQEELASRIIAEGLSVR
PARB_XYLFA      FSLTHAEAAEAVGRSRAAVSNXXXXXXXXXXXXXXXQSRRLEMGHARALLTLELADKLAKEAADQGWSVR
PARB_CAMJE      HKITQENLAELIHKSRTQITNTLRLLNLDIRTQELIASGKISQGHAKVLVGLDDEKMLVDSIIGQKLNVR
NOC_BACHK       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACCZ       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKNALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACC3       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACC1       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKNALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACC0       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACAN       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACAH       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACAC       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACAA       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACWK       HNLTQEALAQRLGKGQSTVANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACCR       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACC4       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACC2       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKSALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACCQ       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKNALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_BACC7       HNLTQEALAQRLGKGQSTIANKLRLLKLPEEIKNALLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_GEOTN       HDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERHARALIAXXXXXXXXXXIIDKQLNVK
NOC_BACSK       HNLTQESLAQRLGKGQSTIANKLRLLHLPQAVQDAILNRDISERHARALIALKDAEAVLKQIIEEQLNVK
NOC_BACLD       HDLTQEALAQRLGKGQSTIANKLRLLKLPEEVQEAILKKEISERHARALIPLKQPDLLLHEVIEKSLNVK
NOC_BACA2       HDLTQEALAQRLGKGQSTIANKLRLLKLPEPVQDAIMEKKITERHARALIPLKQPEFLLAEIIEKSLNVK
NOC_BACHD       HGLTQESLAQRLGKGQSTIANKLRLLHLSEPVQQAIMERKISERHARALLSLKDDALLLEEIVEQHLNVK
NOC_BACSU       HDLTQEALAQRLGKGQSTIANKLRLLKLPQPVQEAIMEKKITERHARALIPLKQPELLLTEIIEKSLNVK
NOC_GEOSW       HNLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLHRTITERHARALIXXXXXXXXXXXIIDKQLNVK
NOC_GEOKA       HDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERHARALIAXXXXXXXXXXIIDKQLNVK
NOC_BACP2       HDLTQEALAQRLGKGQSTVANKLRLLKLPEEVQQAILEKKISERHARSLVPLKLPELLLQEIIEKQLNVK
NOC_LYSSC       HELTQEALAQRLGKGQSTVANKLRLLRLPDEVQQAILQRKISERHARALIAIKDQPLVLQQTVDNDWNVR
PARB_CHLTR      FGLTQDKVAKKVGKKRSTVANYLRLFSLPQEVQEKMNSGEISLGHAKVILSLEDRQILSQKIISCKLAVR
PARB_MYCTU      FGVTHDELAARIGRSRPLITNMIRLLKLPIPVQRRVAAGVLSAGHARALLSLEAGEELASRIVAEGLSVR
PARB_MYCBO      FGVTHDELAARIGRSRPLITNMIRLLKLPIPVQRRVAAGVLSAGHARALLSLEAGEELASRIVAEGLSVR
NOC_BACCN       HNLTQEALAQRLGKGQSTIANKLRLLKLPEDIKRSLLEKSITERHARALIPLKNEELVLQEIVEKQLNVK
NOC_OCEIH       HSLTQEALAQRLGKNQSTVANKLRLLKLPEEVQTALLDKAISERHARALIKLDQQIAVLHEILEKGLNVK
PARB_XYLFT      FSLTHAEAAEAVGRSRAAVSNXXXXXXXXXXXXXXXESHQLEMGHXXXXXXXXXXXXXXXXXXDQGWSVR
PARB_TREPA      GNLSHEELAQRVGKNRSTITNALRLLKLPPEVQQSLSSRTLSAGHARALLSLTDMQLVAQYVVTHALSVR
PARB_CHLMU      FGLTQDKVAKKVGKKRSTVANYLRLFSLSNEIQEKINSGELTLGHAKVILSLEDRQILSEKIISSKLAVR
PARB_BORBU      YSLTQKDLSEKIGKSRTYISNLVRILDLEQEILNAIHRKEISFGHAKVILSLKDRQDRYNLILKKKFSVR
NOC_LISMF       QDVTQEALAQRVGKSQSAIANKMRLLKLPETVQEAVLNKQISERHARSLLALETEEAILAEIAENHWNVK
NOC_LISMC       QDVTQEALAQRVGKSQSAIANKMRLLKLPETVQEAVLNKQISERHARSLLALETEEAILAEIAENHWNVK
PARB_CHLPN      FGLTQDKVAYKVGKKRSTVANYLRLLALSKTIQESLLQGQITLGHAKVILTLEDREKLNEIIIQEHLAVR
NOC_LISMH       QEVTQEALAQRVGKSQSAIANKMRLLKLPETVQEAVLNKQISERHARSLLALETEEALLAEIAENHWNVK
NOC_LISMO       QDVTQEALAQRVGKSQSAIANKMRLLKLPETVQEAVLIKQISERHARSLLALETEEALLAEIAENHWNVK
NOC_LISIN       QDVTQEALAQRVGKSQSAIANKMRLLKLPETVQEAVLNKQISERHARSLLALETEESLLQEIEENHWNVK
NOC_LISW6       QDVTQEALAQRVGKSQSAIANKLRLLKLPEAVQQAVLNKQISERHARSLLALETEATQVDEIEENHWNVK
PARB2_DEIRA     AEHEQDQVFRSMGETRTFAKNKLRILNWPQPVLEALR---------------------------------
PARB3_DEIRA     ----------------------------------------------------------------------
PARB2_XYLFA     LG-SVDAVLEKHQKSRPWLSKMLALLNLPEQAKRLV----------------------------------
KORB2_ECOLX     LAKGKKKIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRV-----------------------------
REPB_AGRRH      FSREIVIAAMSIDKS-------------------------------------------------------
Y4CJ_RHISN      LGYDR-----------------------------------------------------------------
KORB1_ECOLX     ----------------------------------------------------------------------
YUBM_ECO57      -GKTPAQIGDLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQAL---------------------
YUBM_ECOLI      -GKTPAQIGDLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQAL---------------------
ATPD_MYCAP      --YDLHKEEKHVSSTYENILSFYELLSNDKEVFSFFNSSK---------IGLEEKHKIADELVQENKNLK
YNAK_ECOLI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QSENFVKIFKTKKHSLKTSKDINLQVLENSIREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIEIIKS
PARB_PSEPU      QTEALVRQWSDKPDPVEPSKDPDIARLEQRLAERLGSAVQIRHGNKGKGQLVIRYNSLDELQGVLAHIR-
PARB_PSEPK      QTEALVRQWSDKPDPVEPSKDPDIARLEQRLAERLGSAVQIRHGNKGKGQLVIRYNSLDELQGVLAHIR-
PARB_NEIMA      EVERRSQALQNKRPEPKKTAAADIGRLNDLLTEKLGVNAEIKTANHKKGKIILHFDTPETFDHILKQLGI
PARB_RICTY      QTEALVRQWEYKKSTNNTNKDNDLELLVKALSKKFGIKITIDN-CNLGGKLMFHYKDLEELDLIL-----
PARB_NEIMB      EVERRSQALQNKRPEPKKTAAADIGRLNDLLTEKLGVNAEVKTANHKKGRIVLYFDTPETFGHLLEQLGI
PARB_RICBR      QTEELVRQWSQNEYTKEKTEDNDLQSLVKILSEKFNIKVTIEN-YSLGGKLIFHY---------------
PARB_COXBU      ETEKLIQHWQSKSSANRPSMDPDVARLQHHLSDKLGAAVTIRHGAKGKGKLIIHYNSADELEGILDRIR-
PARB_VIBCH      QTEQLVKCLSDPSDAKNVSEDLEIQQLSQNLSEKLAAKVSIVRTPNGKSKVTISLDEPHKLELLI-----
PARB_RICCN      QTEELVRQWKIGKRFLKNATDNDLELLVKALSEKFGIKITIENYP-LGGKLIFHY---------------
SP0J_BACSU      XXXXXXXXXETKKK--EPVKDAVLKERESYLQNYFGTTVNIKRQK-KKGKIEIEFFSNEDLDRILELL--
PARB_RICPR      QTEALVRQWHXXXXXXXXXXDNDLELLVKALSKKFGIKITIDNCR-LGGKLMFHYKNLEELDLIL-----
PARB_RICFE      QTEELVRQWKVGKRFLKNATDNDLESLVKVLSEKFGIKVTIEN-YSLGGKLIFHY---------------
PARB_CAUCR      ETEALARAGKSKGGRPPRVKDTDTQAXXXXXXXXXXXXXXI-DHRGSTGTLTITYATLEQLDDL------
PARB_CAUCN      ETEALARAGKSKGGRPPRVKDTDTQAXXXXXXXXXXXXXXI-DHRGSTGTLTITYATLEQLDDL------
PARB_HELPY      QTEDLARDFKNKKHGFKQTQTLELERLNQSLWDHYKLKAALKGNK-------------------------
PARB_HELPJ      QTEDLARDFKNKKHGFKQTQTLELERFNQSLWDRYKLKAALKGKK-------------------------
PARB1_DEIRA     EAEALKRRDKGQGAPIKVNPPRAYRQLELDLSRRTGTRVKITGE--DKGRVELNYGSREELDRILQIL--
PARB_MYCLE      ATEEAVKLANHEVNRVQRRKPIGLQDVAERLSNAFDTRVMVSLGK-RKGKIVVEFSSVDDLQRIVDVM--
PARB_XYLFA      EVEHRAQQFKKSKSPASAPAQPDIASLETELSEHLGTKVAINHGRAGKGKLVIHYTDLDVLDGVLERLRA
PARB_CAMJE      DTEKIVKKIKNNESLPNQEFEDEIKKLK-QILNRFGFD--CKNKNND-----------------------
NOC_BACHK       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACCZ       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACC3       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACC1       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACC0       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACAN       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACAH       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACAC       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACAA       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACWK       QTEKLLEEVKPKRKAKQKAVSRDARIAMNTIRQSLGLNV-------------------------------
NOC_BACCR       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACC4       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACC2       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACCQ       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_BACC7       QTEKLLEEAKPKRKAKQKAVSRDTRIAMNTIRQSLGLNV-------------------------------
NOC_GEOTN       QTEDRVKMLEAGERKPKPKRKADMRIAVNTIRQSLSM---------------------------------
NOC_BACSK       QTEERVKYFKTAEEEXXXXXXXDMRIAMNTIRQSVDM---------------------------------
NOC_BACLD       QTEDVVKMLEQDKRKPKPKRKADARIAMNTIRQSLSM---------------------------------
NOC_BACA2       QTEDVVKMLEQNKQKPKPRRKADTRIAMNTIRQSLSM---------------------------------
NOC_BACHD       QTEERVKASKPKKKPTRKAYSKDMRIAMNTIRQSVDM---------------------------------
NOC_BACSU       QTEDVVKMLEQGQRKPKPRRKADTRIAMNTIRQSLSM---------------------------------
NOC_GEOSW       QTEDRVKMLEAANXXXXXSKDMRIAV--NTIRQSL-----------------------------------
NOC_GEOKA       QTEDRVKLLEAGERKPKPKRKADMRIAVNTIRQSL-----------------------------------
NOC_BACP2       QTERVVKMLEQK----------------------------------------------------------
NOC_LYSSC       QLEEQIQ---------------------------------------------------------------
PARB_CHLTR      EAEMEAKLVKGKGASLK-----------------------------------------------------
PARB_MYCTU      ATEETVTLARQAHHSDATTKPIQMPGLQD-VAERLSTTFVTVSLGKRKGKIVVEFGSVDDLARIVGLMTT
PARB_MYCBO      ATEETVTLARQAHHSDATTKPIQMPGLQD-VAERLSTTFVTVSLGKRKGKIVVEFGSVDDLARIVGLMTT
NOC_BACCN       QTE-------------------------------------------------------------------
NOC_OCEIH       QTED------------------------------------------------------------------
PARB_XYLFT      EVEHRAQQFKKSKSLASAPAQPDIASLETELSERLGTKVAINHGRTGKGKLVIHYTDLDVLDGVLERLRA
PARB_TREPA      AAEECV----------------------------------------------------------------
PARB_CHLMU      EAEIEAKLLKGKEDASK--KEASLQ---------------------------------------------
PARB_BORBU      DAEKYVKNFSVKKRELE--QDPFLNNIKEFLFDKIQTKIDIKGNQ-NKGKIEIEYFTAGDLKRIVSL---
NOC_LISMF       QTE-------------------------------------------------------------------
NOC_LISMC       QTE-------------------------------------------------------------------
PARB_CHLPN      EAELIAKQLISEEGSSIELKPTPLDMAESS----------------------------------------
NOC_LISMH       QTE-------------------------------------------------------------------
NOC_LISMO       QTE-------------------------------------------------------------------
NOC_LISIN       QTE-------------------------------------------------------------------
NOC_LISW6       QTE-------------------------------------------------------------------
PARB2_DEIRA     ----------------------------------------------------------------------
PARB3_DEIRA     ----------------------------------------------------------------------
PARB2_XYLFA     ----------------------------------------------------------------------
KORB2_ECOLX     ----------------------------------------------------------------------
REPB_AGRRH      ----------------------------------------------------------------------
Y4CJ_RHISN      ----------------------------------------------------------------------
KORB1_ECOLX     ----------------------------------------------------------------------
YUBM_ECO57      ----------------------------------------------------------------------
YUBM_ECOLI      ----------------------------------------------------------------------
ATPD_MYCAP      TFANFLKLLISKNNS-----PLLLQALSIYIR-------LVESELNILRAKLISAFEIDNQTKIIEKLEN
YNAK_ECOLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NY
PARB_PSEPU      --
PARB_PSEPK      --
PARB_NEIMA      DY
PARB_RICTY      --
PARB_NEIMB      DY
PARB_RICBR      --
PARB_COXBU      --
PARB_VIBCH      --
PARB_RICCN      --
SP0J_BACSU      --
PARB_RICPR      --
PARB_RICFE      --
PARB_CAUCR      --
PARB_CAUCN      --
PARB_HELPY      --
PARB_HELPJ      --
PARB1_DEIRA     --
PARB_MYCLE      --
PARB_XYLFA      --
PARB_CAMJE      --
NOC_BACHK       --
NOC_BACCZ       --
NOC_BACC3       --
NOC_BACC1       --
NOC_BACC0       --
NOC_BACAN       --
NOC_BACAH       --
NOC_BACAC       --
NOC_BACAA       --
NOC_BACWK       --
NOC_BACCR       --
NOC_BACC4       --
NOC_BACC2       --
NOC_BACCQ       --
NOC_BACC7       --
NOC_GEOTN       --
NOC_BACSK       --
NOC_BACLD       --
NOC_BACA2       --
NOC_BACHD       --
NOC_BACSU       --
NOC_GEOSW       --
NOC_GEOKA       --
NOC_BACP2       --
NOC_LYSSC       --
PARB_CHLTR      --
PARB_MYCTU      D-
PARB_MYCBO      D-
NOC_BACCN       --
NOC_OCEIH       --
PARB_XYLFT      --
PARB_TREPA      --
PARB_CHLMU      --
PARB_BORBU      --
NOC_LISMF       --
NOC_LISMC       --
PARB_CHLPN      --
NOC_LISMH       --
NOC_LISMO       --
NOC_LISIN       --
NOC_LISW6       --
PARB2_DEIRA     --
PARB3_DEIRA     --
PARB2_XYLFA     --
KORB2_ECOLX     --
REPB_AGRRH      --
Y4CJ_RHISN      --
KORB1_ECOLX     --
YUBM_ECO57      --
YUBM_ECOLI      --
ATPD_MYCAP      KY
YNAK_ECOLI      --