[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21179.1

[Show Plain Result]


## Summary of Sequence Search
    1::844
    3::875       0.0  50%  875 aa  SYL_BARBK RecName: Full=Leucyl-tRNA synthetase;       
    4::870       0.0  51%  870 aa  SYL_PARL1 RecName: Full=Leucyl-tRNA synthetase;       
   12::886       0.0  50%  886 aa  SYL_BART1 RecName: Full=Leucyl-tRNA synthetase;       
   10::880       0.0  50%  880 aa  SYL_BARQU RecName: Full=Leucyl-tRNA synthetase;       
    4::873       0.0  48%  874 aa  SYL_AZOC5 RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUA2 RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUA1 RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUSI RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUO2 RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUME RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUMB RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUAB RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUSU RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  50%  877 aa  SYL_BRUC2 RecName: Full=Leucyl-tRNA synthetase;       
    4::842       0.0  51%  876 aa  SYL_RHIME RecName: Full=Leucyl-tRNA synthetase;       
    4::874       0.0  49%  875 aa  SYL_RHILO RecName: Full=Leucyl-tRNA synthetase;       
    4::877       0.0  48%  878 aa  SYL_NITHX RecName: Full=Leucyl-tRNA synthetase;       
    4::850       0.0  51%  877 aa  SYL_OCHA4 RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  48%  876 aa  SYL_AGRVS RecName: Full=Leucyl-tRNA synthetase;       
    4::854       0.0  48%  855 aa  SYL_HYPNA RecName: Full=Leucyl-tRNA synthetase;       
    5::827       0.0  49%  862 aa  SYL_RHORT RecName: Full=Leucyl-tRNA synthetase;       
    4::881       0.0  48%  882 aa  SYL_RHOPB RecName: Full=Leucyl-tRNA synthetase;       
   10::850       0.0  51%  880 aa  SYL_BARHE RecName: Full=Leucyl-tRNA synthetase;       
    9::845       0.0  48%  846 aa  SYL_ZYMMO RecName: Full=Leucyl-tRNA synthetase;       
    1::863       0.0  48%  865 aa  SYL_MARMM RecName: Full=Leucyl-tRNA synthetase;       
    4::849       0.0  49%  883 aa  SYL_NITWN RecName: Full=Leucyl-tRNA synthetase;       
    4::840       0.0  49%  874 aa  SYL_BRASB RecName: Full=Leucyl-tRNA synthetase;       
    4::856       0.0  50%  876 aa  SYL_SINMW RecName: Full=Leucyl-tRNA synthetase;       
    4::840       0.0  50%  874 aa  SYL_BRASO RecName: Full=Leucyl-tRNA synthetase;       
    4::842       0.0  49%  876 aa  SYL_RHISN RecName: Full=Leucyl-tRNA synthetase;       
    1::844       0.0  47%  861 aa  SYL_CAUCR RecName: Full=Leucyl-tRNA synthetase;       
    1::844       0.0  47%  861 aa  SYL_CAUCN RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  47%  876 aa  SYL2_RHIL3 RecName: Full=Leucyl-tRNA synthetase 2;       
    4::876       0.0  47%  876 aa  SYL_RHIE6 RecName: Full=Leucyl-tRNA synthetase;       
    4::859       0.0  49%  879 aa  SYL_OLICO RecName: Full=Leucyl-tRNA synthetase;       
    4::844       0.0  49%  871 aa  SYL_MESSB RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  48%  876 aa  SYL_RHIEC RecName: Full=Leucyl-tRNA synthetase;       
   10::823       0.0  48%  862 aa  SYL_MAGSA RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  46%  835 aa  SYL_RICRS RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  46%  835 aa  SYL_RICRO RecName: Full=Leucyl-tRNA synthetase;       
   18::873       0.0  48%  875 aa  SYL_GRABC RecName: Full=Leucyl-tRNA synthetase;       
    3::876       0.0  47%  876 aa  SYL_AGRT5 RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  46%  835 aa  SYL_RICCN RecName: Full=Leucyl-tRNA synthetase;       
    4::875       0.0  47%  876 aa  SYL_METSB RecName: Full=Leucyl-tRNA synthetase;       
    2::838       0.0  49%  838 aa  SYL_WOLPM RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  46%  835 aa  SYL_RICM5 RecName: Full=Leucyl-tRNA synthetase;       
    2::819       0.0  49%  819 aa  SYL_WOLPP RecName: Full=Leucyl-tRNA synthetase;       
    2::838       0.0  48%  838 aa  SYL_ORITB RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  45%  835 aa  SYL_RICAE RecName: Full=Leucyl-tRNA synthetase;       
    9::863       0.0  48%  865 aa  SYL_GLUOX RecName: Full=Leucyl-tRNA synthetase;       
   40::862       0.0  48%  864 aa  SYL_ACICJ RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  46%  835 aa  SYL_RICFE RecName: Full=Leucyl-tRNA synthetase;       
    4::835       0.0  45%  835 aa  SYL_RICPU RecName: Full=Leucyl-tRNA synthetase;       
    2::838       0.0  49%  838 aa  SYL_WOLWR RecName: Full=Leucyl-tRNA synthetase;       
    4::876       0.0  47%  876 aa  SYL_RHILW RecName: Full=Leucyl-tRNA synthetase;       
   12::847       0.0  47%  848 aa  SYL_NOVAD RecName: Full=Leucyl-tRNA synthetase;       
    4::840       0.0  48%  874 aa  SYL_BRAJA RecName: Full=Leucyl-tRNA synthetase;       
    6::848       0.0  47%  849 aa  SYL_SPHAL RecName: Full=Leucyl-tRNA synthetase;       
    1::873       0.0  46%  873 aa  SYL_RHOS5 RecName: Full=Leucyl-tRNA synthetase;       
    3::825       0.0  48%  829 aa  SYL_EHRCJ RecName: Full=Leucyl-tRNA synthetase;       
    4::863       0.0  46%  876 aa  SYL_RHOPT RecName: Full=Leucyl-tRNA synthetase;       
    1::835       0.0  48%  848 aa  SYL_ROSDO RecName: Full=Leucyl-tRNA synthetase;       
    1::847       0.0  47%  847 aa  SYL_RHOSK RecName: Full=Leucyl-tRNA synthetase;       
    4::834       0.0  45%  834 aa  SYL_RICCK RecName: Full=Leucyl-tRNA synthetase;       
    1::847       0.0  46%  847 aa  SYL_RHOS1 RecName: Full=Leucyl-tRNA synthetase;       
    1::729       0.0  50%  865 aa  SYL_RHOCS RecName: Full=Leucyl-tRNA synthetase;       
    2::864       0.0  49%  865 aa  SYL_WOLTR RecName: Full=Leucyl-tRNA synthetase;       
    1::847       0.0  46%  847 aa  SYL_RHOS4 RecName: Full=Leucyl-tRNA synthetase;       
    4::863       0.0  46%  876 aa  SYL_RHOPA RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  49%  861 aa  SYL_CAUSK RecName: Full=Leucyl-tRNA synthetase;       
    4::888       0.0  45%  888 aa  SYL_RHOP5 RecName: Full=Leucyl-tRNA synthetase;       
    5::850       0.0  47%  867 aa  SYL_PHEZH RecName: Full=Leucyl-tRNA synthetase;       
    4::865       0.0  46%  878 aa  SYL_RHOPS RecName: Full=Leucyl-tRNA synthetase;       
    4::861       0.0  46%  874 aa  SYL_RHOP2 RecName: Full=Leucyl-tRNA synthetase;       
   22::812       0.0  48%  831 aa  SYL_RICBR RecName: Full=Leucyl-tRNA synthetase;       
    3::824       0.0  48%  829 aa  SYL_EHRCR RecName: Full=Leucyl-tRNA synthetase;       
    4::869       0.0  45%  870 aa  SYL_RICAH RecName: Full=Leucyl-tRNA synthetase;       
    1::844       0.0  49%  857 aa  SYL_SILST RecName: Full=Leucyl-tRNA synthetase;       
    3::855       0.0  45%  857 aa  SYL_VIBPA RecName: Full=Leucyl-tRNA synthetase;       
    8::827       0.0  47%  829 aa  SYL_ANAMM RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  858 aa  SYL_IDILO RecName: Full=Leucyl-tRNA synthetase;       
    4::865       0.0  44%  867 aa  SYL_ALTMD RecName: Full=Leucyl-tRNA synthetase;       
    1::839       0.0  49%  852 aa  SYL_SILPO RecName: Full=Leucyl-tRNA synthetase;       
   18::828       0.0  46%  828 aa  SYL_RICTY RecName: Full=Leucyl-tRNA synthetase;       
    3::826       0.0  46%  830 aa  SYL_EHRRG RecName: Full=Leucyl-tRNA synthetase;       
    3::855       0.0  45%  857 aa  SYL_VIBVU RecName: Full=Leucyl-tRNA synthetase;       
    3::860       0.0  44%  862 aa  SYL_VIBHB RecName: Full=Leucyl-tRNA synthetase;       
    3::855       0.0  45%  857 aa  SYL_VIBVY RecName: Full=Leucyl-tRNA synthetase;       
   18::828       0.0  45%  828 aa  SYL_RICPR RecName: Full=Leucyl-tRNA synthetase;       
    4::834       0.0  48%  835 aa  SYL_SPHWW RecName: Full=Leucyl-tRNA synthetase;       
    3::826       0.0  46%  830 aa  SYL_EHRRW RecName: Full=Leucyl-tRNA synthetase;       
    3::813       0.0  47%  815 aa  SYL_MARMS RecName: Full=Leucyl-tRNA synthetase;       
   13::875       0.0  45%  877 aa  SYL_THICR RecName: Full=Leucyl-tRNA synthetase;       
    3::860       0.0  44%  862 aa  SYL_PSEHT RecName: Full=Leucyl-tRNA synthetase;       
    3::823       0.0  47%  824 aa  SYL_GEOUR RecName: Full=Leucyl-tRNA synthetase;       
    1::826       0.0  47%  831 aa  SYL_NEOSM RecName: Full=Leucyl-tRNA synthetase;       
    3::862       0.0  45%  864 aa  SYL_CELJU RecName: Full=Leucyl-tRNA synthetase;       
    9::833       0.0  47%  844 aa  SYL_PARDP RecName: Full=Leucyl-tRNA synthetase;       
    3::823       0.0  46%  824 aa  SYL_GEOMG RecName: Full=Leucyl-tRNA synthetase;       
    3::816       0.0  47%  817 aa  SYL_CALS8 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  43%  861 aa  SYL_MARAV RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  43%  858 aa  SYL_VIBSL RecName: Full=Leucyl-tRNA synthetase;       
    4::813       0.0  46%  815 aa  SYL_ALCBS RecName: Full=Leucyl-tRNA synthetase;       
    4::857       0.0  44%  859 aa  SYL_MAGSM RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  44%  858 aa  SYL_VIBF1 RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  43%  858 aa  SYL_VIBFM RecName: Full=Leucyl-tRNA synthetase;       
    5::857       0.0  43%  859 aa  SYL_PSYIN RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  43%  858 aa  SYL_PHOPR RecName: Full=Leucyl-tRNA synthetase;       
    3::823       0.0  47%  824 aa  SYL_GEOSM RecName: Full=Leucyl-tRNA synthetase;       
    1::863       0.0  44%  863 aa  SYL_JANSC RecName: Full=Leucyl-tRNA synthetase;       
    3::849       0.0  45%  863 aa  SYL_DESAA RecName: Full=Leucyl-tRNA synthetase;       
    5::842       0.0  44%  861 aa  SYL_HAHCH RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  48%  813 aa  SYL_FRATN RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  43%  858 aa  SYL_ALISL RecName: Full=Leucyl-tRNA synthetase;       
    3::823       0.0  46%  824 aa  SYL_GEOSL RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRATT RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRAT1 RecName: Full=Leucyl-tRNA synthetase;       
    3::823       0.0  47%  824 aa  SYL_GEOBB RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRATW RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRATO RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRATH RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRATF RecName: Full=Leucyl-tRNA synthetase;       
    1::818       0.0  46%  819 aa  SYL_FERNB RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  46%  824 aa  SYL_ALKMQ RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRATM RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHESR RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHESM RecName: Full=Leucyl-tRNA synthetase;       
    5::861       0.0  44%  863 aa  SYL_SHEFN RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHEB9 RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHESA RecName: Full=Leucyl-tRNA synthetase;       
   12::862       0.0  44%  862 aa  SYL_PROMT RecName: Full=Leucyl-tRNA synthetase;       
    1::822       0.0  46%  824 aa  SYL_SYNWW RecName: Full=Leucyl-tRNA synthetase;       
    5::861       0.0  44%  863 aa  SYL_SHEDO RecName: Full=Leucyl-tRNA synthetase;       
    3::819       0.0  46%  821 aa  SYL_CARHZ RecName: Full=Leucyl-tRNA synthetase;       
    3::823       0.0  46%  824 aa  SYL_GEOSF RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHEB8 RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHEB5 RecName: Full=Leucyl-tRNA synthetase;       
    4::854       0.0  43%  856 aa  SYL_CHRSD RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHEB2 RecName: Full=Leucyl-tRNA synthetase;       
    3::816       0.0  47%  863 aa  SYL_DESAH RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHEON RecName: Full=Leucyl-tRNA synthetase;       
    5::861       0.0  43%  863 aa  SYL_COLP3 RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHEPC RecName: Full=Leucyl-tRNA synthetase;       
    4::854       0.0  43%  856 aa  SYL_CYAP8 RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  43%  859 aa  SYL_AERHH RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  44%  859 aa  SYL_SHESW RecName: Full=Leucyl-tRNA synthetase;       
    5::829       0.0  46%  830 aa  SYL_HALOH RecName: Full=Leucyl-tRNA synthetase;       
    4::816       0.0  44%  817 aa  SYL_METFK RecName: Full=Leucyl-tRNA synthetase;       
    4::822       0.0  45%  823 aa  SYL_PELPD RecName: Full=Leucyl-tRNA synthetase;       
   13::869       0.0  45%  869 aa  SYL_DINSH RecName: Full=Leucyl-tRNA synthetase;       
    6::868       0.0  42%  870 aa  SYL_PSEA6 RecName: Full=Leucyl-tRNA synthetase;       
   24::864       0.0  44%  864 aa  SYL_PROM5 RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  43%  859 aa  SYL_SHEAM RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  42%  859 aa  SYL_SHEPA RecName: Full=Leucyl-tRNA synthetase;       
   15::856       0.0  46%  856 aa  SYL_PROMS RecName: Full=Leucyl-tRNA synthetase;       
    1::822       0.0  45%  823 aa  SYL_THEM4 RecName: Full=Leucyl-tRNA synthetase;       
    3::868       0.0  43%  868 aa  SYL_NITEC RecName: Full=Leucyl-tRNA synthetase;       
    3::873       0.0  43%  873 aa  SYL_AZOSE RecName: Full=Leucyl-tRNA synthetase;       
    3::845       0.0  46%  846 aa  SYL_HELMI RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  43%  858 aa  SYL_VIBC3 RecName: Full=Leucyl-tRNA synthetase;       
    4::851       0.0  44%  853 aa  SYL_CYAA5 RecName: Full=Leucyl-tRNA synthetase;       
    3::824       0.0  46%  825 aa  SYL_CLOTH RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  43%  858 aa  SYL_VIBCH RecName: Full=Leucyl-tRNA synthetase;       
    4::860       0.0  43%  862 aa  SYL_SYNAS RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  42%  866 aa  SYL_NITMU RecName: Full=Leucyl-tRNA synthetase;       
    3::861       0.0  43%  863 aa  SYL_SHESH RecName: Full=Leucyl-tRNA synthetase;       
    5::866       0.0  44%  868 aa  SYL_PSESM RecName: Full=Leucyl-tRNA synthetase;       
    8::807       0.0  45%  827 aa  SYL_DESPS RecName: Full=Leucyl-tRNA synthetase;       
    3::826       0.0  45%  827 aa  SYL_DESHY RecName: Full=Leucyl-tRNA synthetase;       
    3::826       0.0  45%  827 aa  SYL_DESHD RecName: Full=Leucyl-tRNA synthetase;       
   12::862       0.0  43%  862 aa  SYL_PROM1 RecName: Full=Leucyl-tRNA synthetase;       
    5::817       0.0  46%  819 aa  SYL_SACD2 RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  42%  868 aa  SYL_PSEPG RecName: Full=Leucyl-tRNA synthetase;       
   15::856       0.0  43%  856 aa  SYL_PROM0 RecName: Full=Leucyl-tRNA synthetase;       
    3::869       0.0  42%  869 aa  SYL_NITEU RecName: Full=Leucyl-tRNA synthetase;       
    3::858       0.0  42%  860 aa  SYL_ACTSZ RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  43%  859 aa  SYL_SHEWM RecName: Full=Leucyl-tRNA synthetase;       
    1::812       0.0  46%  813 aa  SYL_FRAP2 RecName: Full=Leucyl-tRNA synthetase;       
    3::858       0.0  41%  860 aa  SYL_MANSM RecName: Full=Leucyl-tRNA synthetase;       
    5::852       0.0  43%  854 aa  SYL_CYAP7 RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  45%  859 aa  SYL_FUSNN RecName: Full=Leucyl-tRNA synthetase;       
    3::856       0.0  42%  858 aa  SYL_AERS4 RecName: Full=Leucyl-tRNA synthetase;       
    5::868       0.0  42%  869 aa  SYL_SYNY3 RecName: Full=Leucyl-tRNA synthetase;       
    4::871       0.0  43%  872 aa  SYL_ANAVT RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  43%  868 aa  SYL_PSEPK RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  43%  868 aa  SYL_PSEP1 RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  42%  868 aa  SYL_PSEFS RecName: Full=Leucyl-tRNA synthetase;       
   15::842       0.0  44%  858 aa  SYL_PROMP RecName: Full=Leucyl-tRNA synthetase;       
    3::826       0.0  45%  827 aa  SYL_DESRM RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  44%  815 aa  SYL_THELT RecName: Full=Leucyl-tRNA synthetase;       
    4::871       0.0  43%  872 aa  SYL_ANASP RecName: Full=Leucyl-tRNA synthetase;       
    4::795       0.0  46%  829 aa  SYL_MOOTA RecName: Full=Leucyl-tRNA synthetase;       
    3::886       0.0  43%  887 aa  SYL_METCA RecName: Full=Leucyl-tRNA synthetase;       
    5::781       0.0  46%  816 aa  SYL_RUTMC RecName: Full=Leucyl-tRNA synthetase;       
    3::873       0.0  43%  873 aa  SYL_AZOSB RecName: Full=Leucyl-tRNA synthetase;       
   17::864       0.0  42%  867 aa  SYL_SYNS3 RecName: Full=Leucyl-tRNA synthetase;       
    3::858       0.0  42%  860 aa  SYL_HAES2 RecName: Full=Leucyl-tRNA synthetase;       
    4::850       0.0  42%  852 aa  SYL_SYNP2 RecName: Full=Leucyl-tRNA synthetase;       
   15::839       0.0  44%  856 aa  SYL_PROM2 RecName: Full=Leucyl-tRNA synthetase;       
    3::858       0.0  42%  860 aa  SYL_HAES1 RecName: Full=Leucyl-tRNA synthetase;       
    4::846       0.0  43%  847 aa  SYL_GLOVI RecName: Full=Leucyl-tRNA synthetase;       
    3::857       0.0  42%  859 aa  SYL_SHEHH RecName: Full=Leucyl-tRNA synthetase;       
    1::805       0.0  45%  806 aa  SYL_CLOD6 RecName: Full=Leucyl-tRNA synthetase;       
    5::866       0.0  43%  868 aa  SYL_PSE14 RecName: Full=Leucyl-tRNA synthetase;       
   15::856       0.0  44%  856 aa  SYL_PROM9 RecName: Full=Leucyl-tRNA synthetase;       
    4::855       0.0  43%  858 aa  SYL_CYAP4 RecName: Full=Leucyl-tRNA synthetase;       
    4::870       0.0  43%  871 aa  SYL_NOSP7 RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  42%  868 aa  SYL_PSEU5 RecName: Full=Leucyl-tRNA synthetase;       
    5::866       0.0  42%  868 aa  SYL_PSEU2 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SHIFL RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  41%  868 aa  SYL_PSEF5 RecName: Full=Leucyl-tRNA synthetase;       
    5::827       0.0  46%  828 aa  SYL_PETMO RecName: Full=Leucyl-tRNA synthetase;       
    3::869       0.0  43%  870 aa  SYL_DECAR RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SHIDS RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  42%  868 aa  SYL_PSEPW RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOLI RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOLC RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOBW RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO5E RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO57 RecName: Full=Leucyl-tRNA synthetase;       
   30::883       0.0  42%  884 aa  SYL_SYNS9 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  861 aa  SYL_HAEIE RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ESCF3 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOSM RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOSE RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO8A RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO55 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  861 aa  SYL_HAEI8 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOUT RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOK1 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO45 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SHISS RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SHIBS RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SHIB3 RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  42%  868 aa  SYL_PSEE4 RecName: Full=Leucyl-tRNA synthetase;       
   24::818       0.0  44%  819 aa  SYL_NITOC RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  43%  866 aa  SYL_LARHH RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO7I RecName: Full=Leucyl-tRNA synthetase;       
    4::856       0.0  41%  857 aa  SYL_SYNPX RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOHS RecName: Full=Leucyl-tRNA synthetase;       
    9::878       0.0  41%  880 aa  SYL_XANC5 RecName: Full=Leucyl-tRNA synthetase;       
    3::826       0.0  45%  827 aa  SYL_PELTS RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOL6 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOL5 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO81 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO27 RecName: Full=Leucyl-tRNA synthetase;       
    3::876       0.0  43%  876 aa  SYL_NEIG1 RecName: Full=Leucyl-tRNA synthetase;       
    3::876       0.0  43%  876 aa  SYL_NEIM0 RecName: Full=Leucyl-tRNA synthetase;       
    3::876       0.0  43%  876 aa  SYL_NEIG2 RecName: Full=Leucyl-tRNA synthetase;       
   22::874       0.0  41%  875 aa  SYL_SYNSC RecName: Full=Leucyl-tRNA synthetase;       
    9::877       0.0  41%  879 aa  SYL_XANC8 RecName: Full=Leucyl-tRNA synthetase;       
   31::824       0.0  45%  824 aa  SYL_THEP1 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SHIF8 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  42%  860 aa  SYL_SERP5 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  861 aa  SYL_HAEIN RecName: Full=Leucyl-tRNA synthetase;       
    9::878       0.0  41%  880 aa  SYL_XANAC RecName: Full=Leucyl-tRNA synthetase;       
   31::824       0.0  45%  824 aa  SYL_THEMA RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  861 aa  SYL_HAEIG RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECO24 RecName: Full=Leucyl-tRNA synthetase;       
    4::882       0.0  42%  882 aa  SYL_SYNJB RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ECOLU RecName: Full=Leucyl-tRNA synthetase;       
    9::883       0.0  41%  885 aa  SYL_XANCB RecName: Full=Leucyl-tRNA synthetase;       
    5::859       0.0  42%  860 aa  SYL_SODGM RecName: Full=Leucyl-tRNA synthetase;       
    3::861       0.0  42%  863 aa  SYL_SHELP RecName: Full=Leucyl-tRNA synthetase;       
    4::856       0.0  41%  861 aa  SYL_ACTPJ RecName: Full=Leucyl-tRNA synthetase;       
    4::856       0.0  41%  861 aa  SYL_ACTP2 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_CITK8 RecName: Full=Leucyl-tRNA synthetase;       
    9::878       0.0  41%  880 aa  SYL_XANOR RecName: Full=Leucyl-tRNA synthetase;       
    9::878       0.0  41%  880 aa  SYL_XANOP RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALAR RecName: Full=Leucyl-tRNA synthetase;       
    4::859       0.0  41%  861 aa  SYL_HAEDU RecName: Full=Leucyl-tRNA synthetase;       
    9::878       0.0  41%  880 aa  SYL_XANOM RecName: Full=Leucyl-tRNA synthetase;       
    3::876       0.0  43%  876 aa  SYL_NEIMF RecName: Full=Leucyl-tRNA synthetase;       
    3::876       0.0  43%  876 aa  SYL_NEIMB RecName: Full=Leucyl-tRNA synthetase;       
   16::871       0.0  43%  872 aa  SYL_PROM4 RecName: Full=Leucyl-tRNA synthetase;       
    8::877       0.0  41%  879 aa  SYL_XYLFA RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALSV RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALPK RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALPB RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALPA RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALCH RecName: Full=Leucyl-tRNA synthetase;       
    5::822       0.0  45%  823 aa  SYL_LEGPH RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ERWCT RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPS RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPP RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPN RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPE RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPB RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPA RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERP3 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALTY RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALPC RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALNS RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALHS RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALDC RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALA4 RecName: Full=Leucyl-tRNA synthetase;       
    5::822       0.0  45%  823 aa  SYL_LEGPL RecName: Full=Leucyl-tRNA synthetase;       
    5::822       0.0  45%  823 aa  SYL_LEGPA RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPY RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERPG RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALTI RecName: Full=Leucyl-tRNA synthetase;       
    3::866       0.0  40%  868 aa  SYL_PSEPF RecName: Full=Leucyl-tRNA synthetase;       
    5::822       0.0  44%  823 aa  SYL_LEGPC RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALEP RecName: Full=Leucyl-tRNA synthetase;       
    3::868       0.0  41%  870 aa  SYL_PSEMY RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_ERWT9 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_YERE8 RecName: Full=Leucyl-tRNA synthetase;       
    3::831       0.0  42%  851 aa  SYL_PELCD RecName: Full=Leucyl-tRNA synthetase;       
    8::877       0.0  41%  879 aa  SYL_XYLFT RecName: Full=Leucyl-tRNA synthetase;       
    8::877       0.0  41%  879 aa  SYL_XYLFM RecName: Full=Leucyl-tRNA synthetase;       
    8::877       0.0  41%  879 aa  SYL_XYLF2 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_SALG2 RecName: Full=Leucyl-tRNA synthetase;       
    3::802       0.0  45%  820 aa  SYL_COXBU RecName: Full=Leucyl-tRNA synthetase;       
    3::802       0.0  45%  820 aa  SYL_COXBN RecName: Full=Leucyl-tRNA synthetase;       
    3::802       0.0  45%  820 aa  SYL_COXB1 RecName: Full=Leucyl-tRNA synthetase;       
    3::802       0.0  45%  820 aa  SYL_COXB2 RecName: Full=Leucyl-tRNA synthetase;       
    1::824       0.0  43%  826 aa  SYL_NATTJ RecName: Full=Leucyl-tRNA synthetase;       
    3::802       0.0  45%  820 aa  SYL_COXBR RecName: Full=Leucyl-tRNA synthetase;       
    5::889       0.0  44%  890 aa  SYL_POLSQ RecName: Full=Leucyl-tRNA synthetase;       
    3::864       0.0  41%  864 aa  SYL_BURP8 RecName: Full=Leucyl-tRNA synthetase;       
   24::865       0.0  42%  867 aa  SYL_DICNV RecName: Full=Leucyl-tRNA synthetase;       
   10::874       0.0  42%  874 aa  SYL_ACIBY RecName: Full=Leucyl-tRNA synthetase;       
   10::874       0.0  42%  874 aa  SYL_ACIBC RecName: Full=Leucyl-tRNA synthetase;       
   10::874       0.0  42%  874 aa  SYL_ACIB5 RecName: Full=Leucyl-tRNA synthetase;       
   10::874       0.0  42%  874 aa  SYL_ACIBS RecName: Full=Leucyl-tRNA synthetase;       
    3::871       0.0  41%  873 aa  SYL_PSEAE RecName: Full=Leucyl-tRNA synthetase;       
    3::871       0.0  41%  873 aa  SYL_PSEA8 RecName: Full=Leucyl-tRNA synthetase;       
   10::874       0.0  42%  874 aa  SYL_ACIB3 RecName: Full=Leucyl-tRNA synthetase;       
    4::853       0.0  41%  855 aa  SYL_ACAM1 RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_KLEP7 RecName: Full=Leucyl-tRNA synthetase;       
    3::871       0.0  41%  873 aa  SYL_PSEAB RecName: Full=Leucyl-tRNA synthetase;       
    3::850       0.0  42%  863 aa  SYL_BURXL RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  41%  860 aa  SYL_KLEP3 RecName: Full=Leucyl-tRNA synthetase;       
   20::862       0.0  40%  865 aa  SYL_SYNE7 RecName: Full=Leucyl-tRNA synthetase;       
   17::877       0.0  42%  878 aa  SYL_PROM3 RecName: Full=Leucyl-tRNA synthetase;       
    3::910       0.0  43%  910 aa  SYL_NEIMA RecName: Full=Leucyl-tRNA synthetase;       
   10::873       0.0  41%  873 aa  SYL_ACIAD RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  40%  860 aa  SYL_PHOLL RecName: Full=Leucyl-tRNA synthetase;       
    3::859       0.0  40%  860 aa  SYL_ENTS8 RecName: Full=Leucyl-tRNA synthetase;       
    3::858       0.0  41%  860 aa  SYL_PASMU RecName: Full=Leucyl-tRNA synthetase;       
    3::856     e-180  41%  857 aa  SYL_THIDA RecName: Full=Leucyl-tRNA synthetase;       
   20::862     e-180  40%  865 aa  SYL_SYNP6 RecName: Full=Leucyl-tRNA synthetase;       
    3::871     e-180  41%  873 aa  SYL_PSEA7 RecName: Full=Leucyl-tRNA synthetase;       
   18::876     e-180  40%  878 aa  SYL_SYNPW RecName: Full=Leucyl-tRNA synthetase;       
    3::820     e-180  45%  822 aa  SYL_SULDN RecName: Full=Leucyl-tRNA synthetase;       
   17::877     e-180  42%  878 aa  SYL_PROMM RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-180  41%  864 aa  SYL_BURVG RecName: Full=Leucyl-tRNA synthetase;       
    2::828     e-180  44%  829 aa  SYL_DESVH RecName: Full=Leucyl-tRNA synthetase;       
    2::828     e-180  44%  829 aa  SYL_DESVV RecName: Full=Leucyl-tRNA synthetase;       
    5::862     e-180  41%  864 aa  SYL_ALHEH RecName: Full=Leucyl-tRNA synthetase;       
    7::818     e-179  44%  835 aa  SYL_LAWIP RecName: Full=Leucyl-tRNA synthetase;       
    3::859     e-179  41%  860 aa  SYL_EDWI9 RecName: Full=Leucyl-tRNA synthetase;       
    3::859     e-179  39%  860 aa  SYL_PROMH RecName: Full=Leucyl-tRNA synthetase;       
    3::852     e-179  42%  853 aa  SYL_BRAHW RecName: Full=Leucyl-tRNA synthetase;       
    7::863     e-179  41%  864 aa  SYL_SYNR3 RecName: Full=Leucyl-tRNA synthetase;       
    2::827     e-179  42%  829 aa  SYL_DESDG RecName: Full=Leucyl-tRNA synthetase;       
    3::859     e-178  41%  860 aa  SYL_PECCP RecName: Full=Leucyl-tRNA synthetase;       
   29::872     e-178  42%  872 aa  SYL_CHRVO RecName: Full=Leucyl-tRNA synthetase;       
   12::883     e-178  44%  885 aa  SYL_PSYWF RecName: Full=Leucyl-tRNA synthetase;       
   41::919     e-178  43%  921 aa  SYL_PSYA2 RecName: Full=Leucyl-tRNA synthetase;       
    5::889     e-178  42%  890 aa  SYL_POLNS RecName: Full=Leucyl-tRNA synthetase;       
   44::917     e-178  42%  919 aa  SYL_PSYCK RecName: Full=Leucyl-tRNA synthetase;       
   24::815     e-178  43%  817 aa  SYL_HALHL RecName: Full=Leucyl-tRNA synthetase;       
    4::722     e-177  47%  929 aa  SYL_TRIEI RecName: Full=Leucyl-tRNA synthetase;       
    3::850     e-177  41%  869 aa  SYL_HAMD5 RecName: Full=Leucyl-tRNA synthetase;       
   10::904     e-177  41%  904 aa  SYL_ROSS1 RecName: Full=Leucyl-tRNA synthetase;       
    4::873     e-177  41%  873 aa  SYL_SYNJA RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-177  41%  864 aa  SYL_BURCH RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-177  41%  864 aa  SYL_BURCC RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-177  41%  864 aa  SYL_BURCA RecName: Full=Leucyl-tRNA synthetase;       
    3::868     e-177  41%  870 aa  SYL_AZOVD RecName: Full=Leucyl-tRNA synthetase;       
    4::809     e-177  44%  829 aa  SYL_SYNFM RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-177  41%  864 aa  SYL_BURCJ RecName: Full=Leucyl-tRNA synthetase;       
    6::819     e-177  44%  821 aa  SYL_CAMC1 RecName: Full=Leucyl-tRNA synthetase;       
    3::853     e-176  41%  857 aa  SYL_THEEB RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-176  42%  864 aa  SYL_BURTA RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-176  42%  864 aa  SYL_BURM9 RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-176  42%  864 aa  SYL_BURM7 RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-176  42%  864 aa  SYL_BURMS RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-176  42%  864 aa  SYL_BURMA RecName: Full=Leucyl-tRNA synthetase;       
    4::676     e-175  46%  834 aa  SYL_ACTP7 RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-175  42%  864 aa  SYL_BURPS RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-175  42%  864 aa  SYL_BURP0 RecName: Full=Leucyl-tRNA synthetase;       
    9::878     e-175  39%  880 aa  SYL_STRMK RecName: Full=Leucyl-tRNA synthetase;       
    3::892     e-175  41%  892 aa  SYL_RHOFD RecName: Full=Leucyl-tRNA synthetase;       
    3::893     e-175  40%  894 aa  SYL_ENT38 RecName: Full=Leucyl-tRNA synthetase;       
    9::788     e-174  43%  816 aa  SYL_XANCP RecName: Full=Leucyl-tRNA synthetase;       
    2::813     e-174  43%  815 aa  SYL_NITSB RecName: Full=Leucyl-tRNA synthetase;       
    3::910     e-174  41%  910 aa  SYL_DIAST RecName: Full=Leucyl-tRNA synthetase;       
   29::876     e-174  41%  876 aa  SYL_VARPS RecName: Full=Leucyl-tRNA synthetase;       
    3::880     e-174  42%  881 aa  SYL_HERAR RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-174  40%  864 aa  SYL_BURS3 RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-174  40%  864 aa  SYL_BURA4 RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-174  41%  864 aa  SYL_BURP6 RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-174  41%  864 aa  SYL_BURP1 RecName: Full=Leucyl-tRNA synthetase;       
    2::833     e-174  43%  834 aa  SYL_DESVM RecName: Full=Leucyl-tRNA synthetase;       
   41::880     e-174  42%  881 aa  SYL_JANMA RecName: Full=Leucyl-tRNA synthetase;       
    5::860     e-174  40%  861 aa  SYL_BAUCH RecName: Full=Leucyl-tRNA synthetase;       
    3::825     e-173  42%  826 aa  SYL_DESAP RecName: Full=Leucyl-tRNA synthetase;       
    9::879     e-173  39%  880 aa  SYL_STRM5 RecName: Full=Leucyl-tRNA synthetase;       
    3::876     e-173  43%  877 aa  SYL_RALPJ RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-173  40%  864 aa  SYL_BURCM RecName: Full=Leucyl-tRNA synthetase;       
    3::864     e-173  40%  864 aa  SYL_BURM1 RecName: Full=Leucyl-tRNA synthetase;       
    3::910     e-172  41%  910 aa  SYL_ACISJ RecName: Full=Leucyl-tRNA synthetase;       
    3::888     e-172  41%  888 aa  SYL_POLNA RecName: Full=Leucyl-tRNA synthetase;       
   17::836     e-172  42%  870 aa  SYL_PROMA RecName: Full=Leucyl-tRNA synthetase;       
    3::875     e-172  41%  897 aa  SYL_ACIAC RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-171  40%  833 aa  SYL_STRP4 RecName: Full=Leucyl-tRNA synthetase;       
   38::884     e-171  41%  885 aa  SYL_BORA1 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-171  40%  833 aa  SYL_STRPI RecName: Full=Leucyl-tRNA synthetase;       
    4::859     e-171  42%  861 aa  SYL_SYMTH RecName: Full=Leucyl-tRNA synthetase;       
    4::785     e-170  43%  815 aa  SYL_VESOH RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-170  41%  804 aa  SYL_ENTFA RecName: Full=Leucyl-tRNA synthetase;       
    5::829     e-170  43%  830 aa  SYL_HELHP RecName: Full=Leucyl-tRNA synthetase;       
    3::819     e-170  43%  821 aa  SYL_ARCB4 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRZT RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRPN RecName: Full=Leucyl-tRNA synthetase;       
    3::911     e-169  41%  911 aa  SYL_DELAS RecName: Full=Leucyl-tRNA synthetase;       
    3::884     e-169  40%  885 aa  SYL_BORPA RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  39%  833 aa  SYL_STRTD RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  39%  833 aa  SYL_STRT2 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  39%  833 aa  SYL_STRT1 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRP7 RecName: Full=Leucyl-tRNA synthetase;       
   17::883     e-169  41%  904 aa  SYL_ROSCS RecName: Full=Leucyl-tRNA synthetase;       
    3::884     e-169  40%  885 aa  SYL_BORBR RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRPS RecName: Full=Leucyl-tRNA synthetase;       
   36::854     e-169  44%  897 aa  SYL_METPP RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRZP RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRZJ RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRPJ RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRR6 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-169  40%  833 aa  SYL_STRP2 RecName: Full=Leucyl-tRNA synthetase;       
    2::804     e-169  45%  806 aa  SYL_HELPJ RecName: Full=Leucyl-tRNA synthetase;       
    3::766     e-168  45%  817 aa  SYL_THISH RecName: Full=Leucyl-tRNA synthetase;       
    3::809     e-168  44%  811 aa  SYL_CAMFF RecName: Full=Leucyl-tRNA synthetase;       
    2::805     e-168  44%  806 aa  SYL_HELPY RecName: Full=Leucyl-tRNA synthetase;       
    6::795     e-168  44%  821 aa  SYL_CAMC5 RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-167  41%  804 aa  SYL_BACP2 RecName: Full=Leucyl-tRNA synthetase;       
    3::783     e-167  42%  805 aa  SYL_LACF3 RecName: Full=Leucyl-tRNA synthetase;       
    3::830     e-167  42%  873 aa  SYL_RALME RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-167  42%  802 aa  SYL_BACWK RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-167  41%  805 aa  SYL_ANOFW RecName: Full=Leucyl-tRNA synthetase;       
    3::884     e-167  40%  885 aa  SYL_BORPE RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-166  41%  804 aa  SYL_STAES RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-166  41%  804 aa  SYL_STAEQ RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-166  41%  805 aa  SYL_GEOTN RecName: Full=Leucyl-tRNA synthetase;       
   38::887     e-166  40%  887 aa  SYL_LEPCP RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-166  41%  802 aa  SYL_BACCN RecName: Full=Leucyl-tRNA synthetase;       
    3::828     e-166  39%  829 aa  SYL_LACLM RecName: Full=Leucyl-tRNA synthetase;       
    3::828     e-166  39%  829 aa  SYL_LACLA RecName: Full=Leucyl-tRNA synthetase;       
    2::805     e-166  43%  806 aa  SYL_HELAH RecName: Full=Leucyl-tRNA synthetase;       
    8::861     e-166  41%  861 aa  SYL_BUCBP RecName: Full=Leucyl-tRNA synthetase;       
    3::805     e-165  40%  807 aa  SYL_LACSS RecName: Full=Leucyl-tRNA synthetase;       
    3::857     e-165  39%  858 aa  SYL_TREDE RecName: Full=Leucyl-tRNA synthetase;       
   38::884     e-165  40%  885 aa  SYL_BORPD RecName: Full=Leucyl-tRNA synthetase;       
    3::804     e-165  40%  806 aa  SYL_BACHD RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-165  38%  833 aa  SYL_STRU0 RecName: Full=Leucyl-tRNA synthetase;       
    3::886     e-165  40%  886 aa  SYL_POLSJ RecName: Full=Leucyl-tRNA synthetase;       
    3::906     e-165  40%  907 aa  SYL_VEREI RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-165  40%  804 aa  SYL_OCEIH RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-165  38%  833 aa  SYL_STRP3 RecName: Full=Leucyl-tRNA synthetase;       
   38::876     e-165  41%  877 aa  SYL_RALSO RecName: Full=Leucyl-tRNA synthetase;       
    2::805     e-165  44%  806 aa  SYL_HELPH RecName: Full=Leucyl-tRNA synthetase;       
    2::812     e-165  43%  813 aa  SYL_CAMHC RecName: Full=Leucyl-tRNA synthetase;       
    3::806     e-164  38%  808 aa  SYL_LACPL RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACHK RecName: Full=Leucyl-tRNA synthetase;       
    5::870     e-164  40%  872 aa  SYL_BLOPB RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-164  39%  833 aa  SYL_STRGC RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-164  41%  805 aa  SYL_GEOSW RecName: Full=Leucyl-tRNA synthetase;       
    8::828     e-164  39%  861 aa  SYL_BUCAP RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACCZ RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACC3 RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACC0 RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACAN RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACAH RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACAC RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  42%  802 aa  SYL_BACAA RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  41%  802 aa  SYL_BACCQ RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  41%  802 aa  SYL_BACC7 RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-164  41%  802 aa  SYL_BACC1 RecName: Full=Leucyl-tRNA synthetase;       
   22::808     e-163  44%  809 aa  SYL_CAMLR RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-163  38%  833 aa  SYL_STRSY RecName: Full=Leucyl-tRNA synthetase;       
    3::817     e-163  42%  819 aa  SYL_WOLSU RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-163  38%  833 aa  SYL_STRS2 RecName: Full=Leucyl-tRNA synthetase;       
    1::834     e-163  39%  835 aa  SYL_ELUMP RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-163  41%  802 aa  SYL_BACCR RecName: Full=Leucyl-tRNA synthetase;       
   33::872     e-163  40%  874 aa  SYLM_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
    1::790     e-163  41%  842 aa  SYL_BORRA RecName: Full=Leucyl-tRNA synthetase;       
    1::790     e-162  41%  842 aa  SYL_BORDL RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-162  39%  833 aa  SYL_STRSV RecName: Full=Leucyl-tRNA synthetase;       
    3::828     e-162  39%  829 aa  SYL_LACLS RecName: Full=Leucyl-tRNA synthetase;       
    3::804     e-162  41%  805 aa  SYL_BREBN RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-162  41%  804 aa  SYL_STAHJ RecName: Full=Leucyl-tRNA synthetase;       
    4::832     e-162  39%  833 aa  SYL_STRMU RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-162  41%  804 aa  SYL_BACLD RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-162  40%  802 aa  SYL_BACC2 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-161  38%  833 aa  SYL_STRPZ RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-161  39%  805 aa  SYL_LACS1 RecName: Full=Leucyl-tRNA synthetase;       
    3::812     e-161  41%  813 aa  SYL_DEHE1 RecName: Full=Leucyl-tRNA synthetase;       
    3::808     e-161  43%  809 aa  SYL_CAMJ8 RecName: Full=Leucyl-tRNA synthetase;       
    3::784     e-161  40%  806 aa  SYL_LACRJ RecName: Full=Leucyl-tRNA synthetase;       
    3::784     e-161  40%  806 aa  SYL_LACRD RecName: Full=Leucyl-tRNA synthetase;       
    6::809     e-160  39%  810 aa  SYL_SOLUE RecName: Full=Leucyl-tRNA synthetase;       
    3::808     e-160  42%  809 aa  SYL_CAMJD RecName: Full=Leucyl-tRNA synthetase;       
    1::805     e-160  39%  807 aa  SYL_STAAW RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRPM RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRA5 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRA3 RecName: Full=Leucyl-tRNA synthetase;       
    3::804     e-160  39%  806 aa  SYL_STAAS RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRP6 RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-160  40%  805 aa  SYL_GEOKA RecName: Full=Leucyl-tRNA synthetase;       
    3::812     e-160  40%  813 aa  SYL_DEHSC RecName: Full=Leucyl-tRNA synthetase;       
    1::812     e-160  40%  840 aa  SYL_BORGA RecName: Full=Leucyl-tRNA synthetase;       
   10::851     e-160  39%  867 aa  SYL_BLOFL RecName: Full=Leucyl-tRNA synthetase;       
   14::829     e-160  40%  830 aa  SYL_THEFY RecName: Full=Leucyl-tRNA synthetase;       
   47::924     e-160  42%  940 aa  SYLM_DICDI RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    1::832     e-160  38%  833 aa  SYL_STRA1 RecName: Full=Leucyl-tRNA synthetase;       
    3::788     e-160  41%  805 aa  SYL_PEDPA RecName: Full=Leucyl-tRNA synthetase;       
    2::819     e-160  41%  819 aa  SYL_CHLTR RecName: Full=Leucyl-tRNA synthetase;       
    1::801     e-160  41%  802 aa  SYL_ALKOO RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRPG RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRPF RecName: Full=Leucyl-tRNA synthetase;       
    2::819     e-160  41%  819 aa  SYL_CHLTA RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-160  38%  833 aa  SYL_STRP1 RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-160  40%  804 aa  SYL_STAAR RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-159  39%  804 aa  SYL_BACSU RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-159  38%  833 aa  SYL_STRPC RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-159  38%  833 aa  SYL_STRPB RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-159  38%  833 aa  SYL_STRP8 RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAA9 RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAA2 RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-159  40%  804 aa  SYL_STAAN RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-159  40%  804 aa  SYL_STAAM RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-159  40%  804 aa  SYL_STAA1 RecName: Full=Leucyl-tRNA synthetase;       
    3::807     e-159  39%  808 aa  SYL_LEUMM RecName: Full=Leucyl-tRNA synthetase;       
    3::812     e-159  40%  813 aa  SYL_DEHSB RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-159  38%  833 aa  SYL_STRPD RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-159  40%  804 aa  SYL_STAAB RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAAT RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAAE RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAAC RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAA8 RecName: Full=Leucyl-tRNA synthetase;       
    1::803     e-159  39%  805 aa  SYL_STAA3 RecName: Full=Leucyl-tRNA synthetase;       
    2::596     e-159  52%  634 aa  SYLA_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit alpha;     
   16::821     e-159  40%  823 aa  SYL_DEIRA RecName: Full=Leucyl-tRNA synthetase;       
    5::841     e-159  40%  859 aa  SYL_BUCAI RecName: Full=Leucyl-tRNA synthetase;       
    3::782     e-159  41%  802 aa  SYL_BACC4 RecName: Full=Leucyl-tRNA synthetase;       
    2::819     e-158  40%  819 aa  SYL_CHLTB RecName: Full=Leucyl-tRNA synthetase;       
    2::819     e-158  40%  819 aa  SYL_CHLT2 RecName: Full=Leucyl-tRNA synthetase;       
    3::804     e-158  39%  805 aa  SYL_LYSSC RecName: Full=Leucyl-tRNA synthetase;       
    3::808     e-158  42%  809 aa  SYL_CAMJR RecName: Full=Leucyl-tRNA synthetase;       
    3::808     e-158  42%  809 aa  SYL_CAMJJ RecName: Full=Leucyl-tRNA synthetase;       
    3::808     e-158  42%  809 aa  SYL_CAMJE RecName: Full=Leucyl-tRNA synthetase;       
    3::801     e-158  38%  803 aa  SYL_LISIN RecName: Full=Leucyl-tRNA synthetase;       
    1::819     e-158  40%  840 aa  SYL_BORAP RecName: Full=Leucyl-tRNA synthetase;       
   24::841     e-157  41%  843 aa  SYL_ARTS2 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-157  38%  833 aa  SYL_STRE4 RecName: Full=Leucyl-tRNA synthetase;       
    3::830     e-157  40%  873 aa  SYL_RALEJ RecName: Full=Leucyl-tRNA synthetase;       
    1::801     e-157  39%  802 aa  SYL_FINM2 RecName: Full=Leucyl-tRNA synthetase;       
    1::832     e-157  38%  833 aa  SYL_STRS7 RecName: Full=Leucyl-tRNA synthetase;       
   12::818     e-157  39%  819 aa  SYL_DEIGD RecName: Full=Leucyl-tRNA synthetase;       
   26::882     e-156  41%  894 aa  SYLM_YEAST RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    1::832     e-156  38%  833 aa  SYL_STREM RecName: Full=Leucyl-tRNA synthetase;       
    3::801     e-156  38%  803 aa  SYL_LISMF RecName: Full=Leucyl-tRNA synthetase;       
    3::801     e-156  38%  803 aa  SYL_LISMC RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-155  39%  804 aa  SYL_STAS1 RecName: Full=Leucyl-tRNA synthetase;       
    2::844     e-155  38%  845 aa  SYL_PARUW RecName: Full=Leucyl-tRNA synthetase;       
    3::801     e-155  38%  803 aa  SYL_LISMH RecName: Full=Leucyl-tRNA synthetase;       
   32::853     e-155  41%  855 aa  SYL_KINRD RecName: Full=Leucyl-tRNA synthetase;       
   11::846     e-155  39%  851 aa  SYL_CLAM3 RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-155  38%  803 aa  SYL_LEUCK RecName: Full=Leucyl-tRNA synthetase;       
    3::799     e-155  39%  801 aa  SYL_EXIS2 RecName: Full=Leucyl-tRNA synthetase;       
    3::801     e-155  37%  803 aa  SYL_LISMO RecName: Full=Leucyl-tRNA synthetase;       
    4::813     e-155  38%  814 aa  SYL_HERA2 RecName: Full=Leucyl-tRNA synthetase;       
   26::886     e-155  40%  894 aa  SYLM_SACDO RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
   40::860     e-155  39%  862 aa  SYL_RENSM RecName: Full=Leucyl-tRNA synthetase;       
    3::800     e-154  39%  802 aa  SYL_MACCJ RecName: Full=Leucyl-tRNA synthetase;       
    1::811     e-154  42%  813 aa  SYL_CLOBL RecName: Full=Leucyl-tRNA synthetase;       
    3::802     e-154  39%  804 aa  SYL_BACA2 RecName: Full=Leucyl-tRNA synthetase;       
   25::840     e-154  41%  842 aa  SYL_ARTAT RecName: Full=Leucyl-tRNA synthetase;       
    3::801     e-154  37%  803 aa  SYL_LISW6 RecName: Full=Leucyl-tRNA synthetase;       
    1::811     e-154  41%  813 aa  SYL_CLOBH RecName: Full=Leucyl-tRNA synthetase;       
    1::811     e-154  41%  813 aa  SYL_CLOB1 RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-153  39%  804 aa  SYL_BACSK RecName: Full=Leucyl-tRNA synthetase;       
    2::820     e-153  39%  820 aa  SYL_CHLPN RecName: Full=Leucyl-tRNA synthetase;       
    2::800     e-152  38%  807 aa  SYL_CHLP8 RecName: Full=Leucyl-tRNA synthetase;       
    3::835     e-152  36%  838 aa  SYL1_RHIL3 RecName: Full=Leucyl-tRNA synthetase 1;       
   11::722     e-152  43%  852 aa  SYL_CLAMS RecName: Full=Leucyl-tRNA synthetase;       
    1::808     e-152  40%  840 aa  SYL_BORBZ RecName: Full=Leucyl-tRNA synthetase;       
    1::811     e-152  41%  812 aa  SYL_CLOAB RecName: Full=Leucyl-tRNA synthetase;       
    1::840     e-152  38%  842 aa  SYL_BORT9 RecName: Full=Leucyl-tRNA synthetase;       
    1::808     e-151  40%  840 aa  SYL_BORBU RecName: Full=Leucyl-tRNA synthetase;       
    5::781     e-151  40%  864 aa  SYL_WIGBR RecName: Full=Leucyl-tRNA synthetase;       
   32::848     e-151  39%  848 aa  SYL_NOCSJ RecName: Full=Leucyl-tRNA synthetase;       
    3::807     e-151  38%  809 aa  SYL_LACBA RecName: Full=Leucyl-tRNA synthetase;       
    2::800     e-150  38%  807 aa  SYL_CHLTE RecName: Full=Leucyl-tRNA synthetase;       
    2::803     e-150  38%  806 aa  SYL_CHLPB RecName: Full=Leucyl-tRNA synthetase;       
    2::806     e-150  39%  807 aa  SYL_MYCPU RecName: Full=Leucyl-tRNA synthetase;       
    2::820     e-150  38%  820 aa  SYL_CHLFF RecName: Full=Leucyl-tRNA synthetase;       
    2::760     e-150  40%  804 aa  SYL_LACDB RecName: Full=Leucyl-tRNA synthetase;       
    2::760     e-150  40%  804 aa  SYL_LACDA RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-149  39%  804 aa  SYL_MYCCT RecName: Full=Leucyl-tRNA synthetase;       
    2::786     e-149  39%  804 aa  SYL_LACAC RecName: Full=Leucyl-tRNA synthetase;       
    7::810     e-149  41%  812 aa  SYL_CLONN RecName: Full=Leucyl-tRNA synthetase;       
   19::832     e-149  38%  832 aa  SYL_ACIC1 RecName: Full=Leucyl-tRNA synthetase;       
    3::792     e-149  39%  810 aa  SYL_OENOB RecName: Full=Leucyl-tRNA synthetase;       
    3::815     e-149  39%  816 aa  SYL_CLOPE RecName: Full=Leucyl-tRNA synthetase;       
    2::784     e-149  39%  804 aa  SYL_LACJO RecName: Full=Leucyl-tRNA synthetase;       
    3::815     e-149  39%  816 aa  SYL_CLOPS RecName: Full=Leucyl-tRNA synthetase;       
    2::798     e-148  40%  799 aa  SYL_MYCPE RecName: Full=Leucyl-tRNA synthetase;       
    8::811     e-148  41%  812 aa  SYL_CLOTE RecName: Full=Leucyl-tRNA synthetase;       
    2::820     e-148  37%  820 aa  SYL_CHLAB RecName: Full=Leucyl-tRNA synthetase;       
    1::840     e-148  38%  842 aa  SYL_BORHD RecName: Full=Leucyl-tRNA synthetase;       
    3::803     e-148  39%  804 aa  SYL_MYCMS RecName: Full=Leucyl-tRNA synthetase;       
   22::819     e-148  39%  819 aa  SYL_CHLMU RecName: Full=Leucyl-tRNA synthetase;       
    2::786     e-147  38%  804 aa  SYL_LACH4 RecName: Full=Leucyl-tRNA synthetase;       
    2::820     e-147  37%  820 aa  SYL_CHLCV RecName: Full=Leucyl-tRNA synthetase;       
    1::815     e-147  40%  816 aa  SYL_CLOB8 RecName: Full=Leucyl-tRNA synthetase;       
    2::755     e-147  39%  804 aa  SYL_LACGA RecName: Full=Leucyl-tRNA synthetase;       
    3::781     e-147  38%  803 aa  SYL_LACCB RecName: Full=Leucyl-tRNA synthetase;       
    3::781     e-147  38%  803 aa  SYL_LACC3 RecName: Full=Leucyl-tRNA synthetase;       
   62::758     e-147  45%  994 aa  SYLM_NEUCR RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    2::801     e-146  39%  805 aa  SYL_PELLD RecName: Full=Leucyl-tRNA synthetase;       
    2::804     e-146  39%  805 aa  SYL_MYCGA RecName: Full=Leucyl-tRNA synthetase;       
   10::818     e-146  40%  819 aa  SYL_THETN RecName: Full=Leucyl-tRNA synthetase;       
    2::804     e-146  38%  805 aa  SYL_CHLT3 RecName: Full=Leucyl-tRNA synthetase;       
    3::861     e-145  37%  863 aa  SYL_SALRD RecName: Full=Leucyl-tRNA synthetase;       
   29::795     e-145  39%  796 aa  SYL_BDEBA RecName: Full=Leucyl-tRNA synthetase;       
    1::949     e-144  37%  950 aa  SYL_RHOBA RecName: Full=Leucyl-tRNA synthetase;       
   21::860     e-144  40%  866 aa  SYL_LEIXX RecName: Full=Leucyl-tRNA synthetase;       
    3::815     e-144  39%  816 aa  SYL_CLOP1 RecName: Full=Leucyl-tRNA synthetase;       
   26::809     e-143  40%  811 aa  SYL_CLOK5 RecName: Full=Leucyl-tRNA synthetase;       
    2::793     e-143  38%  807 aa  SYL_PELPB RecName: Full=Leucyl-tRNA synthetase;       
    2::862     e-142  38%  863 aa  SYL_LEPIN RecName: Full=Leucyl-tRNA synthetase;       
    2::862     e-142  38%  863 aa  SYL_LEPIC RecName: Full=Leucyl-tRNA synthetase;       
    2::806     e-142  39%  816 aa  SYL_CHLPD RecName: Full=Leucyl-tRNA synthetase;       
    2::800     e-142  38%  806 aa  SYL_PROA2 RecName: Full=Leucyl-tRNA synthetase;       
    2::801     e-142  39%  805 aa  SYL_CHLCH RecName: Full=Leucyl-tRNA synthetase;       
   60::901     e-141  38%  903 aa  SYLM_HUMAN RecName: Full=Probable leucyl-tRNA synthetase,
    2::801     e-141  39%  805 aa  SYL_CHLL2 RecName: Full=Leucyl-tRNA synthetase;       
   14::816     e-141  37%  817 aa  SYL_RUBXD RecName: Full=Leucyl-tRNA synthetase;       
   60::898     e-140  38%  903 aa  SYLM_PONAB RecName: Full=Probable leucyl-tRNA synthetase,
    7::766     e-140  42%  885 aa  SYL_HALSA RecName: Full=Leucyl-tRNA synthetase;       
   16::803     e-140  39%  806 aa  SYL_TROW8 RecName: Full=Leucyl-tRNA synthetase;       
    2::789     e-139  39%  806 aa  SYL_UREU1 RecName: Full=Leucyl-tRNA synthetase;       
   16::803     e-139  39%  806 aa  SYL_TROWT RecName: Full=Leucyl-tRNA synthetase;       
    2::801     e-139  39%  805 aa  SYL_PROVI RecName: Full=Leucyl-tRNA synthetase;       
    3::878     e-137  34%  878 aa  SYL_TREPS RecName: Full=Leucyl-tRNA synthetase;       
    3::878     e-137  34%  878 aa  SYL_TREPA RecName: Full=Leucyl-tRNA synthetase;       
   56::900     e-137  38%  902 aa  SYLM_MOUSE RecName: Full=Probable leucyl-tRNA synthetase,
    2::863     e-136  38%  864 aa  SYL_LEPBL RecName: Full=Leucyl-tRNA synthetase;       
    2::863     e-136  38%  864 aa  SYL_LEPBJ RecName: Full=Leucyl-tRNA synthetase;       
    1::780     e-136  37%  803 aa  SYL_ACHLI RecName: Full=Leucyl-tRNA synthetase;       
    2::789     e-135  39%  806 aa  SYL_UREPA RecName: Full=Leucyl-tRNA synthetase;       
    2::789     e-135  39%  806 aa  SYL_UREP2 RecName: Full=Leucyl-tRNA synthetase;       
   35::800     e-134  39%  801 aa  SYL_MESFL RecName: Full=Leucyl-tRNA synthetase;       
    3::928     e-129  38%  944 aa  SYL_BACV8 RecName: Full=Leucyl-tRNA synthetase;       
    3::946     e-129  40%  962 aa  SYL_GRAFK RecName: Full=Leucyl-tRNA synthetase;       
   23::951     e-128  36%  952 aa  SYL_CORGB RecName: Full=Leucyl-tRNA synthetase;       
   29::853     e-127  35%  854 aa  SYL_SORC5 RecName: Full=Leucyl-tRNA synthetase;       
   28::953     e-127  38%  953 aa  SYL_MYCS2 RecName: Full=Leucyl-tRNA synthetase;       
   23::951     e-127  36%  952 aa  SYL_CORGL RecName: Full=Leucyl-tRNA synthetase;       
   27::956     e-127  36%  957 aa  SYL_COREF RecName: Full=Leucyl-tRNA synthetase;       
   30::950     e-125  36%  950 aa  SYL_MYCSS RecName: Full=Leucyl-tRNA synthetase;       
   30::950     e-125  36%  950 aa  SYL_MYCSK RecName: Full=Leucyl-tRNA synthetase;       
   30::950     e-125  36%  950 aa  SYL_MYCSJ RecName: Full=Leucyl-tRNA synthetase;       
    2::946     e-125  38%  962 aa  SYL_FLAPJ RecName: Full=Leucyl-tRNA synthetase;       
    4::658     e-125  39%  847 aa  SYL_BUCCC RecName: Full=Leucyl-tRNA synthetase;       
    1::923     e-124  35%  923 aa  SYL_AMOA5 RecName: Full=Leucyl-tRNA synthetase;       
    1::902     e-124  37%  921 aa  SYL_CYTH3 RecName: Full=Leucyl-tRNA synthetase;       
    3::896     e-124  39%  944 aa  SYL_BACTN RecName: Full=Leucyl-tRNA synthetase;       
   20::948     e-123  36%  949 aa  SYL_CORA7 RecName: Full=Leucyl-tRNA synthetase;       
   21::974     e-123  36%  976 aa  SYL_CORJK RecName: Full=Leucyl-tRNA synthetase;       
    2::887     e-123  39%  918 aa  SYL_AZOPC RecName: Full=Leucyl-tRNA synthetase;       
    2::790     e-122  38%  793 aa  SYL_MYCPN RecName: Full=Leucyl-tRNA synthetase;       
    2::790     e-121  38%  792 aa  SYL_MYCGE RecName: Full=Leucyl-tRNA synthetase;       
   29::959     e-121  36%  960 aa  SYL_CORDI RecName: Full=Leucyl-tRNA synthetase;       
   27::944     e-120  35%  945 aa  SYL_RHOSR RecName: Full=Leucyl-tRNA synthetase;       
   32::968     e-120  36%  968 aa  SYL_MYCVP RecName: Full=Leucyl-tRNA synthetase;       
   16::965     e-119  37%  987 aa  SYL_BIFLD RecName: Full=Leucyl-tRNA synthetase;       
   16::965     e-119  37%  987 aa  SYL_BIFLO RecName: Full=Leucyl-tRNA synthetase;       
   70::969     e-117  36%  969 aa  SYL_MYCTU RecName: Full=Leucyl-tRNA synthetase;       
   70::969     e-117  36%  969 aa  SYL_MYCTA RecName: Full=Leucyl-tRNA synthetase;       
   70::969     e-117  36%  969 aa  SYL_MYCBT RecName: Full=Leucyl-tRNA synthetase;       
   70::969     e-117  36%  969 aa  SYL_MYCBP RecName: Full=Leucyl-tRNA synthetase;       
   70::969     e-117  36%  969 aa  SYL_MYCBO RecName: Full=Leucyl-tRNA synthetase;       
   25::949     e-117  36%  949 aa  SYL_MYCGI RecName: Full=Leucyl-tRNA synthetase;       
   26::960     e-116  35%  962 aa  SYL_STRAW RecName: Full=Leucyl-tRNA synthetase;       
   24::949     e-116  34%  950 aa  SYL_NOCFA RecName: Full=Leucyl-tRNA synthetase;       
   29::964     e-116  35%  966 aa  SYL_STRCO RecName: Full=Leucyl-tRNA synthetase;       
   35::969     e-115  35%  969 aa  SYL_MYCPA RecName: Full=Leucyl-tRNA synthetase;       
    3::927     e-115  37%  943 aa  SYL_BACFR RecName: Full=Leucyl-tRNA synthetase;       
   35::969     e-115  35%  969 aa  SYL_MYCA1 RecName: Full=Leucyl-tRNA synthetase;       
    3::927     e-115  37%  943 aa  SYL_BACFN RecName: Full=Leucyl-tRNA synthetase;       
   22::951     e-114  34%  952 aa  SYL_SALAI RecName: Full=Leucyl-tRNA synthetase;       
   41::954     e-113  34%  955 aa  SYL_SACEN RecName: Full=Leucyl-tRNA synthetase;       
    3::912     e-113  37%  925 aa  SYL_PORG3 RecName: Full=Leucyl-tRNA synthetase;       
   43::976     e-113  35%  976 aa  SYL_MYCMM RecName: Full=Leucyl-tRNA synthetase;       
   43::976     e-113  35%  976 aa  SYL_MYCUA RecName: Full=Leucyl-tRNA synthetase;       
    3::912     e-112  36%  925 aa  SYL_PORGI RecName: Full=Leucyl-tRNA synthetase;       
    3::910     e-112  36%  946 aa  SYL_PARD8 RecName: Full=Leucyl-tRNA synthetase;       
   24::953     e-112  34%  954 aa  SYL_SALTO RecName: Full=Leucyl-tRNA synthetase;       
   35::972     e-108  34%  972 aa  SYL_MYCLE RecName: Full=Leucyl-tRNA synthetase;       
   35::972     e-108  34%  972 aa  SYL_MYCLB RecName: Full=Leucyl-tRNA synthetase;       
   24::955     e-107  33%  957 aa  SYL_STRGG RecName: Full=Leucyl-tRNA synthetase;       
  205::865     e-100  36%  867 aa  SYL_LEPBP RecName: Full=Leucyl-tRNA synthetase;       
  205::865     e-100  36%  867 aa  SYL_LEPBA RecName: Full=Leucyl-tRNA synthetase;       
  232::956     7e-99  36%  990 aa  SYL_BIFAA RecName: Full=Leucyl-tRNA synthetase;       
  200::953     5e-95  35%  954 aa  SYL_FLAJ1 RecName: Full=Leucyl-tRNA synthetase;       
   63::210     8e-89  35% 1064 aa  SYL_FRASC RecName: Full=Leucyl-tRNA synthetase;       
   64::407     3e-68  35% 1069 aa  SYL_FRAAA RecName: Full=Leucyl-tRNA synthetase;       
    8::774     8e-47  32%  873 aa  SYV_MESFL RecName: Full=Valyl-tRNA synthetase;       
    7::637     9e-43  32%  865 aa  SYV_THEMA RecName: Full=Valyl-tRNA synthetase;       
    6::765     3e-42  31%  876 aa  SYV_STACT RecName: Full=Valyl-tRNA synthetase;       
    8::771     3e-42  31%  883 aa  SYV_STRA5 RecName: Full=Valyl-tRNA synthetase;       
   11::642     3e-42  32%  880 aa  SYV_BACSU RecName: Full=Valyl-tRNA synthetase;       
    8::760     8e-42  30%  872 aa  SYV_MYCMS RecName: Full=Valyl-tRNA synthetase;       
    8::771     1e-41  31%  884 aa  SYV_STRA1 RecName: Full=Valyl-tRNA synthetase;       
   10::768     3e-41  33%  877 aa  SYV_METTH RecName: Full=Valyl-tRNA synthetase;       
    8::638     8e-41  33%  879 aa  SYV_THETN RecName: Full=Valyl-tRNA synthetase;       
   11::785     1e-40  30%  880 aa  SYV_BACLD RecName: Full=Valyl-tRNA synthetase;       
    4::580     1e-40  34%  882 aa  SYV_ONYPE RecName: Full=Valyl-tRNA synthetase;       
   11::580     3e-40  35%  880 aa  SYV_BACHD RecName: Full=Valyl-tRNA synthetase;       
    6::587     5e-40  35%  876 aa  SYV_BACFR RecName: Full=Valyl-tRNA synthetase;       
    6::587     5e-40  35%  876 aa  SYV_BACFN RecName: Full=Valyl-tRNA synthetase;       
    6::648     2e-39  33%  879 aa  SYV_BACTN RecName: Full=Valyl-tRNA synthetase;       
   14::701     2e-39  32%  874 aa  SYV_UREPA RecName: Full=Valyl-tRNA synthetase;       
   11::646     4e-39  31%  881 aa  SYV_CLOAB RecName: Full=Valyl-tRNA synthetase;       
    7::643     5e-39  32%  882 aa  SYV_STRP6 RecName: Full=Valyl-tRNA synthetase;       
    8::769     6e-39  31%  883 aa  SYV_STRT1 RecName: Full=Valyl-tRNA synthetase;       
    7::643     6e-39  32%  882 aa  SYV_STRPM RecName: Full=Valyl-tRNA synthetase;       
    7::643     8e-39  32%  882 aa  SYV_STRP3 RecName: Full=Valyl-tRNA synthetase;       
    7::643     8e-39  32%  882 aa  SYV_STRP1 RecName: Full=Valyl-tRNA synthetase;       
    7::643     1e-38  32%  882 aa  SYV_STRP8 RecName: Full=Valyl-tRNA synthetase;       
    8::769     1e-38  31%  883 aa  SYV_STRT2 RecName: Full=Valyl-tRNA synthetase;       
    8::644     2e-38  32%  883 aa  SYV_STRR6 RecName: Full=Valyl-tRNA synthetase;       
    8::721     3e-38  31%  883 aa  SYV_STRPN RecName: Full=Valyl-tRNA synthetase;       
   10::718     3e-37  29%  869 aa  SYV_METMA RecName: Full=Valyl-tRNA synthetase;       
   20::770     3e-37  30%  880 aa  SYV_ENTFA RecName: Full=Valyl-tRNA synthetase;       
   10::683     3e-37  31%  939 aa  SYV_CHLTA RecName: Full=Valyl-tRNA synthetase;       
   10::683     3e-37  31%  939 aa  SYV_CHLMU RecName: Full=Valyl-tRNA synthetase;       
   11::643     3e-37  32%  881 aa  SYV_BACCR RecName: Full=Valyl-tRNA synthetase;       
    5::707     3e-37  28%  832 aa  SYV_MYCS5 RecName: Full=Valyl-tRNA synthetase;       
    7::731     3e-37  29%  863 aa  SYV_ARCFU RecName: Full=Valyl-tRNA synthetase;       
   10::683     4e-37  31%  939 aa  SYV_CHLTR RecName: Full=Valyl-tRNA synthetase;       
   10::683     4e-37  31%  939 aa  SYV_CHLTB RecName: Full=Valyl-tRNA synthetase;       
   10::580     4e-37  32%  880 aa  SYV_BACSK RecName: Full=Valyl-tRNA synthetase;       
   11::643     6e-37  32%  881 aa  SYV_BACCZ RecName: Full=Valyl-tRNA synthetase;       
   11::643     7e-37  32%  881 aa  SYV_BACC1 RecName: Full=Valyl-tRNA synthetase;       
    4::693     1e-36  33%  875 aa  SYV_PELUB RecName: Full=Valyl-tRNA synthetase;       
    8::644     1e-36  33%  883 aa  SYV_STRMU RecName: Full=Valyl-tRNA synthetase;       
   10::710     2e-36  28%  957 aa  SYV_BLOPB RecName: Full=Valyl-tRNA synthetase;       
   11::643     2e-36  32%  881 aa  SYV_BACHK RecName: Full=Valyl-tRNA synthetase;       
   11::643     2e-36  32%  881 aa  SYV_BACAN RecName: Full=Valyl-tRNA synthetase;       
    6::755     3e-36  30%  876 aa  SYV_GRAFK RecName: Full=Valyl-tRNA synthetase;       
   11::646     3e-36  32%  880 aa  SYV_CLOTE RecName: Full=Valyl-tRNA synthetase;       
   10::815     4e-36  32%  918 aa  SYV_PROMP RecName: Full=Valyl-tRNA synthetase;       
   14::765     4e-36  29%  883 aa  SYV_OCEIH RecName: Full=Valyl-tRNA synthetase;       
   10::683     4e-36  31%  939 aa  SYV_CHLT2 RecName: Full=Valyl-tRNA synthetase;       
    8::689     6e-36  31%  949 aa  SYV_PARUW RecName: Full=Valyl-tRNA synthetase;       
   10::684     1e-35  30%  940 aa  SYV_CHLFF RecName: Full=Valyl-tRNA synthetase;       
   10::684     2e-35  31%  940 aa  SYV_CHLPN RecName: Full=Valyl-tRNA synthetase;       
   17::626     2e-35  33%  925 aa  SYI_CARHZ RecName: Full=Isoleucyl-tRNA synthetase;       
   13::766     3e-35  30%  861 aa  SYV_MYCGA RecName: Full=Valyl-tRNA synthetase;       
    7::639     3e-35  32%  879 aa  SYV_LACAC RecName: Full=Valyl-tRNA synthetase;       
    5::711     9e-35  29%  958 aa  SYV_SHEON RecName: Full=Valyl-tRNA synthetase;       
    6::588     9e-35  32%  876 aa  SYV_PORG3 RecName: Full=Valyl-tRNA synthetase;       
    8::644     2e-34  30%  880 aa  SYV_LACLA RecName: Full=Valyl-tRNA synthetase;       
   10::684     2e-34  31%  940 aa  SYV_CHLAB RecName: Full=Valyl-tRNA synthetase;       
    6::588     3e-34  32%  876 aa  SYV_PORGI RecName: Full=Valyl-tRNA synthetase;       
    6::589     3e-34  33%  875 aa  SYV_BACV8 RecName: Full=Valyl-tRNA synthetase;       
    9::601     4e-34  31%  894 aa  SYV_BDEBA RecName: Full=Valyl-tRNA synthetase;       
   13::770     6e-34  31%  883 aa  SYV_LISMO RecName: Full=Valyl-tRNA synthetase;       
   13::770     6e-34  31%  883 aa  SYV_LISMF RecName: Full=Valyl-tRNA synthetase;       
   40::288     6e-34  33%  289 aa  SYLB_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit beta;      
   10::684     8e-34  30%  940 aa  SYV_CHLCV RecName: Full=Valyl-tRNA synthetase;       
   11::582     2e-33  34%  887 aa  SYV_DESPS RecName: Full=Valyl-tRNA synthetase;       
   19::716     2e-33  30%  932 aa  SYI_THETN RecName: Full=Isoleucyl-tRNA synthetase;       
   12::596     3e-33  32%  883 aa  SYV_LACCA RecName: Full=Valyl-tRNA synthetase;       
   12::772     5e-33  29%  882 aa  SYV_LISIN RecName: Full=Valyl-tRNA synthetase;       
   19::706     1e-32  31%  932 aa  SYI_THEPX RecName: Full=Isoleucyl-tRNA synthetase;       
   19::706     1e-32  31%  932 aa  SYI_THEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::582     1e-32  33%  887 aa  SYV_GEOSL RecName: Full=Valyl-tRNA synthetase;       
    1::804     1e-32  37%  967 aa  SYL_PYRAB RecName: Full=Leucyl-tRNA synthetase;       
    6::719     2e-32  31%  874 aa  SYV_PETMO RecName: Full=Valyl-tRNA synthetase;       
   10::576     2e-32  33%  838 aa  SYV_MYCPN RecName: Full=Valyl-tRNA synthetase;       
   11::616     4e-32  34%  837 aa  SYV_MYCGE RecName: Full=Valyl-tRNA synthetase;       
    1::804     4e-32  38%  967 aa  SYL_PYRKO RecName: Full=Leucyl-tRNA synthetase;       
    1::822     4e-32  37%  967 aa  SYL_PYRFU RecName: Full=Leucyl-tRNA synthetase;       
    1::898     5e-32  36%  967 aa  SYL_PYRHO RecName: Full=Leucyl-tRNA synthetase;       
   10::893     5e-32  28% 1065 aa  SYI_PYRKO RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     5e-32  30%  921 aa  SYI_BACC4 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     5e-32  30%  921 aa  SYI_BACC2 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     5e-32  30%  921 aa  SYI1_BACCR RecName: Full=Isoleucyl-tRNA synthetase 1;       
   23::608     1e-31  32%  899 aa  SYV_PELCD RecName: Full=Valyl-tRNA synthetase;       
   12::657     1e-31  29%  889 aa  SYV_LACPL RecName: Full=Valyl-tRNA synthetase;       
    1::822     1e-31  37%  967 aa  SYL_THEON RecName: Full=Leucyl-tRNA synthetase;       
   17::825     3e-31  29%  921 aa  SYI_BACCQ RecName: Full=Isoleucyl-tRNA synthetase;       
   17::825     3e-31  29%  921 aa  SYI_BACC7 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     3e-31  29%  921 aa  SYI_BACAC RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     3e-31  29%  921 aa  SYI_BACAA RecName: Full=Isoleucyl-tRNA synthetase;       
   17::825     3e-31  29%  921 aa  SYI1_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 1;       
   17::699     3e-31  29%  921 aa  SYI1_BACAN RecName: Full=Isoleucyl-tRNA synthetase 1;       
    5::733     4e-31  34%  891 aa  SYV_PYRAB RecName: Full=Valyl-tRNA synthetase;       
   17::825     4e-31  29%  921 aa  SYI1_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 1;       
   13::765     5e-31  29%  869 aa  SYV_MYCPE RecName: Full=Valyl-tRNA synthetase;       
   17::709     5e-31  31%  921 aa  SYI_BACWK RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     5e-31  29%  921 aa  SYI_BACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     5e-31  29%  921 aa  SYI_BACC0 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::699     5e-31  29%  921 aa  SYI1_BACHK RecName: Full=Isoleucyl-tRNA synthetase 1;       
    6::744     8e-31  34%  891 aa  SYV_PYRHO RecName: Full=Valyl-tRNA synthetase;       
    6::734     8e-31  35%  891 aa  SYV_PYRFU RecName: Full=Valyl-tRNA synthetase;       
    6::585     8e-31  37%  881 aa  SYV_HALSA RecName: Full=Valyl-tRNA synthetase;       
    6::585     8e-31  37%  881 aa  SYV_HALS3 RecName: Full=Valyl-tRNA synthetase;       
   18::841     8e-31  29%  900 aa  SYI_UREPA RecName: Full=Isoleucyl-tRNA synthetase;       
   11::794     1e-30  32%  886 aa  SYV_METMP RecName: Full=Valyl-tRNA synthetase;       
   28::650     1e-30  30%  959 aa  SYI_NOSP7 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::634     1e-30  33%  925 aa  SYI_BREBN RecName: Full=Isoleucyl-tRNA synthetase;       
   15::607     2e-30  29%  911 aa  SYV_SYMTH RecName: Full=Valyl-tRNA synthetase;       
    6::772     2e-30  29%  876 aa  SYV_STAAR RecName: Full=Valyl-tRNA synthetase;       
    6::726     4e-30  29%  876 aa  SYV_STAHJ RecName: Full=Valyl-tRNA synthetase;       
    6::642     4e-30  33%  927 aa  SYV_RHILO RecName: Full=Valyl-tRNA synthetase;       
    5::841     4e-30  25%  955 aa  SYV_BUCAI RecName: Full=Valyl-tRNA synthetase;       
   17::709     4e-30  28%  921 aa  SYI_BACCN RecName: Full=Isoleucyl-tRNA synthetase;       
    6::772     5e-30  29%  876 aa  SYV_STAAB RecName: Full=Valyl-tRNA synthetase;       
   26::671     7e-30  31%  933 aa  SYV_PROMT RecName: Full=Valyl-tRNA synthetase;       
    6::640     9e-30  35%  888 aa  SYV_PYRKO RecName: Full=Valyl-tRNA synthetase;       
    6::637     9e-30  30%  875 aa  SYV_ANOFW RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAW RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAT RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAS RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAN RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAM RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAE RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAAC RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAA9 RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAA8 RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAA3 RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAA2 RecName: Full=Valyl-tRNA synthetase;       
    6::772     1e-29  29%  876 aa  SYV_STAA1 RecName: Full=Valyl-tRNA synthetase;       
    5::668     3e-29  28%  952 aa  SYV_VIBPA RecName: Full=Valyl-tRNA synthetase;       
   20::586     3e-29  32%  933 aa  SYV_PROMA RecName: Full=Valyl-tRNA synthetase;       
    8::702     3e-29  32%  855 aa  SYV_METTP RecName: Full=Valyl-tRNA synthetase;       
   28::652     3e-29  31%  960 aa  SYI_ANASP RecName: Full=Isoleucyl-tRNA synthetase;       
    7::583     6e-29  32%  862 aa  SYV_THETH RecName: Full=Valyl-tRNA synthetase;       
    7::583     6e-29  32%  862 aa  SYV_THET8 RecName: Full=Valyl-tRNA synthetase;       
   13::702     6e-29  26%  939 aa  SYV_CHRVO RecName: Full=Valyl-tRNA synthetase;       
    7::815     6e-29  30% 1042 aa  SYI_BORBZ RecName: Full=Isoleucyl-tRNA synthetase;       
    9::678     7e-29  29%  919 aa  SYV_FRATT RecName: Full=Valyl-tRNA synthetase;       
    7::815     7e-29  30% 1042 aa  SYI_BORBU RecName: Full=Isoleucyl-tRNA synthetase;       
   12::701     1e-28  26%  937 aa  SYV_LARHH RecName: Full=Valyl-tRNA synthetase;       
   19::624     1e-28  28%  908 aa  SYI_MESFL RecName: Full=Isoleucyl-tRNA synthetase;       
   29::661     1e-28  30%  968 aa  SYI_PROMS RecName: Full=Isoleucyl-tRNA synthetase;       
   29::661     2e-28  31%  965 aa  SYI_PROM2 RecName: Full=Isoleucyl-tRNA synthetase;       
   12::642     3e-28  29%  912 aa  SYV_THIDA RecName: Full=Valyl-tRNA synthetase;       
    7::815     3e-28  29% 1042 aa  SYI_BORGA RecName: Full=Isoleucyl-tRNA synthetase;       
    7::653     4e-28  34%  914 aa  SYV_METKA RecName: Full=Valyl-tRNA synthetase;       
   57::709     5e-28  28%  973 aa  SYV_COLP3 RecName: Full=Valyl-tRNA synthetase;       
    6::638     5e-28  29%  875 aa  SYV_BORGA RecName: Full=Valyl-tRNA synthetase;       
    3::823     5e-28  28%  932 aa  SYL_ARCFU RecName: Full=Leucyl-tRNA synthetase;       
    4::673     6e-28  28%  827 aa  SYV_MYCPU RecName: Full=Valyl-tRNA synthetase;       
    6::1064    6e-28  29% 1165 aa  SYV_AQUAE RecName: Full=Valyl-tRNA synthetase;       
   19::371     6e-28  33%  910 aa  SYL_THEAC RecName: Full=Leucyl-tRNA synthetase;       
   21::648     6e-28  31%  959 aa  SYI_CYAA5 RecName: Full=Isoleucyl-tRNA synthetase;       
   13::400     8e-28  34%  910 aa  SYL_THEVO RecName: Full=Leucyl-tRNA synthetase;       
   20::695     8e-28  32%  892 aa  SYI_MYCAP RecName: Full=Isoleucyl-tRNA synthetase;       
    5::693     1e-27  36%  962 aa  SYL_METBU RecName: Full=Leucyl-tRNA synthetase;       
    7::583     1e-27  32%  862 aa  SYV_THET2 RecName: Full=Valyl-tRNA synthetase;       
   18::600     2e-27  36%  809 aa  SYV_SULTO RecName: Full=Valyl-tRNA synthetase;       
   10::718     2e-27  32%  869 aa  SYV_METAC RecName: Full=Valyl-tRNA synthetase;       
    8::757     2e-27  32%  814 aa  SYV_RICPR RecName: Full=Valyl-tRNA synthetase;       
   47::724     3e-27  36%  878 aa  SYV_METJA RecName: Full=Valyl-tRNA synthetase;       
    4::760     3e-27  28%  870 aa  SYV_CAMJR RecName: Full=Valyl-tRNA synthetase;       
    5::662     4e-27  27%  951 aa  SYV_VIBVY RecName: Full=Valyl-tRNA synthetase;       
    5::662     4e-27  27%  951 aa  SYV_VIBVU RecName: Full=Valyl-tRNA synthetase;       
   10::734     4e-27  32%  869 aa  SYV_METBF RecName: Full=Valyl-tRNA synthetase;       
    5::807     4e-27  30%  961 aa  SYL_METAC RecName: Full=Leucyl-tRNA synthetase;       
   29::661     4e-27  30%  968 aa  SYI_PROM9 RecName: Full=Isoleucyl-tRNA synthetase;       
   50::711     5e-27  29% 1064 aa  SYVM_DICDI RecName: Full=Probable valyl-tRNA synthetase,
    7::815     5e-27  29% 1042 aa  SYI_BORAP RecName: Full=Isoleucyl-tRNA synthetase;       
   46::637     7e-27  34%  859 aa  SYV_RICFE RecName: Full=Valyl-tRNA synthetase;       
   21::641     9e-27  31%  952 aa  SYI_MICAN RecName: Full=Isoleucyl-tRNA synthetase;       
    8::590     1e-26  36%  813 aa  SYV_RICCK RecName: Full=Valyl-tRNA synthetase;       
   29::662     1e-26  27%  967 aa  SYI_PROM1 RecName: Full=Isoleucyl-tRNA synthetase;       
   44::674     2e-26  34%  842 aa  SYV_SULSO RecName: Full=Valyl-tRNA synthetase;       
    6::638     2e-26  29%  876 aa  SYV_STAES RecName: Full=Valyl-tRNA synthetase;       
    6::638     2e-26  29%  876 aa  SYV_STAEQ RecName: Full=Valyl-tRNA synthetase;       
   18::618     2e-26  30%  913 aa  SYV_DEIRA RecName: Full=Valyl-tRNA synthetase;       
   29::662     2e-26  28%  967 aa  SYI_PROMT RecName: Full=Isoleucyl-tRNA synthetase;       
    6::638     2e-26  30%  876 aa  SYV_STAS1 RecName: Full=Valyl-tRNA synthetase;       
   10::784     2e-26  29%  882 aa  SYV_LACSS RecName: Full=Valyl-tRNA synthetase;       
   21::643     2e-26  28%  954 aa  SYI_SYNP6 RecName: Full=Isoleucyl-tRNA synthetase;       
   21::648     2e-26  31%  959 aa  SYI_CYAP8 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::609     3e-26  32%  894 aa  SYV_WOLSU RecName: Full=Valyl-tRNA synthetase;       
   35::677     3e-26  34%  831 aa  SYV_SULAC RecName: Full=Valyl-tRNA synthetase;       
   29::661     3e-26  28%  968 aa  SYI_PROM0 RecName: Full=Isoleucyl-tRNA synthetase;       
    5::731     3e-26  31%  966 aa  SYL_METBF RecName: Full=Leucyl-tRNA synthetase;       
   22::687     3e-26  29%  983 aa  SYI_GLOVI RecName: Full=Isoleucyl-tRNA synthetase;       
   21::642     3e-26  29%  955 aa  SYI_CYAP4 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::827     3e-26  29% 1044 aa  SYI_BORHD RecName: Full=Isoleucyl-tRNA synthetase;       
   11::195     4e-26  38%  880 aa  SYV_GEOKA RecName: Full=Valyl-tRNA synthetase;       
   11::195     4e-26  38%  880 aa  SYV_BACST RecName: Full=Valyl-tRNA synthetase;       
   20::704     4e-26  25%  971 aa  SYV_ACIAD RecName: Full=Valyl-tRNA synthetase;       
   10::455     6e-26  34%  966 aa  SYV_BLOFL RecName: Full=Valyl-tRNA synthetase;       
   10::293     8e-26  34%  880 aa  SYV_CLOPE RecName: Full=Valyl-tRNA synthetase;       
    6::638     1e-25  29%  875 aa  SYV_BORBU RecName: Full=Valyl-tRNA synthetase;       
    7::639     2e-25  30%  879 aa  SYV_LACJO RecName: Full=Valyl-tRNA synthetase;       
    4::760     2e-25  28%  870 aa  SYV_CAMJE RecName: Full=Valyl-tRNA synthetase;       
   21::648     2e-25  31%  959 aa  SYI_CYAP7 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::317     3e-25  34%  909 aa  SYV_TREDE RecName: Full=Valyl-tRNA synthetase;       
    3::845     3e-25  31%  942 aa  SYL2_SULAC RecName: Full=Leucyl-tRNA synthetase 2;       
    4::813     4e-25  32%  855 aa  SYV_WOLTR RecName: Full=Valyl-tRNA synthetase;       
   17::621     4e-25  33%  927 aa  SYI_LACH4 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::864     4e-25  29% 1044 aa  SYI_BORT9 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::613     5e-25  33%  887 aa  SYV_FUSNN RecName: Full=Valyl-tRNA synthetase;       
   23::591     5e-25  31%  880 aa  SYV_DEHE1 RecName: Full=Valyl-tRNA synthetase;       
    8::193     6e-25  35%  897 aa  SYV_GLOVI RecName: Full=Valyl-tRNA synthetase;       
   19::694     6e-25  28%  885 aa  SYI_MYCMO RecName: Full=Isoleucyl-tRNA synthetase;       
   21::649     8e-25  29%  988 aa  SYI_SYNY3 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::712     8e-25  29%  930 aa  SYI_MOOTA RecName: Full=Isoleucyl-tRNA synthetase;       
   14::645     8e-25  30% 1033 aa  SYI2_BACHK RecName: Full=Isoleucyl-tRNA synthetase 2;       
    1::381     1e-24  38%  660 aa  SYM_BACHD RecName: Full=Methionyl-tRNA synthetase;       
    4::834     1e-24  31%  864 aa  SYV_WOLPM RecName: Full=Valyl-tRNA synthetase;       
    7::711     1e-24  32%  802 aa  SYV_EHRCJ RecName: Full=Valyl-tRNA synthetase;       
    3::714     1e-24  32%  937 aa  SYL_METTH RecName: Full=Leucyl-tRNA synthetase;       
   17::701     1e-24  29%  926 aa  SYI_ENTFA RecName: Full=Isoleucyl-tRNA synthetase;       
    6::635     2e-24  28%  861 aa  SYV_THELT RecName: Full=Valyl-tRNA synthetase;       
    6::581     2e-24  33%  872 aa  SYV_NATPD RecName: Full=Valyl-tRNA synthetase;       
  139::578     2e-24  31% 1108 aa  SYV_ARATH RecName: Full=Valyl-tRNA synthetase;       
    8::648     2e-24  28% 1076 aa  SYI_METB6 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::893     2e-24  28% 1067 aa  SYI_PYRAB RecName: Full=Isoleucyl-tRNA synthetase;       
   29::663     2e-24  29%  969 aa  SYI_PROMA RecName: Full=Isoleucyl-tRNA synthetase;       
    7::639     2e-24  30% 1022 aa  SYI2_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 2;       
  148::859     3e-24  28% 1104 aa  SYV_YEAST RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
   24::619     3e-24  34%  928 aa  SYI_LACSS RecName: Full=Isoleucyl-tRNA synthetase;       
   24::620     3e-24  29%  928 aa  SYI_LACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::645     3e-24  30% 1033 aa  SYI2_BACCR RecName: Full=Isoleucyl-tRNA synthetase 2;       
    8::346     4e-24  31%  952 aa  SYL_METVS RecName: Full=Leucyl-tRNA synthetase;       
    5::705     4e-24  32%  966 aa  SYL_METMA RecName: Full=Leucyl-tRNA synthetase;       
   24::620     4e-24  29%  928 aa  SYI_LACCB RecName: Full=Isoleucyl-tRNA synthetase;       
   14::645     4e-24  29% 1033 aa  SYI2_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 2;       
    8::757     5e-24  32%  814 aa  SYV_RICTY RecName: Full=Valyl-tRNA synthetase;       
   15::651     5e-24  35%  823 aa  SYV_ANAMM RecName: Full=Valyl-tRNA synthetase;       
    7::757     7e-24  33%  810 aa  SYV_EHRRW RecName: Full=Valyl-tRNA synthetase;       
    9::759     7e-24  33%  812 aa  SYV_EHRRG RecName: Full=Valyl-tRNA synthetase;       
   18::646     7e-24  26%  952 aa  SYI_VIBSL RecName: Full=Isoleucyl-tRNA synthetase;       
   24::711     7e-24  28%  930 aa  SYI_STRMU RecName: Full=Isoleucyl-tRNA synthetase;       
    9::709     9e-24  30%  954 aa  SYV_MANSM RecName: Full=Valyl-tRNA synthetase;       
    9::190     9e-24  38%  878 aa  SYV_CARHZ RecName: Full=Valyl-tRNA synthetase;       
    3::676     9e-24  29%  931 aa  SYV_ALCBS RecName: Full=Valyl-tRNA synthetase;       
   14::645     9e-24  29% 1033 aa  SYI_BACAH RecName: Full=Isoleucyl-tRNA synthetase;       
    9::850     1e-23  26% 1047 aa  SYI_SULTO RecName: Full=Isoleucyl-tRNA synthetase;       
    8::675     1e-23  28% 1039 aa  SYI_METJA RecName: Full=Isoleucyl-tRNA synthetase;       
    9::709     2e-23  29%  954 aa  SYV_PASMU RecName: Full=Valyl-tRNA synthetase;       
   17::712     2e-23  31%  928 aa  SYI_LACJO RecName: Full=Isoleucyl-tRNA synthetase;       
   30::709     2e-23  26%  939 aa  SYI_BUCBP RecName: Full=Isoleucyl-tRNA synthetase;       
   11::614     3e-23  30% 1050 aa  SYI_SULAC RecName: Full=Isoleucyl-tRNA synthetase;       
   18::631     3e-23  29%  940 aa  SYI_BUCAI RecName: Full=Isoleucyl-tRNA synthetase;       
    4::827     5e-23  31%  950 aa  SYL_METTP RecName: Full=Leucyl-tRNA synthetase;       
   46::797     6e-23  33%  812 aa  SYV_RICBR RecName: Full=Valyl-tRNA synthetase;       
    6::626     6e-23  28%  952 aa  SYV_NITWN RecName: Full=Valyl-tRNA synthetase;       
   12::605     6e-23  34% 1014 aa  SYV_ANASP RecName: Full=Valyl-tRNA synthetase;       
   15::875     6e-23  31% 1066 aa  SYI_PYRHO RecName: Full=Isoleucyl-tRNA synthetase;       
   18::631     6e-23  29%  940 aa  SYI_BUCAT RecName: Full=Isoleucyl-tRNA synthetase;       
   18::631     6e-23  29%  940 aa  SYI_BUCA5 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::797     8e-23  33%  812 aa  SYV_RICB8 RecName: Full=Valyl-tRNA synthetase;       
    3::689     8e-23  34%  987 aa  SYV_RHOSK RecName: Full=Valyl-tRNA synthetase;       
    3::689     8e-23  34%  987 aa  SYV_RHOS1 RecName: Full=Valyl-tRNA synthetase;       
    6::677     8e-23  27%  957 aa  SYV_RHOPA RecName: Full=Valyl-tRNA synthetase;       
    6::676     8e-23  28%  958 aa  SYV_BRAJA RecName: Full=Valyl-tRNA synthetase;       
    8::341     8e-23  32%  946 aa  SYL_PYRCJ RecName: Full=Leucyl-tRNA synthetase;       
   14::645     8e-23  29% 1033 aa  SYI2_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 2;       
    8::771     1e-22  32%  884 aa  SYV_STRA3 RecName: Full=Valyl-tRNA synthetase;       
    4::370     1e-22  32%  969 aa  SYL_META3 RecName: Full=Leucyl-tRNA synthetase;       
   18::646     1e-22  27%  952 aa  SYI_ALISL RecName: Full=Isoleucyl-tRNA synthetase;       
   16::872     1e-22  29%  950 aa  SYL2_METS5 RecName: Full=Leucyl-tRNA synthetase 2;       
    1::186     2e-22  37%  929 aa  SYV_NITOC RecName: Full=Valyl-tRNA synthetase;       
   19::624     2e-22  31%  915 aa  SYI_MYCMS RecName: Full=Isoleucyl-tRNA synthetase;       
   17::717     2e-22  32%  929 aa  SYI_HALOH RecName: Full=Isoleucyl-tRNA synthetase;       
    9::709     2e-22  27%  954 aa  SYV_HAEI8 RecName: Full=Valyl-tRNA synthetase;       
    8::844     2e-22  27%  945 aa  SYL_PYRIL RecName: Full=Leucyl-tRNA synthetase;       
    8::544     3e-22  32%  942 aa  SYV_STRMK RecName: Full=Valyl-tRNA synthetase;       
   97::766     3e-22  29%  980 aa  SYV_SCHPO RecName: Full=Valyl-tRNA synthetase;       
    3::689     3e-22  34%  987 aa  SYV_RHOS4 RecName: Full=Valyl-tRNA synthetase;       
    9::709     3e-22  28%  954 aa  SYV_HAES2 RecName: Full=Valyl-tRNA synthetase;       
    9::709     3e-22  27%  954 aa  SYV_HAEIG RecName: Full=Valyl-tRNA synthetase;       
    5::195     3e-22  35%  959 aa  SYL_AERPE RecName: Full=Leucyl-tRNA synthetase;       
   20::620     3e-22  29%  900 aa  SYI_MYCPE RecName: Full=Isoleucyl-tRNA synthetase;       
   10::701     3e-22  27% 1044 aa  SYI_METTH RecName: Full=Isoleucyl-tRNA synthetase;       
    6::189     4e-22  38%  873 aa  SYV_PARD8 RecName: Full=Valyl-tRNA synthetase;       
    9::709     4e-22  27%  954 aa  SYV_HAEIN RecName: Full=Valyl-tRNA synthetase;       
    7::859     4e-22  30%  944 aa  SYL2_SULSO RecName: Full=Leucyl-tRNA synthetase 2;       
   18::646     4e-22  27%  952 aa  SYI_VIBFM RecName: Full=Isoleucyl-tRNA synthetase;       
   18::646     4e-22  27%  952 aa  SYI_VIBF1 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::645     4e-22  30% 1033 aa  SYI2_BACAN RecName: Full=Isoleucyl-tRNA synthetase 2;       
    8::843     5e-22  30%  945 aa  SYL_THENV RecName: Full=Leucyl-tRNA synthetase;       
   15::895     5e-22  31% 1066 aa  SYI_PYRFU RecName: Full=Isoleucyl-tRNA synthetase;       
   13::193     7e-22  35%  955 aa  SYV_BURPS RecName: Full=Valyl-tRNA synthetase;       
   13::193     7e-22  35%  955 aa  SYV_BURMA RecName: Full=Valyl-tRNA synthetase;       
    9::709     7e-22  29%  954 aa  SYV_ACTPJ RecName: Full=Valyl-tRNA synthetase;       
    9::709     7e-22  29%  954 aa  SYV_ACTP7 RecName: Full=Valyl-tRNA synthetase;       
    9::709     7e-22  29%  954 aa  SYV_ACTP2 RecName: Full=Valyl-tRNA synthetase;       
   20::822     7e-22  27%  955 aa  SYL_METMP RecName: Full=Leucyl-tRNA synthetase;       
   20::822     7e-22  27%  955 aa  SYL_METM7 RecName: Full=Leucyl-tRNA synthetase;       
    5::701     7e-22  28% 1018 aa  SYI_ARCFU RecName: Full=Isoleucyl-tRNA synthetase;       
    2::187     9e-22  35%  945 aa  SYV_NEIMB RecName: Full=Valyl-tRNA synthetase;       
   17::699     9e-22  32%  924 aa  SYI_GEOKA RecName: Full=Isoleucyl-tRNA synthetase;       
    5::662     1e-21  30%  953 aa  SYV_VIBCH RecName: Full=Valyl-tRNA synthetase;       
    9::709     1e-21  27%  954 aa  SYV_HAEIE RecName: Full=Valyl-tRNA synthetase;       
    4::357     1e-21  33%  644 aa  SYM_CLOAB RecName: Full=Methionyl-tRNA synthetase;       
    3::417     1e-21  30%  649 aa  SYM_BACST RecName: Full=Methionyl-tRNA synthetase;       
    1::429     1e-21  30%  660 aa  SYM1_BACCR RecName: Full=Methionyl-tRNA synthetase 1;       
   20::629     1e-21  29%  941 aa  SYI_PSYA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::709     1e-21  32%  921 aa  SYI_LISW6 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::692     1e-21  30% 1035 aa  SYI_CLOAB RecName: Full=Isoleucyl-tRNA synthetase;       
   18::634     1e-21  29%  942 aa  SYI_BLOPB RecName: Full=Isoleucyl-tRNA synthetase;       
   46::724     2e-21  34%  812 aa  SYV_RICAH RecName: Full=Valyl-tRNA synthetase;       
   17::194     2e-21  36%  955 aa  SYV_RALEJ RecName: Full=Valyl-tRNA synthetase;       
   20::622     2e-21  29%  955 aa  SYI_VESOH RecName: Full=Isoleucyl-tRNA synthetase;       
   17::714     2e-21  29%  931 aa  SYI_LACS1 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::709     2e-21  33%  924 aa  SYI_GEOTN RecName: Full=Isoleucyl-tRNA synthetase;       
  140::810     3e-21  29% 1093 aa  SYV_NEUCR RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
    5::188     3e-21  37%  839 aa  SYV_MYCMO RecName: Full=Valyl-tRNA synthetase;       
    3::734     3e-21  31%  822 aa  SYV_MYCHJ RecName: Full=Valyl-tRNA synthetase;       
    3::734     3e-21  31%  822 aa  SYV_MYCH7 RecName: Full=Valyl-tRNA synthetase;       
    3::734     3e-21  31%  822 aa  SYV_MYCH2 RecName: Full=Valyl-tRNA synthetase;       
    7::761     3e-21  27%  882 aa  SYV_LEPIC RecName: Full=Valyl-tRNA synthetase;       
   12::200     3e-21  36%  943 aa  SYV_DECAR RecName: Full=Valyl-tRNA synthetase;       
   11::709     3e-21  29%  956 aa  SYV_BUCBP RecName: Full=Valyl-tRNA synthetase;       
    1::429     3e-21  30%  660 aa  SYM1_BACAN RecName: Full=Methionyl-tRNA synthetase 1;       
   17::699     3e-21  33%  923 aa  SYI_GEOSW RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     3e-21  27%  935 aa  SYI_FRAP2 RecName: Full=Isoleucyl-tRNA synthetase;       
    2::187     3e-21  34%  945 aa  SYV_NEIMA RecName: Full=Valyl-tRNA synthetase;       
   18::632     3e-21  27%  940 aa  SYI_SHEPW RecName: Full=Isoleucyl-tRNA synthetase;       
   17::709     3e-21  31%  921 aa  SYI_LISMF RecName: Full=Isoleucyl-tRNA synthetase;       
   17::709     3e-21  31%  921 aa  SYI_LISMC RecName: Full=Isoleucyl-tRNA synthetase;       
   17::709     3e-21  31%  921 aa  SYI_LISIN RecName: Full=Isoleucyl-tRNA synthetase;       
   17::704     3e-21  33%  937 aa  SYI_LACBA RecName: Full=Isoleucyl-tRNA synthetase;       
   10::203     4e-21  34%  913 aa  SYV_THEEB RecName: Full=Valyl-tRNA synthetase;       
   11::204     4e-21  32%  909 aa  SYV_SYNP6 RecName: Full=Valyl-tRNA synthetase;       
   19::720     4e-21  28%  965 aa  SYV_PHOLL RecName: Full=Valyl-tRNA synthetase;       
    7::190     4e-21  34%  882 aa  SYV_LEPIN RecName: Full=Valyl-tRNA synthetase;       
   18::637     4e-21  28%  942 aa  SYI_PSEHT RecName: Full=Isoleucyl-tRNA synthetase;       
    5::706     6e-21  28%  951 aa  SYV_SALTY RecName: Full=Valyl-tRNA synthetase;       
    5::706     6e-21  28%  951 aa  SYV_SALTI RecName: Full=Valyl-tRNA synthetase;       
    5::706     6e-21  28%  951 aa  SYV_SALPA RecName: Full=Valyl-tRNA synthetase;       
    5::706     6e-21  28%  951 aa  SYV_SALCH RecName: Full=Valyl-tRNA synthetase;       
   17::625     6e-21  35%  931 aa  SYI_LACRJ RecName: Full=Isoleucyl-tRNA synthetase;       
  247::901     7e-21  28% 1217 aa  SYVC_TAKRU RecName: Full=Valyl-tRNA synthetase;       
   20::622     7e-21  29%  922 aa  SYI_RUTMC RecName: Full=Isoleucyl-tRNA synthetase;       
    5::662     1e-20  28%  957 aa  SYV_VIBF1 RecName: Full=Valyl-tRNA synthetase;       
   17::184     1e-20  36%  968 aa  SYV_RALSO RecName: Full=Valyl-tRNA synthetase;       
    1::635     1e-20  29%  921 aa  SYV_METCA RecName: Full=Valyl-tRNA synthetase;       
   12::653     1e-20  28%  948 aa  SYV_AZOSE RecName: Full=Valyl-tRNA synthetase;       
    2::420     1e-20  33%  977 aa  SYL_NANEQ RecName: Full=Leucyl-tRNA synthetase;       
   25::653     1e-20  30%  901 aa  SYI_MYCGA RecName: Full=Isoleucyl-tRNA synthetase;       
   17::355     1e-20  32%  932 aa  SYI_LACPL RecName: Full=Isoleucyl-tRNA synthetase;       
   17::710     1e-20  33%  921 aa  SYI_BACSU RecName: Full=Isoleucyl-tRNA synthetase;       
    8::544     1e-20  31%  942 aa  SYV_STRM5 RecName: Full=Valyl-tRNA synthetase;       
    2::414     1e-20  30%  638 aa  SYM_THETN RecName: Full=Methionyl-tRNA synthetase;       
   68::663     1e-20  28%  968 aa  SYI_SYNS3 RecName: Full=Isoleucyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_SHISS RecName: Full=Valyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_SHIFL RecName: Full=Valyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_SHIDS RecName: Full=Valyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_SHIBS RecName: Full=Valyl-tRNA synthetase;       
   10::190     2e-20  36%  918 aa  SYV_NITEU RecName: Full=Valyl-tRNA synthetase;       
    2::187     2e-20  34%  945 aa  SYV_NEIG1 RecName: Full=Valyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_ECOLI RecName: Full=Valyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_ECOL6 RecName: Full=Valyl-tRNA synthetase;       
    5::706     2e-20  28%  951 aa  SYV_ECO57 RecName: Full=Valyl-tRNA synthetase;       
    7::813     2e-20  28%  945 aa  SYL1_SULTO RecName: Full=Leucyl-tRNA synthetase 1;       
   17::709     2e-20  31%  921 aa  SYI_LISMO RecName: Full=Isoleucyl-tRNA synthetase;       
   17::709     2e-20  31%  921 aa  SYI_LISMH RecName: Full=Isoleucyl-tRNA synthetase;       
   57::626     2e-20  31%  921 aa  SYI_KOSOT RecName: Full=Isoleucyl-tRNA synthetase;       
   11::819     2e-20  31%  969 aa  SYL_STAMF RecName: Full=Leucyl-tRNA synthetase;       
   20::902     2e-20  29%  955 aa  SYL_METM5 RecName: Full=Leucyl-tRNA synthetase;       
   17::613     2e-20  34%  896 aa  SYI_ACHLI RecName: Full=Isoleucyl-tRNA synthetase;       
    8::730     3e-20  30%  910 aa  SYV_SYNY3 RecName: Full=Valyl-tRNA synthetase;       
   10::190     3e-20  36%  917 aa  SYV_NITEC RecName: Full=Valyl-tRNA synthetase;       
    5::707     3e-20  29%  960 aa  SYV_BUCAP RecName: Full=Valyl-tRNA synthetase;       
    8::346     3e-20  28%  945 aa  SYL_PYRAE RecName: Full=Leucyl-tRNA synthetase;       
   18::632     3e-20  27%  940 aa  SYI_SHEPA RecName: Full=Isoleucyl-tRNA synthetase;       
   12::661     3e-20  29%  981 aa  SYI_PYRAE RecName: Full=Isoleucyl-tRNA synthetase;       
   17::623     3e-20  33%  933 aa  SYI_PEDPA RecName: Full=Isoleucyl-tRNA synthetase;       
   17::626     3e-20  34%  931 aa  SYI_LACDB RecName: Full=Isoleucyl-tRNA synthetase;       
   17::626     3e-20  34%  931 aa  SYI_LACDA RecName: Full=Isoleucyl-tRNA synthetase;       
   17::700     3e-20  32%  918 aa  SYI1_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 1;       
   10::644     4e-20  30%  926 aa  SYV_NITMU RecName: Full=Valyl-tRNA synthetase;       
   88::690     4e-20  27% 1050 aa  SYV_CAEEL RecName: Full=Valyl-tRNA synthetase;       
    6::863     4e-20  30%  942 aa  SYL_METJA RecName: Full=Leucyl-tRNA synthetase;       
   17::624     4e-20  35%  930 aa  SYI_STRZP RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     4e-20  35%  930 aa  SYI_STRPS RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     4e-20  35%  930 aa  SYI_STRPJ RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     4e-20  35%  930 aa  SYI_STRP7 RecName: Full=Isoleucyl-tRNA synthetase;       
    7::653     4e-20  34% 1058 aa  SYI_METBU RecName: Full=Isoleucyl-tRNA synthetase;       
    7::680     4e-20  32% 1040 aa  SYI_META3 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::615     5e-20  36%  854 aa  SYV_ORITB RecName: Full=Valyl-tRNA synthetase;       
    4::706     5e-20  27%  951 aa  SYV_ERWCT RecName: Full=Valyl-tRNA synthetase;       
    3::501     5e-20  29%  659 aa  SYM_STAHJ RecName: Full=Methionyl-tRNA synthetase;       
   10::650     5e-20  29% 1036 aa  SYI_CLOTE RecName: Full=Isoleucyl-tRNA synthetase;       
   12::600     6e-20  34%  896 aa  SYV_SPHWW RecName: Full=Valyl-tRNA synthetase;       
    5::669     6e-20  28%  953 aa  SYV_PHOPR RecName: Full=Valyl-tRNA synthetase;       
    3::377     6e-20  35%  657 aa  SYM_STAAW RecName: Full=Methionyl-tRNA synthetase;       
    3::377     6e-20  35%  657 aa  SYM_STAAS RecName: Full=Methionyl-tRNA synthetase;       
    3::377     6e-20  35%  657 aa  SYM_STAAR RecName: Full=Methionyl-tRNA synthetase;       
    3::377     6e-20  35%  657 aa  SYM_STAAN RecName: Full=Methionyl-tRNA synthetase;       
    3::377     6e-20  35%  657 aa  SYM_STAAM RecName: Full=Methionyl-tRNA synthetase;       
    3::377     6e-20  35%  657 aa  SYM_STAAC RecName: Full=Methionyl-tRNA synthetase;       
   18::632     6e-20  27%  940 aa  SYI_SHEAM RecName: Full=Isoleucyl-tRNA synthetase;       
   17::645     6e-20  29%  911 aa  SYI_NAUPA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::632     6e-20  30%  932 aa  SYI_LACLA RecName: Full=Isoleucyl-tRNA synthetase;       
    9::716     8e-20  28%  961 aa  SYV_HAEDU RecName: Full=Valyl-tRNA synthetase;       
    5::673     8e-20  28%  920 aa  SYV_COXBU RecName: Full=Valyl-tRNA synthetase;       
    6::770     8e-20  29%  907 aa  SYV_BARHE RecName: Full=Valyl-tRNA synthetase;       
    6::646     8e-20  32%  947 aa  SYV_AGRT5 RecName: Full=Valyl-tRNA synthetase;       
    3::489     8e-20  27%  641 aa  SYM_CLOTE RecName: Full=Methionyl-tRNA synthetase;       
   57::632     8e-20  29%  923 aa  SYI_BRAHW RecName: Full=Isoleucyl-tRNA synthetase;       
   34::737     8e-20  27%  956 aa  SYI_AQUAE RecName: Full=Isoleucyl-tRNA synthetase;       
    6::770     1e-19  30%  907 aa  SYV_BARQU RecName: Full=Valyl-tRNA synthetase;       
    7::645     1e-19  29%  877 aa  SYV_AMOA5 RecName: Full=Valyl-tRNA synthetase;       
   24::825     1e-19  31%  914 aa  SYI_MACCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   17::717     1e-19  33%  920 aa  SYI_ANATD RecName: Full=Isoleucyl-tRNA synthetase;       
   19::720     1e-19  29%  965 aa  SYV_YERPS RecName: Full=Valyl-tRNA synthetase;       
   19::720     1e-19  29%  965 aa  SYV_YERPE RecName: Full=Valyl-tRNA synthetase;       
   29::736     1e-19  28%  984 aa  SYV_PSYA2 RecName: Full=Valyl-tRNA synthetase;       
   67::487     1e-19  31%  950 aa  SYVM_SCHPO RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
    8::841     1e-19  27%  945 aa  SYL_PYRAR RecName: Full=Leucyl-tRNA synthetase;       
    6::784     1e-19  31%  943 aa  SYL_METKA RecName: Full=Leucyl-tRNA synthetase;       
   17::199     1e-19  35%  908 aa  SYI_THEM4 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::624     1e-19  32%  930 aa  SYI_STRA5 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::624     1e-19  32%  930 aa  SYI_STRA3 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::624     1e-19  32%  930 aa  SYI_STRA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::416     2e-19  35%  812 aa  SYV_RICCN RecName: Full=Valyl-tRNA synthetase;       
   46::416     2e-19  35%  812 aa  SYV_RICAE RecName: Full=Valyl-tRNA synthetase;       
   45::609     2e-19  32%  910 aa  SYV_BRUSU RecName: Full=Valyl-tRNA synthetase;       
   17::226     2e-19  33%  911 aa  SYV_BIFLO RecName: Full=Valyl-tRNA synthetase;       
   17::226     2e-19  33%  911 aa  SYV_BIFLI RecName: Full=Valyl-tRNA synthetase;       
   17::226     2e-19  33%  911 aa  SYV_BIFLD RecName: Full=Valyl-tRNA synthetase;       
    3::377     2e-19  35%  656 aa  SYM_STAES RecName: Full=Methionyl-tRNA synthetase;       
    3::377     2e-19  35%  656 aa  SYM_STAEQ RecName: Full=Methionyl-tRNA synthetase;       
   25::636     2e-19  26%  948 aa  SYI_VIBVY RecName: Full=Isoleucyl-tRNA synthetase;       
   25::636     2e-19  26%  948 aa  SYI_VIBVU RecName: Full=Isoleucyl-tRNA synthetase;       
   18::636     2e-19  27%  942 aa  SYI_VIBHB RecName: Full=Isoleucyl-tRNA synthetase;       
   24::830     2e-19  30%  916 aa  SYI_STAHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::659     2e-19  30%  926 aa  SYI_NATTJ RecName: Full=Isoleucyl-tRNA synthetase;       
   19::683     2e-19  32% 1080 aa  SYI_METKA RecName: Full=Isoleucyl-tRNA synthetase;       
   94::807     2e-19  28% 1012 aa  SYIM_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   43::649     2e-19  27%  944 aa  SYV_XANAC RecName: Full=Valyl-tRNA synthetase;       
   12::179     2e-19  35%  969 aa  SYV_HERAR RecName: Full=Valyl-tRNA synthetase;       
   40::573     2e-19  30%  874 aa  SYV_HELPY RecName: Full=Valyl-tRNA synthetase;       
   17::848     2e-19  30%  944 aa  SYL2_SULTO RecName: Full=Leucyl-tRNA synthetase 2;       
    6::829     2e-19  28%  934 aa  SYL1_SULSO RecName: Full=Leucyl-tRNA synthetase 1;       
   17::717     2e-19  33%  920 aa  SYI_CALS8 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::195     3e-19  35%  921 aa  SYV_LEGPH RecName: Full=Valyl-tRNA synthetase;       
    1::195     3e-19  35%  921 aa  SYV_LEGPA RecName: Full=Valyl-tRNA synthetase;       
   45::353     3e-19  31%  910 aa  SYV_BRUME RecName: Full=Valyl-tRNA synthetase;       
    1::810     3e-19  28%  938 aa  SYL1_METS5 RecName: Full=Leucyl-tRNA synthetase 1;       
   29::698     3e-19  33%  910 aa  SYI_THEAB RecName: Full=Isoleucyl-tRNA synthetase;       
   46::775     4e-19  34%  812 aa  SYV_RICRS RecName: Full=Valyl-tRNA synthetase;       
   46::775     4e-19  34%  812 aa  SYV_RICRO RecName: Full=Valyl-tRNA synthetase;       
    1::195     4e-19  35%  921 aa  SYV_LEGPL RecName: Full=Valyl-tRNA synthetase;       
    6::736     4e-19  30%  867 aa  SYV_FERNB RecName: Full=Valyl-tRNA synthetase;       
    3::551     4e-19  29%  658 aa  SYM_STAS1 RecName: Full=Methionyl-tRNA synthetase;       
    7::185     4e-19  38%  673 aa  SYM_OCEIH RecName: Full=Methionyl-tRNA synthetase;       
    8::714     4e-19  27% 1049 aa  SYI_SULIM RecName: Full=Isoleucyl-tRNA synthetase;       
    8::714     4e-19  27% 1049 aa  SYI_SULIA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::723     4e-19  31%  916 aa  SYI_STAES RecName: Full=Isoleucyl-tRNA synthetase;       
   18::632     4e-19  26%  940 aa  SYI_SHEWM RecName: Full=Isoleucyl-tRNA synthetase;       
   18::632     4e-19  28%  940 aa  SYI_SHELP RecName: Full=Isoleucyl-tRNA synthetase;       
   24::625     4e-19  34%  930 aa  SYI_LACF3 RecName: Full=Isoleucyl-tRNA synthetase;       
   11::473     4e-19  35% 1064 aa  SYI_AERPE RecName: Full=Isoleucyl-tRNA synthetase;       
   90::524     4e-19  31% 1000 aa  SYIM_CHICK RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   12::607     5e-19  33%  931 aa  SYV_SPHAL RecName: Full=Valyl-tRNA synthetase;       
   19::585     5e-19  33%  876 aa  SYV_MYCTU RecName: Full=Valyl-tRNA synthetase;       
   19::585     5e-19  33%  876 aa  SYV_MYCBO RecName: Full=Valyl-tRNA synthetase;       
   19::593     5e-19  33%  888 aa  SYV_GLUOX RecName: Full=Valyl-tRNA synthetase;       
   43::623     5e-19  32%  932 aa  SYV_CORJK RecName: Full=Valyl-tRNA synthetase;       
   32::213     5e-19  31%  919 aa  SYV_CORDI RecName: Full=Valyl-tRNA synthetase;       
   22::627     5e-19  32%  886 aa  SYI_MYCH7 RecName: Full=Isoleucyl-tRNA synthetase;       
   19::619     5e-19  34%  912 aa  SYI_FERPE RecName: Full=Isoleucyl-tRNA synthetase;       
   17::623     5e-19  35%  923 aa  SYI_BACSK RecName: Full=Isoleucyl-tRNA synthetase;       
   24::723     7e-19  30%  916 aa  SYI_STAEQ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::723     7e-19  30%  871 aa  SYI_STAEP RecName: Full=Isoleucyl-tRNA synthetase;       
   22::836     7e-19  29%  886 aa  SYI_MYCHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   22::627     7e-19  32%  886 aa  SYI_MYCH2 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::711     7e-19  29%  927 aa  SYI_LACAC RecName: Full=Isoleucyl-tRNA synthetase;       
   12::179     9e-19  37%  998 aa  SYV_AZOSB RecName: Full=Valyl-tRNA synthetase;       
   32::637     9e-19  26%  949 aa  SYI_VIBCM RecName: Full=Isoleucyl-tRNA synthetase;       
   32::637     9e-19  26%  949 aa  SYI_VIBCH RecName: Full=Isoleucyl-tRNA synthetase;       
   32::637     9e-19  26%  949 aa  SYI_VIBC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     9e-19  34%  930 aa  SYI_STRGC RecName: Full=Isoleucyl-tRNA synthetase;       
   22::695     9e-19  32%  861 aa  SYI_MYCPN RecName: Full=Isoleucyl-tRNA synthetase;       
   19::619     9e-19  33%  913 aa  SYI_FERNB RecName: Full=Isoleucyl-tRNA synthetase;       
   46::416     1e-18  34%  812 aa  SYV_RICPU RecName: Full=Valyl-tRNA synthetase;       
   52::594     1e-18  35%  882 aa  SYV_MYCPA RecName: Full=Valyl-tRNA synthetase;       
  104::716     1e-18  30% 1072 aa  SYVC_DICDI RecName: Full=Probable valyl-tRNA synthetase,
    8::430     1e-18  30%  664 aa  SYM_BACSU RecName: Full=Methionyl-tRNA synthetase;       
   17::624     1e-18  30%  930 aa  SYI_STRZT RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     1e-18  30%  930 aa  SYI_STRZJ RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     1e-18  30%  930 aa  SYI_STRPN RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     1e-18  30%  930 aa  SYI_STRPI RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     1e-18  30%  930 aa  SYI_STRP4 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::621     1e-18  33%  911 aa  SYI_EXIS2 RecName: Full=Isoleucyl-tRNA synthetase;       
   18::654     1e-18  29%  953 aa  SYI_BLOFL RecName: Full=Isoleucyl-tRNA synthetase;       
  297::614     2e-18  31% 1263 aa  SYVC_MOUSE RecName: Full=Valyl-tRNA synthetase;       
   24::624     2e-18  35%  930 aa  SYI_STRSV RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     2e-18  30%  930 aa  SYI_STRR6 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::624     2e-18  30%  930 aa  SYI_STRP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   18::638     2e-18  26%  944 aa  SYI_PSYIN RecName: Full=Isoleucyl-tRNA synthetase;       
   94::700     2e-18  34% 1034 aa  SYIM_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
    6::646     2e-18  32%  947 aa  SYV_RHIME RecName: Full=Valyl-tRNA synthetase;       
   12::179     2e-18  34%  965 aa  SYV_JANMA RecName: Full=Valyl-tRNA synthetase;       
   13::591     2e-18  32%  901 aa  SYV_CHLTE RecName: Full=Valyl-tRNA synthetase;       
    7::184     2e-18  33%  942 aa  SYL1_SULAC RecName: Full=Leucyl-tRNA synthetase 1;       
   17::709     2e-18  32%  921 aa  SYI_BACHD RecName: Full=Isoleucyl-tRNA synthetase;       
    1::703     3e-18  30%  950 aa  SYV_PSEAE RecName: Full=Valyl-tRNA synthetase;       
   23::196     3e-18  31%  880 aa  SYV_DEHSC RecName: Full=Valyl-tRNA synthetase;       
   24::850     3e-18  29%  929 aa  SYI_STRTD RecName: Full=Isoleucyl-tRNA synthetase;       
   24::850     3e-18  29%  929 aa  SYI_STRT2 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::850     3e-18  29%  929 aa  SYI_STRT1 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::720     3e-18  27%  919 aa  SYI_ARCB4 RecName: Full=Isoleucyl-tRNA synthetase;       
   12::585     3e-18  34%  884 aa  SYV_ZYMMO RecName: Full=Valyl-tRNA synthetase;       
    1::704     3e-18  29%  951 aa  SYV_PSEHT RecName: Full=Valyl-tRNA synthetase;       
   22::214     3e-18  32%  929 aa  SYV_PROMM RecName: Full=Valyl-tRNA synthetase;       
   25::600     3e-18  34%  893 aa  SYV_NOCFA RecName: Full=Valyl-tRNA synthetase;       
   32::728     3e-18  27%  872 aa  SYV_HELPJ RecName: Full=Valyl-tRNA synthetase;       
    7::684     3e-18  32% 1104 aa  SYI_UNCMA RecName: Full=Isoleucyl-tRNA synthetase;       
   22::643     3e-18  30%  953 aa  SYI_THEEB RecName: Full=Isoleucyl-tRNA synthetase;       
   32::630     3e-18  27%  936 aa  SYI_PROMH RecName: Full=Isoleucyl-tRNA synthetase;       
   26::632     3e-18  26%  932 aa  SYI_PASMU RecName: Full=Isoleucyl-tRNA synthetase;       
   13::651     3e-18  27% 1066 aa  SYI_METLZ RecName: Full=Isoleucyl-tRNA synthetase;       
   29::199     4e-18  32%  886 aa  SYV_MYCLE RecName: Full=Valyl-tRNA synthetase;       
   40::705     4e-18  29%  949 aa  SYV_IDILO RecName: Full=Valyl-tRNA synthetase;       
   24::711     4e-18  33%  933 aa  SYI_STRP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::702     4e-18  33%  916 aa  SYI_STAS1 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::632     4e-18  28%  938 aa  SYI_HAEPS RecName: Full=Isoleucyl-tRNA synthetase;       
   17::199     4e-18  30%  931 aa  SYI_DESRM RecName: Full=Isoleucyl-tRNA synthetase;       
  298::615     6e-18  30% 1264 aa  SYVC_HUMAN RecName: Full=Valyl-tRNA synthetase;       
   18::632     6e-18  26%  940 aa  SYI_SHEHH RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     6e-18  27%  938 aa  SYI_ACTP7 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAW RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAT RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAS RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAR RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAN RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAM RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAE RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAC RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAAB RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAA9 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAA8 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAA3 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI_STAA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::650     8e-18  29% 1038 aa  SYI_CLONN RecName: Full=Isoleucyl-tRNA synthetase;       
    5::641     8e-18  29% 1036 aa  SYI_CHLTR RecName: Full=Isoleucyl-tRNA synthetase;       
   24::828     8e-18  31%  917 aa  SYI1_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
   17::713     1e-17  26%  918 aa  SYI_SULNB RecName: Full=Isoleucyl-tRNA synthetase;       
   29::661     1e-17  35%  965 aa  SYI_PROM5 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::676     1e-17  28% 1118 aa  SYI_EHRRG RecName: Full=Isoleucyl-tRNA synthetase;       
   19::714     1e-17  29% 1056 aa  SYI_BDEBA RecName: Full=Isoleucyl-tRNA synthetase;       
   15::775     1e-17  27%  899 aa  SYV_HELHP RecName: Full=Valyl-tRNA synthetase;       
   27::666     1e-17  32%  903 aa  SYV_CORGL RecName: Full=Valyl-tRNA synthetase;       
  298::615     1e-17  31% 1264 aa  SYVC_RAT RecName: Full=Valyl-tRNA synthetase;       
   27::607     2e-17  32%  903 aa  SYV_COREF RecName: Full=Valyl-tRNA synthetase;       
   18::636     2e-17  27%  942 aa  SYI_VIBPA RecName: Full=Isoleucyl-tRNA synthetase;       
   29::661     2e-17  32%  965 aa  SYI_PROMP RecName: Full=Isoleucyl-tRNA synthetase;       
    9::646     2e-17  30% 1070 aa  SYI_HALSA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::428     2e-17  32%  669 aa  SYM_ENTFA RecName: Full=Methionyl-tRNA synthetase;       
   17::622     2e-17  30%  918 aa  SYI_THENN RecName: Full=Isoleucyl-tRNA synthetase;       
   17::711     2e-17  30%  933 aa  SYI_STRP8 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::711     2e-17  30%  933 aa  SYI_STRP6 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::830     2e-17  31%  915 aa  SYI_STACT RecName: Full=Isoleucyl-tRNA synthetase;       
   29::711     2e-17  27%  939 aa  SYI_DESPS RecName: Full=Isoleucyl-tRNA synthetase;       
   36::241     3e-17  31%  881 aa  SYV_THEFY RecName: Full=Valyl-tRNA synthetase;       
   14::200     3e-17  32%  914 aa  SYV_SYNPX RecName: Full=Valyl-tRNA synthetase;       
   21::695     3e-17  31%  870 aa  SYV_PROAC RecName: Full=Valyl-tRNA synthetase;       
   24::711     3e-17  33%  933 aa  SYI_STRPM RecName: Full=Isoleucyl-tRNA synthetase;       
   24::711     3e-17  30%  933 aa  SYI_STRP1 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::765     4e-17  32%  790 aa  SYV_THEVO RecName: Full=Valyl-tRNA synthetase;       
    9::603     4e-17  32%  906 aa  SYV_CAUCR RecName: Full=Valyl-tRNA synthetase;       
   20::714     4e-17  29%  927 aa  SYI_SYNWW RecName: Full=Isoleucyl-tRNA synthetase;       
   30::664     4e-17  28%  974 aa  SYI_SYNPX RecName: Full=Isoleucyl-tRNA synthetase;       
   21::710     4e-17  32%  938 aa  SYI_SYMTH RecName: Full=Isoleucyl-tRNA synthetase;       
   25::199     5e-17  31%  919 aa  SYI_THEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::199     5e-17  31%  919 aa  SYI_THEMA RecName: Full=Isoleucyl-tRNA synthetase;       
   10::809     5e-17  28% 1045 aa  SYI_METTM RecName: Full=Isoleucyl-tRNA synthetase;       
    8::707     5e-17  30% 1034 aa  SYI_METMP RecName: Full=Isoleucyl-tRNA synthetase;       
   13::657     5e-17  33% 1084 aa  SYI_CHLTE RecName: Full=Isoleucyl-tRNA synthetase;       
   13::325     6e-17  33% 1020 aa  SYV_SILPO RecName: Full=Valyl-tRNA synthetase;       
   30::627     6e-17  27%  932 aa  SYI_SACD2 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::700     6e-17  28% 1049 aa  SYI_METTP RecName: Full=Isoleucyl-tRNA synthetase;       
    5::641     6e-17  29% 1036 aa  SYI_CHLTA RecName: Full=Isoleucyl-tRNA synthetase;       
   43::685     8e-17  28%  980 aa  SYV_XANOM RecName: Full=Valyl-tRNA synthetase;       
    7::705     8e-17  31%  768 aa  SYV_PICTO RecName: Full=Valyl-tRNA synthetase;       
   36::752     8e-17  29%  901 aa  SYV_HALMA RecName: Full=Valyl-tRNA synthetase;       
    2::430     8e-17  30%  665 aa  SYM_LISMF RecName: Full=Methionyl-tRNA synthetase;       
   46::632     8e-17  26%  941 aa  SYI_HAHCH RecName: Full=Isoleucyl-tRNA synthetase;       
   10::648     8e-17  28% 1034 aa  SYI_CLOK5 RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     8e-17  27%  938 aa  SYI_ACTP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   78::273     8e-17  29% 1002 aa  SYIM_YEAST RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   43::685     1e-16  28%  980 aa  SYV_XANOR RecName: Full=Valyl-tRNA synthetase;       
   43::685     1e-16  28%  980 aa  SYV_XANOP RecName: Full=Valyl-tRNA synthetase;       
   13::597     1e-16  33%  811 aa  SYV_SPHEL RecName: Full=Valyl-tRNA synthetase;       
   17::656     1e-16  32%  896 aa  SYV_GRABC RecName: Full=Valyl-tRNA synthetase;       
   11::221     1e-16  34%  676 aa  SYM_METST RecName: Full=Methionyl-tRNA synthetase;       
   22::712     1e-16  32%  933 aa  SYI_FUSNN RecName: Full=Isoleucyl-tRNA synthetase;       
   43::190     1e-16  35%  980 aa  SYV_XANC5 RecName: Full=Valyl-tRNA synthetase;       
    6::308     1e-16  31%  871 aa  SYV_NITSB RecName: Full=Valyl-tRNA synthetase;       
    1::429     1e-16  30%  664 aa  SYM_LISMO RecName: Full=Methionyl-tRNA synthetase;       
    1::429     1e-16  29%  664 aa  SYM_LISIN RecName: Full=Methionyl-tRNA synthetase;       
    9::661     1e-16  31% 1061 aa  SYI_NATPD RecName: Full=Isoleucyl-tRNA synthetase;       
   25::647     1e-16  26%  953 aa  SYI_AERS4 RecName: Full=Isoleucyl-tRNA synthetase;       
   43::190     2e-16  35%  944 aa  SYV_XANCP RecName: Full=Valyl-tRNA synthetase;       
   43::190     2e-16  35%  944 aa  SYV_XANCB RecName: Full=Valyl-tRNA synthetase;       
   43::190     2e-16  35%  944 aa  SYV_XANC8 RecName: Full=Valyl-tRNA synthetase;       
    2::120     2e-16  37%  512 aa  SYM_MYCGE RecName: Full=Methionyl-tRNA synthetase;       
    8::762     2e-16  31% 1100 aa  SYI_TREDE RecName: Full=Isoleucyl-tRNA synthetase;       
   31::663     2e-16  26%  919 aa  SYI_SULDN RecName: Full=Isoleucyl-tRNA synthetase;       
   15::510     2e-16  28% 1094 aa  SYI_RICFE RecName: Full=Isoleucyl-tRNA synthetase;       
   18::632     2e-16  26%  939 aa  SYI_MARAV RecName: Full=Isoleucyl-tRNA synthetase;       
    7::779     2e-16  30% 1044 aa  SYI_BORRA RecName: Full=Isoleucyl-tRNA synthetase;       
   17::700     2e-16  29%  922 aa  SYI_BACLD RecName: Full=Isoleucyl-tRNA synthetase;       
    1::701     2e-16  28%  948 aa  SYV_PSEF5 RecName: Full=Valyl-tRNA synthetase;       
   25::647     2e-16  26%  953 aa  SYI_AERHH RecName: Full=Isoleucyl-tRNA synthetase;       
   18::384     3e-16  37%  683 aa  SYM_LACPL RecName: Full=Methionyl-tRNA synthetase;       
   16::348     3e-16  30%  645 aa  SYM_CLOPE RecName: Full=Methionyl-tRNA synthetase;       
   13::90      3e-16  38% 1022 aa  SYL_IGNH4 RecName: Full=Leucyl-tRNA synthetase;       
   17::710     3e-16  30%  922 aa  SYI_DESHD RecName: Full=Isoleucyl-tRNA synthetase;       
   48::628     4e-16  27%  937 aa  SYI_THISH RecName: Full=Isoleucyl-tRNA synthetase;       
   26::645     4e-16  28%  918 aa  SYI_NITSB RecName: Full=Isoleucyl-tRNA synthetase;       
   37::638     4e-16  26%  938 aa  SYI_MANSM RecName: Full=Isoleucyl-tRNA synthetase;       
   17::710     4e-16  30%  922 aa  SYI_DESHY RecName: Full=Isoleucyl-tRNA synthetase;       
   42::706     5e-16  29%  881 aa  SYV_WIGBR RecName: Full=Valyl-tRNA synthetase;       
   15::540     5e-16  28% 1108 aa  SYI_RICBR RecName: Full=Isoleucyl-tRNA synthetase;       
   15::540     5e-16  28% 1108 aa  SYI_RICB8 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::695     5e-16  29%  888 aa  SYI_MYCPU RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     5e-16  27%  938 aa  SYI_ECOHS RecName: Full=Isoleucyl-tRNA synthetase;       
    8::646     7e-16  30%  791 aa  SYV_THEAC RecName: Full=Valyl-tRNA synthetase;       
   10::207     7e-16  30%  860 aa  SYV_SALTO RecName: Full=Valyl-tRNA synthetase;       
   25::216     7e-16  34%  960 aa  SYV_BORPE RecName: Full=Valyl-tRNA synthetase;       
   25::216     7e-16  34%  960 aa  SYV_BORPA RecName: Full=Valyl-tRNA synthetase;       
   25::216     7e-16  34%  960 aa  SYV_BORBR RecName: Full=Valyl-tRNA synthetase;       
   14::227     7e-16  31%  702 aa  SYM_PROVI RecName: Full=Methionyl-tRNA synthetase;       
   11::220     7e-16  34%  660 aa  SYM_METS3 RecName: Full=Methionyl-tRNA synthetase;       
   20::627     7e-16  26%  934 aa  SYI_TERTT RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     7e-16  27%  938 aa  SYI_SHIDS RecName: Full=Isoleucyl-tRNA synthetase;       
   19::700     7e-16  28%  907 aa  SYI_METI4 RecName: Full=Isoleucyl-tRNA synthetase;       
    7::779     7e-16  30% 1044 aa  SYI_BORDL RecName: Full=Isoleucyl-tRNA synthetase;       
    1::701     9e-16  27%  948 aa  SYV_PSEU2 RecName: Full=Valyl-tRNA synthetase;       
    1::701     9e-16  27%  948 aa  SYV_PSEPK RecName: Full=Valyl-tRNA synthetase;       
    2::172     9e-16  30%  508 aa  SYM_RICPR RecName: Full=Methionyl-tRNA synthetase;       
   14::225     9e-16  31%  700 aa  SYM_PELPB RecName: Full=Methionyl-tRNA synthetase;       
   20::637     9e-16  24%  920 aa  SYI_HELPG RecName: Full=Isoleucyl-tRNA synthetase;       
   17::411     9e-16  31%  930 aa  SYI_DESAP RecName: Full=Isoleucyl-tRNA synthetase;       
   21::513     9e-16  26% 1052 aa  SYI_CORDI RecName: Full=Isoleucyl-tRNA synthetase;       
   19::381     1e-15  34%  509 aa  SYM_RICBR RecName: Full=Methionyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_SHISS RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  26%  938 aa  SYI_SHIFL RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_SHIB3 RecName: Full=Isoleucyl-tRNA synthetase;       
   29::663     1e-15  30%  968 aa  SYI_PROMM RecName: Full=Isoleucyl-tRNA synthetase;       
   20::637     1e-15  22%  920 aa  SYI_HELP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ESCF3 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECOSE RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECOLU RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECOLI RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECODH RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECOBW RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECO8A RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECO55 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-15  27%  938 aa  SYI_ECO24 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::701     2e-15  28%  948 aa  SYV_PSESM RecName: Full=Valyl-tRNA synthetase;       
    1::701     2e-15  27%  948 aa  SYV_PSE14 RecName: Full=Valyl-tRNA synthetase;       
   14::687     2e-15  32% 1134 aa  SYI_WOLTR RecName: Full=Isoleucyl-tRNA synthetase;       
   18::623     2e-15  29% 1028 aa  SYI_THEVO RecName: Full=Isoleucyl-tRNA synthetase;       
   15::510     2e-15  27% 1086 aa  SYI_RICTY RecName: Full=Isoleucyl-tRNA synthetase;       
   59::618     2e-15  33%  900 aa  SYI_ONYPE RecName: Full=Isoleucyl-tRNA synthetase;       
   57::695     2e-15  34%  895 aa  SYI_MYCGE RecName: Full=Isoleucyl-tRNA synthetase;       
    2::172     2e-15  29%  507 aa  SYM_RICTY RecName: Full=Methionyl-tRNA synthetase;       
    2::373     2e-15  32%  515 aa  SYM_BRUSU RecName: Full=Methionyl-tRNA synthetase;       
   30::632     2e-15  26%  940 aa  SYI_SHESA RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     2e-15  27%  938 aa  SYI_ECOLC RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     2e-15  29%  945 aa  SYI_BURXL RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     2e-15  29%  945 aa  SYI_BURPP RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     2e-15  28%  945 aa  SYI_BURP8 RecName: Full=Isoleucyl-tRNA synthetase;       
   19::202     3e-15  29%  874 aa  SYV_STRCO RecName: Full=Valyl-tRNA synthetase;       
    7::579     3e-15  31%  855 aa  SYV_SOLUE RecName: Full=Valyl-tRNA synthetase;       
   10::207     3e-15  29%  862 aa  SYV_SALAI RecName: Full=Valyl-tRNA synthetase;       
   19::353     3e-15  33%  508 aa  SYM_RICCN RecName: Full=Methionyl-tRNA synthetase;       
    2::373     3e-15  32%  515 aa  SYM_BRUME RecName: Full=Methionyl-tRNA synthetase;       
   30::632     3e-15  26%  940 aa  SYI_SHESM RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     3e-15  26%  938 aa  SYI_ECOSM RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     3e-15  26%  938 aa  SYI_ECO7I RecName: Full=Isoleucyl-tRNA synthetase;       
   43::190     4e-15  33%  994 aa  SYV_XYLFT RecName: Full=Valyl-tRNA synthetase;       
   43::190     4e-15  32%  991 aa  SYV_XYLFM RecName: Full=Valyl-tRNA synthetase;       
   43::190     4e-15  33%  994 aa  SYV_XYLF2 RecName: Full=Valyl-tRNA synthetase;       
   10::205     4e-15  34%  776 aa  SYM_NANEQ RecName: Full=Methionyl-tRNA synthetase;       
   46::631     4e-15  27%  938 aa  SYI_SHIBS RecName: Full=Isoleucyl-tRNA synthetase;       
    8::866     4e-15  26% 1058 aa  SYI_METBF RecName: Full=Isoleucyl-tRNA synthetase;       
   26::207     4e-15  28% 1120 aa  SYI_EHRCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     4e-15  26%  938 aa  SYI_ECO5E RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     4e-15  26%  938 aa  SYI_ECO57 RecName: Full=Isoleucyl-tRNA synthetase;       
   75::788     4e-15  29%  993 aa  SYIM_MACFA RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   94::258     4e-15  29% 1012 aa  SYIM_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   25::586     5e-15  32%  874 aa  SYV_STRAW RecName: Full=Valyl-tRNA synthetase;       
   10::580     5e-15  29%  884 aa  SYV_DESVH RecName: Full=Valyl-tRNA synthetase;       
    2::353     5e-15  32%  512 aa  SYM_RICFE RecName: Full=Methionyl-tRNA synthetase;       
    9::207     5e-15  36%  540 aa  SYM1_ALKOO RecName: Full=Methionyl-tRNA synthetase 1;       
   29::199     5e-15  30%  911 aa  SYI_THELT RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     5e-15  26%  940 aa  SYI_SHEON RecName: Full=Isoleucyl-tRNA synthetase;       
   18::642     5e-15  25%  954 aa  SYI_PHOPR RecName: Full=Isoleucyl-tRNA synthetase;       
    8::648     5e-15  28% 1059 aa  SYI_METMJ RecName: Full=Isoleucyl-tRNA synthetase;       
   20::637     5e-15  23%  920 aa  SYI_HELPH RecName: Full=Isoleucyl-tRNA synthetase;       
    7::656     5e-15  32% 1262 aa  SYIC_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   47::210     6e-15  35%  856 aa  SYV_TROWT RecName: Full=Valyl-tRNA synthetase;       
   47::210     6e-15  35%  856 aa  SYV_TROW8 RecName: Full=Valyl-tRNA synthetase;       
    2::122     6e-15  36%  512 aa  SYM_MYCPN RecName: Full=Methionyl-tRNA synthetase;       
    4::238     6e-15  29%  672 aa  SYM_META3 RecName: Full=Methionyl-tRNA synthetase;       
   30::632     6e-15  27%  940 aa  SYI_SHESR RecName: Full=Isoleucyl-tRNA synthetase;       
   18::636     6e-15  27%  942 aa  SYI_PSEA6 RecName: Full=Isoleucyl-tRNA synthetase;       
    6::193     6e-15  28% 1059 aa  SYI_HALWD RecName: Full=Isoleucyl-tRNA synthetase;       
   32::631     6e-15  27%  938 aa  SYI_ERWT9 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     6e-15  25%  938 aa  SYI_ECOL6 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     6e-15  25%  938 aa  SYI_ECOL5 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     6e-15  25%  938 aa  SYI_ECO81 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     6e-15  25%  938 aa  SYI_ECO27 RecName: Full=Isoleucyl-tRNA synthetase;       
   43::190     8e-15  32%  994 aa  SYV_XYLFA RecName: Full=Valyl-tRNA synthetase;       
   19::601     8e-15  35%  823 aa  SYV_AERPE RecName: Full=Valyl-tRNA synthetase;       
   30::631     8e-15  27%  938 aa  SYI_YERP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   21::705     8e-15  29%  971 aa  SYI_ACAM1 RecName: Full=Isoleucyl-tRNA synthetase;       
    7::656     8e-15  31% 1262 aa  SYIC_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   30::631     1e-14  26%  938 aa  SYI_YERPY RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPS RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPP RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPN RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPG RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPE RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPB RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-14  26%  938 aa  SYI_YERPA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::637     1e-14  23%  920 aa  SYI_HELPS RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-14  26%  938 aa  SYI_ECOUT RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-14  26%  938 aa  SYI_ECOK1 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     1e-14  26%  938 aa  SYI_ECO45 RecName: Full=Isoleucyl-tRNA synthetase;       
    2::181     1e-14  30%  665 aa  SYM_STRP3 RecName: Full=Methionyl-tRNA synthetase;       
   14::225     1e-14  30%  702 aa  SYM_CHLL2 RecName: Full=Methionyl-tRNA synthetase;       
   14::195     1e-14  31% 1111 aa  SYI_WOLPM RecName: Full=Isoleucyl-tRNA synthetase;       
   49::622     1e-14  34%  919 aa  SYI_PETMO RecName: Full=Isoleucyl-tRNA synthetase;       
   11::648     1e-14  30% 1062 aa  SYI_METHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   38::660     1e-14  32%  958 aa  SYI_JANMA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::637     1e-14  23%  920 aa  SYI_HELPY RecName: Full=Isoleucyl-tRNA synthetase;       
   15::691     1e-14  27% 1024 aa  SYI2_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
   69::682     2e-14  29%  956 aa  SYV_TREPA RecName: Full=Valyl-tRNA synthetase;       
   21::196     2e-14  32%  897 aa  SYI_MYCS5 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::740     2e-14  27%  921 aa  SYI_CAMHC RecName: Full=Isoleucyl-tRNA synthetase;       
   31::628     2e-14  29%  923 aa  SYI_GEOSL RecName: Full=Isoleucyl-tRNA synthetase;       
   20::357     2e-14  26%  938 aa  SYI_DESVM RecName: Full=Isoleucyl-tRNA synthetase;       
   21::601     2e-14  32% 1054 aa  SYI_COREF RecName: Full=Isoleucyl-tRNA synthetase;       
   13::658     2e-14  31% 1101 aa  SYI_ANAMM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::410     3e-14  32%  521 aa  SYM_UREPA RecName: Full=Methionyl-tRNA synthetase;       
    5::426     3e-14  30%  662 aa  SYM_LACLA RecName: Full=Methionyl-tRNA synthetase;       
   14::230     3e-14  30%  700 aa  SYM_CHLT3 RecName: Full=Methionyl-tRNA synthetase;       
   46::633     3e-14  26%  944 aa  SYI_SALTY RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     3e-14  26%  937 aa  SYI_HAES2 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::207     3e-14  28% 1117 aa  SYI_EHRRW RecName: Full=Isoleucyl-tRNA synthetase;       
   24::652     3e-14  30%  953 aa  SYI_BORA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::247     4e-14  28%  622 aa  SYMM_NEUCR RecName: Full=Probable methionyl-tRNA synthetase,
   46::633     4e-14  26%  944 aa  SYI_SALTI RecName: Full=Isoleucyl-tRNA synthetase;       
   46::633     4e-14  26%  944 aa  SYI_SALPK RecName: Full=Isoleucyl-tRNA synthetase;       
   46::633     4e-14  26%  944 aa  SYI_SALPA RecName: Full=Isoleucyl-tRNA synthetase;       
   46::633     4e-14  26%  944 aa  SYI_SALG2 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::633     4e-14  26%  944 aa  SYI_SALEP RecName: Full=Isoleucyl-tRNA synthetase;       
   46::633     4e-14  26%  944 aa  SYI_SALCH RecName: Full=Isoleucyl-tRNA synthetase;       
   25::631     4e-14  28%  937 aa  SYI_PHOLL RecName: Full=Isoleucyl-tRNA synthetase;       
   58::632     4e-14  28%  940 aa  SYI_NITOC RecName: Full=Isoleucyl-tRNA synthetase;       
   20::725     4e-14  27%  937 aa  SYI_DESAD RecName: Full=Isoleucyl-tRNA synthetase;       
   11::653     4e-14  27% 1039 aa  SYI_CLOPE RecName: Full=Isoleucyl-tRNA synthetase;       
    2::181     5e-14  27%  665 aa  SYM_STRP8 RecName: Full=Methionyl-tRNA synthetase;       
    2::372     5e-14  29%  509 aa  SYM_MYCPU RecName: Full=Methionyl-tRNA synthetase;       
   23::658     5e-14  33% 1056 aa  SYI_TROWT RecName: Full=Isoleucyl-tRNA synthetase;       
   23::658     5e-14  33% 1056 aa  SYI_TROW8 RecName: Full=Isoleucyl-tRNA synthetase;       
   33::210     5e-14  28%  970 aa  SYI_SILPO RecName: Full=Isoleucyl-tRNA synthetase;       
    9::196     5e-14  28% 1074 aa  SYI_HALMA RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     5e-14  26%  937 aa  SYI_HAES1 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::631     5e-14  26%  938 aa  SYI_CITK8 RecName: Full=Isoleucyl-tRNA synthetase;       
   80::663     5e-14  35%  973 aa  SYIM_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    3::626     5e-14  31% 1064 aa  SYIC_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
    2::181     7e-14  27%  665 aa  SYM_STRP6 RecName: Full=Methionyl-tRNA synthetase;       
   14::225     7e-14  30%  702 aa  SYM_PELLD RecName: Full=Methionyl-tRNA synthetase;       
   18::638     7e-14  29%  905 aa  SYI_PELUB RecName: Full=Isoleucyl-tRNA synthetase;       
    8::631     7e-14  30% 1072 aa  SYIC_YEAST RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
    7::674     9e-14  30% 1035 aa  SYV_RHOBA RecName: Full=Valyl-tRNA synthetase;       
    2::181     9e-14  27%  665 aa  SYM_STRP1 RecName: Full=Methionyl-tRNA synthetase;       
   12::224     9e-14  31%  668 aa  SYM_METKA RecName: Full=Methionyl-tRNA synthetase;       
    2::776     9e-14  27%  986 aa  SYI_SULSO RecName: Full=Isoleucyl-tRNA synthetase;       
    2::418     1e-13  30%  665 aa  SYM_STRR6 RecName: Full=Methionyl-tRNA synthetase;       
    2::418     1e-13  30%  665 aa  SYM_STRPN RecName: Full=Methionyl-tRNA synthetase;       
   30::631     1e-13  27%  938 aa  SYI_YERE8 RecName: Full=Isoleucyl-tRNA synthetase;       
   55::217     1e-13  31%  999 aa  SYI_NITWN RecName: Full=Isoleucyl-tRNA synthetase;       
   31::349     1e-13  28%  930 aa  SYI_HELHP RecName: Full=Isoleucyl-tRNA synthetase;       
   30::629     1e-13  25%  935 aa  SYI_HAEDU RecName: Full=Isoleucyl-tRNA synthetase;       
   21::734     1e-13  31% 1054 aa  SYI_CORGL RecName: Full=Isoleucyl-tRNA synthetase;       
  104::292     1e-13  30% 1063 aa  SYVM_HUMAN RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   46::631     1e-13  26%  938 aa  SYI_KLEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   15::228     2e-13  27%  703 aa  SYM_CHLTE RecName: Full=Methionyl-tRNA synthetase;       
   62::802     2e-13  28% 1213 aa  SYI_RHOBA RecName: Full=Isoleucyl-tRNA synthetase;       
   29::664     2e-13  31%  969 aa  SYI_PROM4 RecName: Full=Isoleucyl-tRNA synthetase;       
   18::358     2e-13  28%  929 aa  SYI_NEIMF RecName: Full=Isoleucyl-tRNA synthetase;       
    8::866     2e-13  26% 1058 aa  SYI_METMA RecName: Full=Isoleucyl-tRNA synthetase;       
   20::637     2e-13  22%  920 aa  SYI_HELPJ RecName: Full=Isoleucyl-tRNA synthetase;       
   20::416     2e-13  28%  934 aa  SYI_DESDG RecName: Full=Isoleucyl-tRNA synthetase;       
    7::375     3e-13  29%  516 aa  SYM_RHIME RecName: Full=Methionyl-tRNA synthetase;       
   18::220     3e-13  30%  681 aa  SYM_DEIRA RecName: Full=Methionyl-tRNA synthetase;       
    8::677     3e-13  29% 1091 aa  SYI_TREPS RecName: Full=Isoleucyl-tRNA synthetase;       
    8::677     3e-13  29% 1091 aa  SYI_TREPA RecName: Full=Isoleucyl-tRNA synthetase;       
    9::698     3e-13  30% 1043 aa  SYI_THET8 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::698     3e-13  31% 1043 aa  SYI_THET2 RecName: Full=Isoleucyl-tRNA synthetase;       
   48::642     3e-13  27%  948 aa  SYI_EDWI9 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::708     3e-13  31% 1043 aa  SYI_CHLPN RecName: Full=Isoleucyl-tRNA synthetase;       
   24::183     3e-13  26%  953 aa  SYI_BORPD RecName: Full=Isoleucyl-tRNA synthetase;       
   16::201     3e-13  28% 1026 aa  SYI_THEAC RecName: Full=Isoleucyl-tRNA synthetase;       
   41::661     3e-13  30%  959 aa  SYI_HERAR RecName: Full=Isoleucyl-tRNA synthetase;       
   24::548     3e-13  32% 1092 aa  SYI_CORJK RecName: Full=Isoleucyl-tRNA synthetase;       
   25::642     3e-13  31%  939 aa  SYI_AZOSE RecName: Full=Isoleucyl-tRNA synthetase;       
   47::218     4e-13  35%  862 aa  SYV_LEIXX RecName: Full=Valyl-tRNA synthetase;       
    9::119     4e-13  32%  540 aa  SYM_HALOH RecName: Full=Methionyl-tRNA synthetase;       
    9::118     4e-13  34%  544 aa  SYM1_BACC1 RecName: Full=Methionyl-tRNA synthetase 1;       
   15::514     4e-13  31% 1103 aa  SYI_RICAH RecName: Full=Isoleucyl-tRNA synthetase;       
    8::653     4e-13  27% 1058 aa  SYI_METAC RecName: Full=Isoleucyl-tRNA synthetase;       
    8::730     4e-13  29% 1014 aa  SYI_DEHE1 RecName: Full=Isoleucyl-tRNA synthetase;       
   11::237     6e-13  28%  651 aa  SYM_METJA RecName: Full=Methionyl-tRNA synthetase;       
   11::372     6e-13  29%  553 aa  SYM_DEHSC RecName: Full=Methionyl-tRNA synthetase;       
   11::372     6e-13  29%  553 aa  SYM_DEHSB RecName: Full=Methionyl-tRNA synthetase;       
   22::204     6e-13  27% 1042 aa  SYI_NOCFA RecName: Full=Isoleucyl-tRNA synthetase;       
   21::498     6e-13  31% 1059 aa  SYI_MYCLE RecName: Full=Isoleucyl-tRNA synthetase;       
    8::688     6e-13  29% 1014 aa  SYI_DEHSC RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     6e-13  28%  945 aa  SYI_BURM1 RecName: Full=Isoleucyl-tRNA synthetase;       
  104::355     7e-13  33% 1060 aa  SYVM_MOUSE RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
    2::342     7e-13  32%  629 aa  SYM_THEMA RecName: Full=Methionyl-tRNA synthetase;       
   15::730     7e-13  30% 1081 aa  SYI_TETTH RecName: Full=Isoleucyl-tRNA synthetase;       
   15::510     7e-13  32% 1086 aa  SYI_RICPR RecName: Full=Isoleucyl-tRNA synthetase;       
   43::635     7e-13  33%  943 aa  SYI_PSEPW RecName: Full=Isoleucyl-tRNA synthetase;       
   43::635     7e-13  33%  943 aa  SYI_PSEE4 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::637     7e-13  30%  932 aa  SYI_AZOSB RecName: Full=Isoleucyl-tRNA synthetase;       
    9::219     1e-12  27%  559 aa  SYM_KORCO RecName: Full=Methionyl-tRNA synthetase;       
    9::118     1e-12  33%  544 aa  SYM_BACC4 RecName: Full=Methionyl-tRNA synthetase;       
    9::118     1e-12  33%  544 aa  SYM_BACC2 RecName: Full=Methionyl-tRNA synthetase;       
   43::215     1e-12  29%  941 aa  SYI_ZYMMO RecName: Full=Isoleucyl-tRNA synthetase;       
   25::636     1e-12  28%  929 aa  SYI_THIDA RecName: Full=Isoleucyl-tRNA synthetase;       
   59::371     1e-12  27%  943 aa  SYI_STRMK RecName: Full=Isoleucyl-tRNA synthetase;       
   15::499     1e-12  31% 1092 aa  SYI_RICCN RecName: Full=Isoleucyl-tRNA synthetase;       
   43::184     1e-12  28%  943 aa  SYI_PSEPK RecName: Full=Isoleucyl-tRNA synthetase;       
   43::635     1e-12  32%  943 aa  SYI_PSEPG RecName: Full=Isoleucyl-tRNA synthetase;       
   43::184     1e-12  28%  943 aa  SYI_PSEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
   18::358     1e-12  28%  929 aa  SYI_NEIMA RecName: Full=Isoleucyl-tRNA synthetase;       
   12::194     1e-12  29%  538 aa  SYM_STRCO RecName: Full=Methionyl-tRNA synthetase;       
   11::120     1e-12  34%  553 aa  SYM_DEHE1 RecName: Full=Methionyl-tRNA synthetase;       
   17::227     1e-12  29%  705 aa  SYM_CHLCH RecName: Full=Methionyl-tRNA synthetase;       
    9::118     1e-12  33%  544 aa  SYM_BACCQ RecName: Full=Methionyl-tRNA synthetase;       
    9::118     1e-12  33%  544 aa  SYM_BACC7 RecName: Full=Methionyl-tRNA synthetase;       
    9::118     1e-12  33%  544 aa  SYM2_BACCR RecName: Full=Methionyl-tRNA synthetase 2;       
   15::499     1e-12  31% 1092 aa  SYI_RICPU RecName: Full=Isoleucyl-tRNA synthetase;       
   32::184     1e-12  28%  943 aa  SYI_PSEMY RecName: Full=Isoleucyl-tRNA synthetase;       
   18::638     1e-12  30%  944 aa  SYI_IDILO RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     1e-12  30%  945 aa  SYI_BURVG RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     1e-12  27%  945 aa  SYI_BURCM RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     1e-12  30%  945 aa  SYI_BURCC RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     1e-12  27%  945 aa  SYI_BURA4 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::416     2e-12  33%  545 aa  SYM_STRPS RecName: Full=Methionyl-tRNA synthetase;       
    9::416     2e-12  33%  545 aa  SYM_STRP7 RecName: Full=Methionyl-tRNA synthetase;       
    2::344     2e-12  30%  516 aa  SYM_RHILO RecName: Full=Methionyl-tRNA synthetase;       
    4::375     2e-12  31%  516 aa  SYM_AGRT5 RecName: Full=Methionyl-tRNA synthetase;       
   19::638     2e-12  29%  939 aa  SYI_SULSY RecName: Full=Isoleucyl-tRNA synthetase;       
   17::638     2e-12  30%  917 aa  SYI_CAMJR RecName: Full=Isoleucyl-tRNA synthetase;       
   23::678     2e-12  33% 1103 aa  SYI_BIFLO RecName: Full=Isoleucyl-tRNA synthetase;       
    3::221     2e-12  28%  565 aa  SYM_THEPD RecName: Full=Methionyl-tRNA synthetase;       
    2::402     2e-12  30%  636 aa  SYM_FUSNN RecName: Full=Methionyl-tRNA synthetase;       
    9::118     2e-12  33%  544 aa  SYM_BACC3 RecName: Full=Methionyl-tRNA synthetase;       
    9::118     2e-12  33%  544 aa  SYM_BACC0 RecName: Full=Methionyl-tRNA synthetase;       
    9::118     2e-12  33%  544 aa  SYM_BACAC RecName: Full=Methionyl-tRNA synthetase;       
    9::118     2e-12  33%  544 aa  SYM_BACAA RecName: Full=Methionyl-tRNA synthetase;       
    9::118     2e-12  33%  544 aa  SYM2_BACAN RecName: Full=Methionyl-tRNA synthetase 2;       
    9::118     2e-12  33%  544 aa  SYM1_BACHK RecName: Full=Methionyl-tRNA synthetase 1;       
    9::118     2e-12  33%  544 aa  SYM1_BACAH RecName: Full=Methionyl-tRNA synthetase 1;       
   59::371     2e-12  27%  943 aa  SYI_STRM5 RecName: Full=Isoleucyl-tRNA synthetase;       
   18::177     2e-12  29%  929 aa  SYI_NEIG2 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::200     2e-12  28%  937 aa  SYI_LAWIP RecName: Full=Isoleucyl-tRNA synthetase;       
   17::650     2e-12  30%  917 aa  SYI_CAMJE RecName: Full=Isoleucyl-tRNA synthetase;       
   14::225     3e-12  29%  702 aa  SYM_CHLPD RecName: Full=Methionyl-tRNA synthetase;       
    9::118     3e-12  32%  544 aa  SYM_BACWK RecName: Full=Methionyl-tRNA synthetase;       
   42::220     3e-12  28% 1005 aa  SYI_RHOPA RecName: Full=Isoleucyl-tRNA synthetase;       
    9::707     3e-12  31% 1038 aa  SYI_PARUW RecName: Full=Isoleucyl-tRNA synthetase;       
   29::413     3e-12  28%  937 aa  SYI_HYDS0 RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     3e-12  29%  945 aa  SYI_BURTA RecName: Full=Isoleucyl-tRNA synthetase;       
   34::624     4e-12  30%  751 aa  SYV_NANEQ RecName: Full=Valyl-tRNA synthetase;       
  104::296     4e-12  29% 1064 aa  SYVM_MACMU RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   11::121     4e-12  34%  651 aa  SYM_METTH RecName: Full=Methionyl-tRNA synthetase;       
   10::220     4e-12  29%  561 aa  SYM_IGNH4 RecName: Full=Methionyl-tRNA synthetase;       
   15::497     4e-12  31% 1079 aa  SYI_RICCK RecName: Full=Isoleucyl-tRNA synthetase;       
   18::177     4e-12  29%  929 aa  SYI_NEIG1 RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     4e-12  29%  945 aa  SYI_BURCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   42::220     4e-12  28% 1002 aa  SYI_BRAJA RecName: Full=Isoleucyl-tRNA synthetase;       
   25::201     5e-12  28% 1047 aa  SYI_STRAW RecName: Full=Isoleucyl-tRNA synthetase;       
   18::177     5e-12  29%  929 aa  SYI_NEIMB RecName: Full=Isoleucyl-tRNA synthetase;       
   18::177     5e-12  29%  929 aa  SYI_NEIM0 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::640     5e-12  28%  932 aa  SYI_DECAR RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     5e-12  29%  945 aa  SYI_BURS3 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::140     6e-12  30%  570 aa  SYM_PYRAE RecName: Full=Methionyl-tRNA synthetase;       
   15::226     6e-12  27%  689 aa  SYM_CYTH3 RecName: Full=Methionyl-tRNA synthetase;       
   21::631     6e-12  33%  940 aa  SYI_WIGBR RecName: Full=Isoleucyl-tRNA synthetase;       
   15::499     6e-12  31% 1092 aa  SYI_RICAE RecName: Full=Isoleucyl-tRNA synthetase;       
   57::643     6e-12  32%  947 aa  SYI_PERMH RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     6e-12  29%  945 aa  SYI_BURCH RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     6e-12  29%  945 aa  SYI_BURCA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::183     6e-12  26%  953 aa  SYI_BORPE RecName: Full=Isoleucyl-tRNA synthetase;       
   24::183     6e-12  26%  953 aa  SYI_BORPA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::183     6e-12  26%  953 aa  SYI_BORBR RecName: Full=Isoleucyl-tRNA synthetase;       
   36::209     6e-12  28%  967 aa  SYI_AGRT5 RecName: Full=Isoleucyl-tRNA synthetase;       
   11::122     8e-12  33%  600 aa  SYM_CHLAD RecName: Full=Methionyl-tRNA synthetase;       
   43::637     8e-12  31%  943 aa  SYI_PSEFS RecName: Full=Isoleucyl-tRNA synthetase;       
   30::629     8e-12  26%  937 aa  SYI_PECCP RecName: Full=Isoleucyl-tRNA synthetase;       
   11::191     8e-12  29% 1030 aa  SYI2_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 2;       
   43::637     8e-12  33%  943 aa  SYI1_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 1;       
  104::292     1e-11  28% 1065 aa  SYVM_RAT RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
   59::188     1e-11  31%  943 aa  SYI_XYLFT RecName: Full=Isoleucyl-tRNA synthetase;       
   59::647     1e-11  33%  943 aa  SYI_XYLFA RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     1e-11  31%  943 aa  SYI_XYLF2 RecName: Full=Isoleucyl-tRNA synthetase;       
   33::192     1e-11  27%  959 aa  SYI_RALME RecName: Full=Isoleucyl-tRNA synthetase;       
   25::374     1e-11  26%  943 aa  SYI_PSEAE RecName: Full=Isoleucyl-tRNA synthetase;       
   25::374     1e-11  26%  943 aa  SYI_PSEAB RecName: Full=Isoleucyl-tRNA synthetase;       
   25::374     1e-11  26%  943 aa  SYI_PSEA8 RecName: Full=Isoleucyl-tRNA synthetase;       
   47::230     1e-11  30% 1119 aa  SYI_LEIXX RecName: Full=Isoleucyl-tRNA synthetase;       
   58::200     1e-11  29%  938 aa  SYI_DESVV RecName: Full=Isoleucyl-tRNA synthetase;       
   58::200     1e-11  29%  938 aa  SYI_DESVH RecName: Full=Isoleucyl-tRNA synthetase;       
    1::226     1e-11  26%  679 aa  SYM_PARD8 RecName: Full=Methionyl-tRNA synthetase;       
   11::237     1e-11  28%  663 aa  SYM_METMP RecName: Full=Methionyl-tRNA synthetase;       
   11::122     1e-11  33%  600 aa  SYM_CHLSY RecName: Full=Methionyl-tRNA synthetase;       
   11::122     1e-11  33%  600 aa  SYM_CHLAA RecName: Full=Methionyl-tRNA synthetase;       
    5::412     1e-11  28%  497 aa  SYM_AQUAE RecName: Full=Methionyl-tRNA synthetase;       
   42::222     1e-11  31%  590 aa  SYMM_TAKRU RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   59::647     1e-11  33%  943 aa  SYI_XYLFM RecName: Full=Isoleucyl-tRNA synthetase;       
   18::632     1e-11  28%  940 aa  SYI_SHESH RecName: Full=Isoleucyl-tRNA synthetase;       
   25::374     1e-11  26%  943 aa  SYI_PSEA7 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::505     1e-11  31% 1041 aa  SYI_MYCTU RecName: Full=Isoleucyl-tRNA synthetase;       
   26::505     1e-11  31% 1041 aa  SYI_MYCBO RecName: Full=Isoleucyl-tRNA synthetase;       
    5::641     1e-11  31% 1036 aa  SYI_CHLTB RecName: Full=Isoleucyl-tRNA synthetase;       
    5::641     1e-11  31% 1036 aa  SYI_CHLT2 RecName: Full=Isoleucyl-tRNA synthetase;       
    2::376     2e-11  29%  519 aa  SYM_MYCBO RecName: Full=Methionyl-tRNA synthetase;       
   11::237     2e-11  29%  663 aa  SYM_METVS RecName: Full=Methionyl-tRNA synthetase;       
   11::237     2e-11  28%  663 aa  SYM_METM5 RecName: Full=Methionyl-tRNA synthetase;       
   43::635     2e-11  32%  943 aa  SYI_PSEU2 RecName: Full=Isoleucyl-tRNA synthetase;       
   43::635     2e-11  31%  943 aa  SYI_PSE14 RecName: Full=Isoleucyl-tRNA synthetase;       
   29::629     2e-11  30%  927 aa  SYI_PELCD RecName: Full=Isoleucyl-tRNA synthetase;       
   26::185     2e-11  30%  925 aa  SYI_CHRVO RecName: Full=Isoleucyl-tRNA synthetase;       
   31::640     2e-11  29%  916 aa  SYI_CAMFF RecName: Full=Isoleucyl-tRNA synthetase;       
   33::651     2e-11  29%  945 aa  SYI1_BURPS RecName: Full=Isoleucyl-tRNA synthetase 1;       
   33::651     2e-11  29%  945 aa  SYI1_BURMA RecName: Full=Isoleucyl-tRNA synthetase 1;       
    3::140     2e-11  28%  567 aa  SYM_PYRIL RecName: Full=Methionyl-tRNA synthetase;       
   11::237     2e-11  28%  663 aa  SYM_METM7 RecName: Full=Methionyl-tRNA synthetase;       
    5::641     2e-11  31% 1036 aa  SYI_CHLMU RecName: Full=Isoleucyl-tRNA synthetase;       
   70::668     2e-11  32%  969 aa  SYI_CAUCR RecName: Full=Isoleucyl-tRNA synthetase;       
  104::292     3e-11  30% 1062 aa  SYVM_PIG RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
    3::123     3e-11  31%  606 aa  SYM_THEFY RecName: Full=Methionyl-tRNA synthetase;       
   11::224     3e-11  27%  592 aa  SYM_ROSS1 RecName: Full=Methionyl-tRNA synthetase;       
   20::225     3e-11  27%  601 aa  SYM_PROAC RecName: Full=Methionyl-tRNA synthetase;       
    1::226     3e-11  26%  680 aa  SYM_PORGI RecName: Full=Methionyl-tRNA synthetase;       
    1::226     3e-11  26%  680 aa  SYM_PORG3 RecName: Full=Methionyl-tRNA synthetase;       
    7::143     3e-11  30%  710 aa  SYM_HERAR RecName: Full=Methionyl-tRNA synthetase;       
   43::635     3e-11  32%  943 aa  SYI_PSESM RecName: Full=Isoleucyl-tRNA synthetase;       
   36::193     3e-11  30%  915 aa  SYI_LEPBP RecName: Full=Isoleucyl-tRNA synthetase;       
   36::193     3e-11  30%  915 aa  SYI_LEPBA RecName: Full=Isoleucyl-tRNA synthetase;       
   16::192     3e-11  32% 1043 aa  SYI_CHLCV RecName: Full=Isoleucyl-tRNA synthetase;       
   16::644     3e-11  32% 1043 aa  SYI_CHLAB RecName: Full=Isoleucyl-tRNA synthetase;       
    2::346     4e-11  27%  618 aa  SYM_THET8 RecName: Full=Methionyl-tRNA synthetase;       
   18::174     4e-11  32%  650 aa  SYM_HELPY RecName: Full=Methionyl-tRNA synthetase;       
   18::175     4e-11  32%  656 aa  SYM_HELPJ RecName: Full=Methionyl-tRNA synthetase;       
   43::643     4e-11  27%  943 aa  SYI_PSEF5 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::517     4e-11  31% 1053 aa  SYI_MYCPA RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  29%  935 aa  SYI_FRATW RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  28%  935 aa  SYI_FRATT RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  29%  935 aa  SYI_FRATO RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  29%  935 aa  SYI_FRATN RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  28%  935 aa  SYI_FRATM RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  29%  935 aa  SYI_FRATH RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  29%  935 aa  SYI_FRATF RecName: Full=Isoleucyl-tRNA synthetase;       
   32::628     4e-11  28%  935 aa  SYI_FRAT1 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::648     4e-11  27%  938 aa  SYI_DESDA RecName: Full=Isoleucyl-tRNA synthetase;       
    2::702     4e-11  30% 1110 aa  SYI_CYTH3 RecName: Full=Isoleucyl-tRNA synthetase;       
   11::222     5e-11  27%  584 aa  SYM_THERP RecName: Full=Methionyl-tRNA synthetase;       
    6::227     5e-11  27%  686 aa  SYM_FLAPJ RecName: Full=Methionyl-tRNA synthetase;       
   13::142     5e-11  31%  550 aa  SYM_CHLMU RecName: Full=Methionyl-tRNA synthetase;       
   15::143     5e-11  29%  680 aa  SYM_BACV8 RecName: Full=Methionyl-tRNA synthetase;       
   33::192     5e-11  26%  964 aa  SYI_RALEH RecName: Full=Isoleucyl-tRNA synthetase;       
   17::149     7e-11  29%  722 aa  SYM_BURM1 RecName: Full=Methionyl-tRNA synthetase;       
    9::136     7e-11  31%  658 aa  SYM_ARCFU RecName: Full=Methionyl-tRNA synthetase;       
   59::188     7e-11  30%  943 aa  SYI_XANOR RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     7e-11  30%  943 aa  SYI_XANOM RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     7e-11  30%  943 aa  SYI_XANCP RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     7e-11  30%  943 aa  SYI_XANCB RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     7e-11  30%  943 aa  SYI_XANC8 RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     7e-11  30%  943 aa  SYI_XANC5 RecName: Full=Isoleucyl-tRNA synthetase;       
   38::193     7e-11  32%  914 aa  SYI_LEPBL RecName: Full=Isoleucyl-tRNA synthetase;       
   38::193     7e-11  32%  914 aa  SYI_LEPBJ RecName: Full=Isoleucyl-tRNA synthetase;       
   20::635     7e-11  30%  953 aa  SYI_COLP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   63::361     7e-11  29%  972 aa  SYI_BRUAB RecName: Full=Isoleucyl-tRNA synthetase;       
   63::361     7e-11  29%  972 aa  SYI_BRUA2 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::140     9e-11  28%  565 aa  SYM_THENV RecName: Full=Methionyl-tRNA synthetase;       
   11::121     9e-11  31%  592 aa  SYM_ROSCS RecName: Full=Methionyl-tRNA synthetase;       
    2::149     9e-11  26%  689 aa  SYM_POLSJ RecName: Full=Methionyl-tRNA synthetase;       
   59::188     9e-11  30%  943 aa  SYI_XANAC RecName: Full=Isoleucyl-tRNA synthetase;       
   31::188     9e-11  26%  941 aa  SYI_HAEIE RecName: Full=Isoleucyl-tRNA synthetase;       
   31::188     9e-11  26%  941 aa  SYI_HAEI8 RecName: Full=Isoleucyl-tRNA synthetase;       
   30::631     1e-10  31%  940 aa  SYI_MARMS RecName: Full=Isoleucyl-tRNA synthetase;       
   20::369     1e-10  22%  921 aa  SYI_HELAH RecName: Full=Isoleucyl-tRNA synthetase;       
   31::188     1e-10  26%  941 aa  SYI_HAEIN RecName: Full=Isoleucyl-tRNA synthetase;       
   31::188     1e-10  26%  941 aa  SYI_HAEIG RecName: Full=Isoleucyl-tRNA synthetase;       
   36::751     1e-10  26%  966 aa  SYI_CUPTR RecName: Full=Isoleucyl-tRNA synthetase;       
   18::360     1e-10  29%  938 aa  SYI_BAUCH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::140     2e-10  28%  570 aa  SYM_PYRAR RecName: Full=Methionyl-tRNA synthetase;       
    2::376     2e-10  28%  519 aa  SYM_MYCTU RecName: Full=Methionyl-tRNA synthetase;       
   13::142     2e-10  30%  550 aa  SYM_CHLTR RecName: Full=Methionyl-tRNA synthetase;       
   13::142     2e-10  30%  550 aa  SYM_CHLTA RecName: Full=Methionyl-tRNA synthetase;       
    1::143     2e-10  26%  679 aa  SYM_BACTN RecName: Full=Methionyl-tRNA synthetase;       
   31::401     2e-10  32%  575 aa  SYMM_DICDI RecName: Full=Probable methionyl-tRNA synthetase,
   43::184     2e-10  27%  943 aa  SYI_PSEU5 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::185     2e-10  25%  939 aa  SYI_NITEU RecName: Full=Isoleucyl-tRNA synthetase;       
   63::361     2e-10  29%  972 aa  SYI_BRUSU RecName: Full=Isoleucyl-tRNA synthetase;       
   63::361     2e-10  28%  972 aa  SYI_BRUME RecName: Full=Isoleucyl-tRNA synthetase;       
   10::219     2e-10  29%  600 aa  SYM_SALAI RecName: Full=Methionyl-tRNA synthetase;       
    1::227     2e-10  24%  691 aa  SYM_GRAFK RecName: Full=Methionyl-tRNA synthetase;       
    1::227     2e-10  27%  711 aa  SYM_FLAJ1 RecName: Full=Methionyl-tRNA synthetase;       
   13::142     2e-10  30%  550 aa  SYM_CHLTB RecName: Full=Methionyl-tRNA synthetase;       
   13::142     2e-10  30%  550 aa  SYM_CHLT2 RecName: Full=Methionyl-tRNA synthetase;       
   12::140     2e-10  30%  550 aa  SYM_CHLCV RecName: Full=Methionyl-tRNA synthetase;       
   31::631     2e-10  32%  936 aa  SYI_COXBU RecName: Full=Isoleucyl-tRNA synthetase;       
   31::631     2e-10  32%  936 aa  SYI_COXBR RecName: Full=Isoleucyl-tRNA synthetase;       
   31::631     2e-10  32%  936 aa  SYI_COXBN RecName: Full=Isoleucyl-tRNA synthetase;       
   31::631     2e-10  32%  936 aa  SYI_COXB2 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::631     2e-10  32%  936 aa  SYI_COXB1 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::855     2e-10  27% 1141 aa  SYIC_CAEEL RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   15::203     3e-10  31%  680 aa  SYM_PHOPR RecName: Full=Methionyl-tRNA synthetase;       
   15::209     3e-10  31%  669 aa  SYM_METTP RecName: Full=Methionyl-tRNA synthetase;       
    8::207     3e-10  26%  681 aa  SYM_CHRSD RecName: Full=Methionyl-tRNA synthetase;       
    1::226     3e-10  25%  679 aa  SYM_BACFR RecName: Full=Methionyl-tRNA synthetase;       
    1::226     3e-10  25%  679 aa  SYM_BACFN RecName: Full=Methionyl-tRNA synthetase;       
   33::192     3e-10  25%  963 aa  SYI_RALEJ RecName: Full=Isoleucyl-tRNA synthetase;       
    5::136     3e-10  27%  694 aa  SYM_METCA RecName: Full=Methionyl-tRNA synthetase;       
   24::201     3e-10  25%  915 aa  SYI_WOLSU RecName: Full=Isoleucyl-tRNA synthetase;       
   82::681     3e-10  31%  960 aa  SYI_GLUOX RecName: Full=Isoleucyl-tRNA synthetase;       
   14::206     3e-10  31% 1078 aa  SYI_DEIRA RecName: Full=Isoleucyl-tRNA synthetase;       
   43::635     3e-10  30%  943 aa  SYI_AZOVD RecName: Full=Isoleucyl-tRNA synthetase;       
    7::144     4e-10  29%  700 aa  SYM_JANMA RecName: Full=Methionyl-tRNA synthetase;       
    5::220     4e-10  27%  546 aa  SYM_COXBU RecName: Full=Methionyl-tRNA synthetase;       
    5::220     4e-10  27%  546 aa  SYM_COXBR RecName: Full=Methionyl-tRNA synthetase;       
    5::220     4e-10  27%  546 aa  SYM_COXBN RecName: Full=Methionyl-tRNA synthetase;       
    5::220     4e-10  27%  546 aa  SYM_COXB2 RecName: Full=Methionyl-tRNA synthetase;       
    5::220     4e-10  27%  546 aa  SYM_COXB1 RecName: Full=Methionyl-tRNA synthetase;       
   12::140     4e-10  29%  551 aa  SYM_CHLAB RecName: Full=Methionyl-tRNA synthetase;       
   58::156     4e-10  31%  941 aa  SYI_HALHL RecName: Full=Isoleucyl-tRNA synthetase;       
    1::496     4e-10  29%  529 aa  SYI_AQUPY RecName: Full=Isoleucyl-tRNA synthetase;       
   48::200     4e-10  29%  941 aa  SYI_ALHEH RecName: Full=Isoleucyl-tRNA synthetase;       
    2::122     6e-10  29%  532 aa  SYM_SYNY3 RecName: Full=Methionyl-tRNA synthetase;       
   10::220     6e-10  29%  572 aa  SYM_HYPBU RecName: Full=Methionyl-tRNA synthetase;       
   11::121     6e-10  32%  612 aa  SYM_CORK4 RecName: Full=Methionyl-tRNA synthetase;       
   16::389     6e-10  27%  628 aa  SYM_CAMJE RecName: Full=Methionyl-tRNA synthetase;       
   10::115     6e-10  32%  614 aa  SYM_BEUC1 RecName: Full=Methionyl-tRNA synthetase;       
   43::637     6e-10  31%  943 aa  SYI_PSEPF RecName: Full=Isoleucyl-tRNA synthetase;       
   17::188     6e-10  26%  918 aa  SYI_CAMC1 RecName: Full=Isoleucyl-tRNA synthetase;       
   64::209     6e-10  29%  971 aa  SYI_BARQU RecName: Full=Isoleucyl-tRNA synthetase;       
    7::660     6e-10  29% 1067 aa  SYIC_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
   27::595     8e-10  31%  799 aa  SYV_PYRAE RecName: Full=Valyl-tRNA synthetase;       
   13::119     8e-10  32%  547 aa  SYM_THEAC RecName: Full=Methionyl-tRNA synthetase;       
    4::223     8e-10  28%  673 aa  SYM_SHELP RecName: Full=Methionyl-tRNA synthetase;       
   13::123     8e-10  31%  603 aa  SYM_SALTO RecName: Full=Methionyl-tRNA synthetase;       
    3::140     8e-10  28%  570 aa  SYM_PYRCJ RecName: Full=Methionyl-tRNA synthetase;       
   25::201     8e-10  26% 1047 aa  SYI_STRCO RecName: Full=Isoleucyl-tRNA synthetase;       
   18::631     8e-10  29%  924 aa  SYI_DICNV RecName: Full=Isoleucyl-tRNA synthetase;       
   29::201     8e-10  25%  919 aa  SYI_CAMC5 RecName: Full=Isoleucyl-tRNA synthetase;       
   13::119     1e-09  32%  543 aa  SYM_THEVO RecName: Full=Methionyl-tRNA synthetase;       
   10::121     1e-09  34%  600 aa  SYM_KINRD RecName: Full=Methionyl-tRNA synthetase;       
   11::121     1e-09  32%  610 aa  SYM_CORGL RecName: Full=Methionyl-tRNA synthetase;       
   11::121     1e-09  32%  610 aa  SYM_CORGB RecName: Full=Methionyl-tRNA synthetase;       
   18::187     1e-09  25%  938 aa  SYI_BUCAP RecName: Full=Isoleucyl-tRNA synthetase;       
   38::679     1e-09  31%  971 aa  SYI_BARHE RecName: Full=Isoleucyl-tRNA synthetase;       
   29::643     1e-09  34%  945 aa  SYI_ACIAD RecName: Full=Isoleucyl-tRNA synthetase;       
    6::116     1e-09  31%  593 aa  SYM_SACEN RecName: Full=Methionyl-tRNA synthetase;       
   16::162     1e-09  26%  710 aa  SYM_BURXL RecName: Full=Methionyl-tRNA synthetase;       
   21::204     1e-09  24% 1060 aa  SYI_THEFY RecName: Full=Isoleucyl-tRNA synthetase;       
   17::638     1e-09  30%  921 aa  SYI_CAMLR RecName: Full=Isoleucyl-tRNA synthetase;       
   10::754     1e-09  29% 1162 aa  SYI_BACTN RecName: Full=Isoleucyl-tRNA synthetase;       
    2::346     2e-09  30%  537 aa  SYM_MYCLE RecName: Full=Methionyl-tRNA synthetase;       
   17::149     2e-09  25%  718 aa  SYM_BURTA RecName: Full=Methionyl-tRNA synthetase;       
   58::638     2e-09  31%  946 aa  SYI_CHRSD RecName: Full=Isoleucyl-tRNA synthetase;       
   38::109     2e-09  36%  489 aa  SYV_TRIVA RecName: Full=Valyl-tRNA synthetase;       
    4::223     2e-09  28%  679 aa  SYM_SHEPA RecName: Full=Methionyl-tRNA synthetase;       
   14::124     2e-09  31%  613 aa  SYM_COREF RecName: Full=Methionyl-tRNA synthetase;       
   30::632     2e-09  27%  940 aa  SYI_SHESW RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     2e-09  27%  940 aa  SYI_SHEPC RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     2e-09  27%  940 aa  SYI_SHEB5 RecName: Full=Isoleucyl-tRNA synthetase;       
   23::224     3e-09  27%  683 aa  SYM_UNCMA RecName: Full=Methionyl-tRNA synthetase;       
   17::146     3e-09  29%  713 aa  SYM_SALRD RecName: Full=Methionyl-tRNA synthetase;       
   12::121     3e-09  28%  690 aa  SYM_PICTO RecName: Full=Methionyl-tRNA synthetase;       
   27::149     3e-09  32%  718 aa  SYM_BURCJ RecName: Full=Methionyl-tRNA synthetase;       
   30::632     3e-09  27%  940 aa  SYI_SHEB9 RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     3e-09  27%  940 aa  SYI_SHEB8 RecName: Full=Isoleucyl-tRNA synthetase;       
   30::632     3e-09  27%  940 aa  SYI_SHEB2 RecName: Full=Isoleucyl-tRNA synthetase;       
   36::209     3e-09  28%  993 aa  SYI_RHILO RecName: Full=Isoleucyl-tRNA synthetase;       
   30::156     3e-09  29%  937 aa  SYI_ERWCT RecName: Full=Isoleucyl-tRNA synthetase;       
   15::202     4e-09  30%  686 aa  SYM_VIBHB RecName: Full=Methionyl-tRNA synthetase;       
   15::203     4e-09  27%  675 aa  SYM_TOLAT RecName: Full=Methionyl-tRNA synthetase;       
   13::346     4e-09  29%  529 aa  SYM_THEEB RecName: Full=Methionyl-tRNA synthetase;       
   11::121     4e-09  31%  610 aa  SYM_CORDI RecName: Full=Methionyl-tRNA synthetase;       
   27::149     4e-09  32%  718 aa  SYM_BURCH RecName: Full=Methionyl-tRNA synthetase;       
   27::149     4e-09  32%  716 aa  SYM_BURCC RecName: Full=Methionyl-tRNA synthetase;       
   27::149     4e-09  32%  718 aa  SYM_BURCA RecName: Full=Methionyl-tRNA synthetase;       
   25::202     4e-09  27% 1024 aa  SYI_PICTO RecName: Full=Isoleucyl-tRNA synthetase;       
  365::534     4e-09  35%  628 aa  SYI_ANTLO RecName: Full=Isoleucyl-tRNA synthetase;       
    2::221     5e-09  31%  571 aa  SYM_SULTO RecName: Full=Methionyl-tRNA synthetase;       
    1::203     5e-09  27%  675 aa  SYM_PHOLL RecName: Full=Methionyl-tRNA synthetase;       
   10::123     5e-09  29%  595 aa  SYM_NOCSJ RecName: Full=Methionyl-tRNA synthetase;       
    9::223     6e-09  29%  573 aa  SYM_SULSO RecName: Full=Methionyl-tRNA synthetase;       
   13::149     6e-09  27%  706 aa  SYM_NITEU RecName: Full=Methionyl-tRNA synthetase;       
    3::140     6e-09  26%  551 aa  SYM_CHLPN RecName: Full=Methionyl-tRNA synthetase;       
   27::149     6e-09  31%  720 aa  SYM_BURS3 RecName: Full=Methionyl-tRNA synthetase;       
   10::128     6e-09  30%  621 aa  SYM_BIFLI RecName: Full=Methionyl-tRNA synthetase;       
    2::199     6e-09  28%  678 aa  SYM_ACIF5 RecName: Full=Methionyl-tRNA synthetase;       
    2::199     6e-09  28%  678 aa  SYM_ACIF2 RecName: Full=Methionyl-tRNA synthetase;       
   17::98      6e-09  33% 1186 aa  SYLC_CAEEL RecName: Full=Leucyl-tRNA synthetase;       
   16::732     6e-09  27% 1137 aa  SYI_PORGI RecName: Full=Isoleucyl-tRNA synthetase;       
   10::733     6e-09  32% 1141 aa  SYI_BACFR RecName: Full=Isoleucyl-tRNA synthetase;       
   10::733     6e-09  32% 1141 aa  SYI_BACFN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::120     8e-09  28%  722 aa  SYM_PYRAB RecName: Full=Methionyl-tRNA synthetase;       
   13::119     8e-09  30%  663 aa  SYM_METPE RecName: Full=Methionyl-tRNA synthetase;       
   16::132     8e-09  30%  710 aa  SYM_METBF RecName: Full=Methionyl-tRNA synthetase;       
   10::128     8e-09  30%  621 aa  SYM_BIFLO RecName: Full=Methionyl-tRNA synthetase;       
   10::128     8e-09  30%  623 aa  SYM_BIFA0 RecName: Full=Methionyl-tRNA synthetase;       
   29::155     8e-09  32%  939 aa  SYI_METCA RecName: Full=Isoleucyl-tRNA synthetase;       
   15::222     1e-08  28%  686 aa  SYM_VIBSL RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  28%  677 aa  SYM_SALAR RecName: Full=Methionyl-tRNA synthetase;       
   20::165     1e-08  28%  715 aa  SYM_METMA RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_KLEP7 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_KLEP3 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO5E RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO57 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO27 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_CITK8 RecName: Full=Methionyl-tRNA synthetase;       
   23::153     1e-08  28%  582 aa  SYM_CALMQ RecName: Full=Methionyl-tRNA synthetase;       
   27::149     1e-08  28%  721 aa  SYM_BURVG RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURPS RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURP6 RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURP1 RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURP0 RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURMS RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURMA RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURM9 RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  24%  725 aa  SYM_BURM7 RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  29%  720 aa  SYM_BURCM RecName: Full=Methionyl-tRNA synthetase;       
   17::149     1e-08  29%  720 aa  SYM_BURA4 RecName: Full=Methionyl-tRNA synthetase;       
    2::139     1e-08  25%  545 aa  SYM_BUCBP RecName: Full=Methionyl-tRNA synthetase;       
   33::192     1e-08  24%  959 aa  SYI_RALPJ RecName: Full=Isoleucyl-tRNA synthetase;       
   20::207     1e-08  29%  688 aa  SYM_VIBPA RecName: Full=Methionyl-tRNA synthetase;       
   15::202     1e-08  31%  686 aa  SYM_VIBFM RecName: Full=Methionyl-tRNA synthetase;       
   12::148     1e-08  28%  690 aa  SYM_THIDA RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_SHISS RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_SHIFL RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_SHIF8 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_SHIBS RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_SHIB3 RecName: Full=Methionyl-tRNA synthetase;       
    2::149     1e-08  25%  701 aa  SYM_NITEC RecName: Full=Methionyl-tRNA synthetase;       
    3::148     1e-08  25%  689 aa  SYM_LEPCP RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ESCF3 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOUT RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOSM RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOSE RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOLU RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOLI RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOLC RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOL6 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOL5 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOK1 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOHS RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECODH RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECOBW RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO8A RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO81 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO7I RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO55 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO45 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     1e-08  26%  677 aa  SYM_ECO24 RecName: Full=Methionyl-tRNA synthetase;       
   11::116     1e-08  32%  612 aa  SYM_CORJK RecName: Full=Methionyl-tRNA synthetase;       
   15::446     1e-08  25%  577 aa  SYMM_CANAL RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   48::360     1e-08  29%  937 aa  SYI_ALCBS RecName: Full=Isoleucyl-tRNA synthetase;       
   15::202     2e-08  28%  683 aa  SYM_VIBCH RecName: Full=Methionyl-tRNA synthetase;       
   15::202     2e-08  28%  683 aa  SYM_VIBC3 RecName: Full=Methionyl-tRNA synthetase;       
    9::223     2e-08  30%  573 aa  SYM_SULIM RecName: Full=Methionyl-tRNA synthetase;       
    1::131     2e-08  27%  683 aa  SYM_SHEFN RecName: Full=Methionyl-tRNA synthetase;       
   13::121     2e-08  28%  662 aa  SYM_METB6 RecName: Full=Methionyl-tRNA synthetase;       
   36::163     2e-08  27%  741 aa  SYM_HALWD RecName: Full=Methionyl-tRNA synthetase;       
   19::146     2e-08  27%  717 aa  SYM_HALMA RecName: Full=Methionyl-tRNA synthetase;       
    1::203     2e-08  26%  676 aa  SYM_ERWCT RecName: Full=Methionyl-tRNA synthetase;       
   10::128     2e-08  30%  620 aa  SYM_BIFAA RecName: Full=Methionyl-tRNA synthetase;       
   46::631     2e-08  29%  938 aa  SYI_ENTS8 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::221     2e-08  32%  571 aa  SYM_SULAC RecName: Full=Methionyl-tRNA synthetase;       
    4::223     2e-08  27%  679 aa  SYM_SHEHH RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-08  26%  689 aa  SYM_SHEB9 RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-08  26%  689 aa  SYM_SHEB8 RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-08  26%  689 aa  SYM_SHEB5 RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-08  26%  689 aa  SYM_SHEB2 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALTY RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALTI RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALSV RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALPK RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALPC RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALPB RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALPA RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALNS RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALHS RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALG2 RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALEP RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALDC RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALCH RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_SALA4 RecName: Full=Methionyl-tRNA synthetase;       
    3::120     2e-08  27%  723 aa  SYM_PYRHO RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  26%  676 aa  SYM_PECCP RecName: Full=Methionyl-tRNA synthetase;       
   13::207     2e-08  28%  664 aa  SYM_METMJ RecName: Full=Methionyl-tRNA synthetase;       
    1::202     2e-08  25%  677 aa  SYM_ENT38 RecName: Full=Methionyl-tRNA synthetase;       
   12::140     2e-08  28%  551 aa  SYM_CHLFF RecName: Full=Methionyl-tRNA synthetase;       
   35::673     2e-08  29% 1114 aa  SYI_PROAC RecName: Full=Isoleucyl-tRNA synthetase;       
   24::664     2e-08  33%  957 aa  SYI_LARHH RecName: Full=Isoleucyl-tRNA synthetase;       
   15::142     3e-08  29%  686 aa  SYM_VIBF1 RecName: Full=Methionyl-tRNA synthetase;       
   15::202     3e-08  27%  677 aa  SYM_SHIDS RecName: Full=Methionyl-tRNA synthetase;       
    2::149     3e-08  26%  688 aa  SYM_RALSO RecName: Full=Methionyl-tRNA synthetase;       
    3::139     3e-08  24%  697 aa  SYM_METPP RecName: Full=Methionyl-tRNA synthetase;       
   20::165     3e-08  27%  712 aa  SYM_METAC RecName: Full=Methionyl-tRNA synthetase;       
    2::205     3e-08  25%  678 aa  SYM_MARAV RecName: Full=Methionyl-tRNA synthetase;       
    1::202     3e-08  26%  677 aa  SYM_ENTS8 RecName: Full=Methionyl-tRNA synthetase;       
    2::149     3e-08  27%  688 aa  SYM_CUPTR RecName: Full=Methionyl-tRNA synthetase;       
   15::202     3e-08  26%  547 aa  SYM_BAUCH RecName: Full=Methionyl-tRNA synthetase;       
   46::631     3e-08  31%  938 aa  SYI_SERP5 RecName: Full=Isoleucyl-tRNA synthetase;       
   49::629     3e-08  34%  931 aa  SYI_LEGPL RecName: Full=Isoleucyl-tRNA synthetase;       
   49::629     3e-08  34%  931 aa  SYI_LEGPH RecName: Full=Isoleucyl-tRNA synthetase;       
   49::629     3e-08  33%  931 aa  SYI_LEGPC RecName: Full=Isoleucyl-tRNA synthetase;       
   49::629     3e-08  33%  931 aa  SYI_LEGPA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::203     4e-08  27%  676 aa  SYM_SHEON RecName: Full=Methionyl-tRNA synthetase;       
    7::149     4e-08  23%  577 aa  SYM_RUBXD RecName: Full=Methionyl-tRNA synthetase;       
    2::149     4e-08  27%  686 aa  SYM_RALEH RecName: Full=Methionyl-tRNA synthetase;       
    3::140     4e-08  26%  741 aa  SYM_PYRKO RecName: Full=Methionyl-tRNA synthetase;       
   11::120     4e-08  28%  724 aa  SYM_PYRFU RecName: Full=Methionyl-tRNA synthetase;       
   15::203     4e-08  26%  686 aa  SYM_PSYIN RecName: Full=Methionyl-tRNA synthetase;       
   17::215     4e-08  26%  692 aa  SYM_METFK RecName: Full=Methionyl-tRNA synthetase;       
   11::121     4e-08  31%  611 aa  SYM_CORU7 RecName: Full=Methionyl-tRNA synthetase;       
   32::151     4e-08  29%  938 aa  SYI_SODGM RecName: Full=Isoleucyl-tRNA synthetase;       
    4::203     5e-08  27%  676 aa  SYM_SHESR RecName: Full=Methionyl-tRNA synthetase;       
    4::203     5e-08  27%  676 aa  SYM_SHESM RecName: Full=Methionyl-tRNA synthetase;       
    4::203     5e-08  27%  676 aa  SYM_SHESA RecName: Full=Methionyl-tRNA synthetase;       
    2::149     5e-08  27%  688 aa  SYM_RALEJ RecName: Full=Methionyl-tRNA synthetase;       
    5::150     5e-08  25%  678 aa  SYM_PSEMY RecName: Full=Methionyl-tRNA synthetase;       
   15::123     5e-08  29%  675 aa  SYM_PROMH RecName: Full=Methionyl-tRNA synthetase;       
   18::133     5e-08  28%  698 aa  SYM_NATPD RecName: Full=Methionyl-tRNA synthetase;       
   15::142     5e-08  28%  686 aa  SYM_ALISL RecName: Full=Methionyl-tRNA synthetase;       
    1::131     7e-08  24%  679 aa  SYM_SODGM RecName: Full=Methionyl-tRNA synthetase;       
    4::202     7e-08  26%  692 aa  SYM_SHESH RecName: Full=Methionyl-tRNA synthetase;       
    2::129     7e-08  27%  688 aa  SYM_DIAST RecName: Full=Methionyl-tRNA synthetase;       
    2::129     7e-08  27%  688 aa  SYM_ACISJ RecName: Full=Methionyl-tRNA synthetase;       
   37::217     7e-08  27%  464 aa  SYC_IGNH4 RecName: Full=Cysteinyl-tRNA synthetase;       
    2::104     9e-08  26%  550 aa  SYM_WIGBR RecName: Full=Methionyl-tRNA synthetase;       
   20::207     9e-08  27%  690 aa  SYM_VIBVY RecName: Full=Methionyl-tRNA synthetase;       
   20::207     9e-08  27%  690 aa  SYM_VIBVU RecName: Full=Methionyl-tRNA synthetase;       
    5::145     9e-08  24%  691 aa  SYM_VEREI RecName: Full=Methionyl-tRNA synthetase;       
    5::202     9e-08  27%  680 aa  SYM_THICR RecName: Full=Methionyl-tRNA synthetase;       
    1::199     9e-08  25%  676 aa  SYM_ERWT9 RecName: Full=Methionyl-tRNA synthetase;       
   44::426     9e-08  29%  562 aa  SYMM_XENLA RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   17::160     9e-08  33%  457 aa  SYC_DEHSB RecName: Full=Cysteinyl-tRNA synthetase;       
    1::202     1e-07  26%  675 aa  SYM_SERP5 RecName: Full=Methionyl-tRNA synthetase;       
    3::148     1e-07  24%  723 aa  SYM_AZOSB RecName: Full=Methionyl-tRNA synthetase;       
    4::129     1e-07  25%  706 aa  SYM_ACIAC RecName: Full=Methionyl-tRNA synthetase;       
   58::668     1e-07  28%  967 aa  SYI2_BURPS RecName: Full=Isoleucyl-tRNA synthetase 2;       
   58::668     1e-07  28%  967 aa  SYI2_BURMA RecName: Full=Isoleucyl-tRNA synthetase 2;       
    4::144     2e-07  23%  688 aa  SYM_SHEWM RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-07  24%  675 aa  SYM_SHEAM RecName: Full=Methionyl-tRNA synthetase;       
    2::149     2e-07  26%  690 aa  SYM_RALME RecName: Full=Methionyl-tRNA synthetase;       
    2::114     2e-07  26%  707 aa  SYM_POLNA RecName: Full=Methionyl-tRNA synthetase;       
    1::227     2e-07  27%  698 aa  SYM_PARUW RecName: Full=Methionyl-tRNA synthetase;       
    3::225     2e-07  24%  728 aa  SYM_NITMU RecName: Full=Methionyl-tRNA synthetase;       
   13::207     2e-07  26%  673 aa  SYM_METLZ RecName: Full=Methionyl-tRNA synthetase;       
    8::205     2e-07  26%  686 aa  SYM_ALCBS RecName: Full=Methionyl-tRNA synthetase;       
   50::632     2e-07  28%  941 aa  SYI_BUCCC RecName: Full=Isoleucyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPY RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPS RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPP RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPN RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPG RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPE RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPB RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERPA RecName: Full=Methionyl-tRNA synthetase;       
    6::203     2e-07  28%  675 aa  SYM_YERP3 RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-07  26%  689 aa  SYM_SHESW RecName: Full=Methionyl-tRNA synthetase;       
    4::144     2e-07  26%  689 aa  SYM_SHEPC RecName: Full=Methionyl-tRNA synthetase;       
   12::129     2e-07  26%  674 aa  SYM_NITOC RecName: Full=Methionyl-tRNA synthetase;       
   23::396     2e-07  27%  575 aa  SYMM_YEAST RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   14::101     2e-07  33% 1176 aa  SYLC_PONAB RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   14::101     2e-07  33% 1176 aa  SYLC_HUMAN RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   38::193     2e-07  27%  914 aa  SYI_LEPIC RecName: Full=Isoleucyl-tRNA synthetase;       
    2::200     3e-07  26%  550 aa  SYM_RUTMC RecName: Full=Methionyl-tRNA synthetase;       
    3::223     3e-07  27%  572 aa  SYM_AERPE RecName: Full=Methionyl-tRNA synthetase;       
    3::221     4e-07  24%  733 aa  SYM_THEON RecName: Full=Methionyl-tRNA synthetase;       
    3::148     4e-07  24%  696 aa  SYM_DECAR RecName: Full=Methionyl-tRNA synthetase;       
    6::203     5e-07  26%  675 aa  SYM_YERE8 RecName: Full=Methionyl-tRNA synthetase;       
    3::129     5e-07  24%  673 aa  SYM_PSEHT RecName: Full=Methionyl-tRNA synthetase;       
    3::139     5e-07  25%  684 aa  SYM_NEIG1 RecName: Full=Methionyl-tRNA synthetase;       
   15::137     6e-07  27%  547 aa  SYM_BUCAT RecName: Full=Methionyl-tRNA synthetase;       
   15::137     6e-07  27%  547 aa  SYM_BUCAI RecName: Full=Methionyl-tRNA synthetase;       
   15::137     6e-07  27%  547 aa  SYM_BUCA5 RecName: Full=Methionyl-tRNA synthetase;       
    3::148     6e-07  26%  675 aa  SYM_ALHEH RecName: Full=Methionyl-tRNA synthetase;       
   15::204     6e-07  28%  677 aa  SYM_AERHH RecName: Full=Methionyl-tRNA synthetase;       
   37::147     6e-07  28%  472 aa  SYC_AERPE RecName: Full=Cysteinyl-tRNA synthetase;       
   12::225     8e-07  26%  696 aa  SYM_XANCP RecName: Full=Methionyl-tRNA synthetase;       
   12::225     8e-07  26%  694 aa  SYM_XANCB RecName: Full=Methionyl-tRNA synthetase;       
   12::225     8e-07  26%  696 aa  SYM_XANC8 RecName: Full=Methionyl-tRNA synthetase;       
   12::115     8e-07  28%  681 aa  SYM_LEPBP RecName: Full=Methionyl-tRNA synthetase;       
   12::115     8e-07  28%  681 aa  SYM_LEPBA RecName: Full=Methionyl-tRNA synthetase;       
    2::140     8e-07  25%  734 aa  SYM_BORBU RecName: Full=Methionyl-tRNA synthetase;       
    3::148     8e-07  25%  718 aa  SYM_AZOSE RecName: Full=Methionyl-tRNA synthetase;       
   10::96      8e-07  29% 1058 aa  SYLC_DICDI RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;    
   38::193     8e-07  26%  914 aa  SYI_LEPIN RecName: Full=Isoleucyl-tRNA synthetase;       
   12::139     1e-06  29%  679 aa  SYM_RHOBA RecName: Full=Methionyl-tRNA synthetase;       
   13::214     1e-06  25%  664 aa  SYM_METHJ RecName: Full=Methionyl-tRNA synthetase;       
   11::117     1e-06  29%  572 aa  SYM_MARMM RecName: Full=Methionyl-tRNA synthetase;       
    4::141     1e-06  25%  684 aa  SYM_HAEDU RecName: Full=Methionyl-tRNA synthetase;       
    2::140     1e-06  25%  734 aa  SYM_BORBZ RecName: Full=Methionyl-tRNA synthetase;       
    1::144     1e-06  22%  685 aa  SYM_ACTSZ RecName: Full=Methionyl-tRNA synthetase;       
   32::220     1e-06  28%  477 aa  SYC_PYRFU RecName: Full=Cysteinyl-tRNA synthetase;       
  110::270     1e-06  36%  555 aa  SYR_STAS1 RecName: Full=Arginyl-tRNA synthetase;       
    7::125     1e-06  26%  704 aa  SYM_LEPBL RecName: Full=Methionyl-tRNA synthetase;       
    7::125     1e-06  26%  704 aa  SYM_LEPBJ RecName: Full=Methionyl-tRNA synthetase;       
    6::142     1e-06  23%  545 aa  SYM_HAMD5 RecName: Full=Methionyl-tRNA synthetase;       
    6::202     1e-06  24%  681 aa  SYM_HAHCH RecName: Full=Methionyl-tRNA synthetase;       
   39::110     1e-06  35%  477 aa  SYC_STAMF RecName: Full=Cysteinyl-tRNA synthetase;       
    5::201     2e-06  26%  683 aa  SYM_PSEPF RecName: Full=Methionyl-tRNA synthetase;       
    3::139     2e-06  26%  685 aa  SYM_NEIMB RecName: Full=Methionyl-tRNA synthetase;       
    2::223     2e-06  26%  568 aa  SYM_METS5 RecName: Full=Methionyl-tRNA synthetase;       
   17::144     2e-06  28%  684 aa  SYM_METBU RecName: Full=Methionyl-tRNA synthetase;       
   11::139     2e-06  27%  569 aa  SYM_CAUCR RecName: Full=Methionyl-tRNA synthetase;       
   11::139     2e-06  27%  569 aa  SYM_CAUCN RecName: Full=Methionyl-tRNA synthetase;       
    2::198     2e-06  26%  685 aa  SYM_ACIAD RecName: Full=Methionyl-tRNA synthetase;       
   19::145     2e-06  28%  493 aa  SYC_SYNSC RecName: Full=Cysteinyl-tRNA synthetase;       
    4::160     2e-06  31%  457 aa  SYC_DEHSC RecName: Full=Cysteinyl-tRNA synthetase;       
    3::117     2e-06  25%  700 aa  SYM_RHOFD RecName: Full=Methionyl-tRNA synthetase;       
   13::140     2e-06  26%  700 aa  SYM_PSYCK RecName: Full=Methionyl-tRNA synthetase;       
   13::140     2e-06  26%  700 aa  SYM_PSYA2 RecName: Full=Methionyl-tRNA synthetase;       
    5::138     2e-06  24%  681 aa  SYM_PSEF5 RecName: Full=Methionyl-tRNA synthetase;       
    4::94      2e-06  28%  579 aa  SYM_HYPNA RecName: Full=Methionyl-tRNA synthetase;       
   12::72      2e-06  34%  679 aa  SYM_HALHL RecName: Full=Methionyl-tRNA synthetase;       
    2::121     2e-06  25%  555 aa  SYM_BLOPB RecName: Full=Methionyl-tRNA synthetase;       
   21::180     2e-06  25%  465 aa  SYC_METS5 RecName: Full=Cysteinyl-tRNA synthetase;       
    2::200     3e-06  28%  545 aa  SYM_VESOH RecName: Full=Methionyl-tRNA synthetase;       
    3::139     3e-06  26%  685 aa  SYM_NEIMA RecName: Full=Methionyl-tRNA synthetase;       
    3::139     3e-06  26%  685 aa  SYM_NEIM0 RecName: Full=Methionyl-tRNA synthetase;       
   19::135     3e-06  27%  689 aa  SYM_HALSA RecName: Full=Methionyl-tRNA synthetase;       
   21::158     3e-06  24%  713 aa  SYM_COLP3 RecName: Full=Methionyl-tRNA synthetase;       
   12::139     3e-06  25%  692 aa  SYM_BORPE RecName: Full=Methionyl-tRNA synthetase;       
   12::139     3e-06  25%  692 aa  SYM_BORPA RecName: Full=Methionyl-tRNA synthetase;       
   12::139     3e-06  25%  692 aa  SYM_BORBR RecName: Full=Methionyl-tRNA synthetase;       
   16::128     3e-06  28%  797 aa  SYM_ARATH RecName: Full=Probable methionyl-tRNA synthetase;        
   12::139     3e-06  24%  682 aa  SYM_ACTPJ RecName: Full=Methionyl-tRNA synthetase;       
   12::139     3e-06  24%  682 aa  SYM_ACTP7 RecName: Full=Methionyl-tRNA synthetase;       
   12::139     3e-06  24%  679 aa  SYM_ACTP2 RecName: Full=Methionyl-tRNA synthetase;       
    2::223     3e-06  24%  558 aa  SYM1_ACAM1 RecName: Full=Methionyl-tRNA synthetase 1;       
    3::108     4e-06  28%  685 aa  SYM_NEIMF RecName: Full=Methionyl-tRNA synthetase;       
   17::139     4e-06  27%  715 aa  SYM_LEPIN RecName: Full=Methionyl-tRNA synthetase;       
   17::139     4e-06  27%  715 aa  SYM_LEPIC RecName: Full=Methionyl-tRNA synthetase;       
    3::141     4e-06  25%  670 aa  SYM_LEGPL RecName: Full=Methionyl-tRNA synthetase;       
    3::141     4e-06  25%  670 aa  SYM_LEGPH RecName: Full=Methionyl-tRNA synthetase;       
    3::141     4e-06  25%  670 aa  SYM_LEGPC RecName: Full=Methionyl-tRNA synthetase;       
    2::140     4e-06  25%  724 aa  SYM_BORGA RecName: Full=Methionyl-tRNA synthetase;       
    2::138     4e-06  28%  690 aa  SYM1_SORC5 RecName: Full=Methionyl-tRNA synthetase 1;       
   37::134     4e-06  29%  474 aa  SYC_THEPD RecName: Full=Cysteinyl-tRNA synthetase;       
   12::225     5e-06  26%  694 aa  SYM_XANOR RecName: Full=Methionyl-tRNA synthetase;       
   12::225     5e-06  26%  694 aa  SYM_XANOP RecName: Full=Methionyl-tRNA synthetase;       
   12::225     5e-06  26%  694 aa  SYM_XANOM RecName: Full=Methionyl-tRNA synthetase;       
    1::144     5e-06  22%  689 aa  SYM_SHEDO RecName: Full=Methionyl-tRNA synthetase;       
    5::203     5e-06  26%  677 aa  SYM_PSEAE RecName: Full=Methionyl-tRNA synthetase;       
    5::203     5e-06  26%  678 aa  SYM_PSEAB RecName: Full=Methionyl-tRNA synthetase;       
    5::203     5e-06  26%  677 aa  SYM_PSEA8 RecName: Full=Methionyl-tRNA synthetase;       
    6::205     5e-06  23%  675 aa  SYM_PSEA6 RecName: Full=Methionyl-tRNA synthetase;       
   25::171     5e-06  27%  801 aa  SYM_ORYSJ RecName: Full=Probable methionyl-tRNA synthetase;        
    3::141     5e-06  25%  670 aa  SYM_LEGPA RecName: Full=Methionyl-tRNA synthetase;       
    4::211     5e-06  23%  673 aa  SYM_DICNV RecName: Full=Methionyl-tRNA synthetase;       
    2::139     5e-06  28%  726 aa  SYM_BORDL RecName: Full=Methionyl-tRNA synthetase;       
   33::221     5e-06  26%  476 aa  SYC_PYRHO RecName: Full=Cysteinyl-tRNA synthetase;       
   41::287     5e-06  28%  457 aa  SYC2_PHOPR RecName: Full=Putative cysteinyl-tRNA synthetase 2;     
   86::157     7e-06  42%  576 aa  SYR_RICCK RecName: Full=Arginyl-tRNA synthetase;       
   12::225     7e-06  26%  694 aa  SYM_XANC5 RecName: Full=Methionyl-tRNA synthetase;       
   12::225     7e-06  26%  694 aa  SYM_XANAC RecName: Full=Methionyl-tRNA synthetase;       
    2::67      7e-06  29%  674 aa  SYM_FRATW RecName: Full=Methionyl-tRNA synthetase;       
    2::67      7e-06  29%  674 aa  SYM_FRATT RecName: Full=Methionyl-tRNA synthetase;       
    2::67      7e-06  29%  673 aa  SYM_FRATN RecName: Full=Methionyl-tRNA synthetase;       
    2::67      7e-06  29%  674 aa  SYM_FRATH RecName: Full=Methionyl-tRNA synthetase;       
    2::67      7e-06  29%  674 aa  SYM_FRATF RecName: Full=Methionyl-tRNA synthetase;       
    2::67      7e-06  29%  674 aa  SYM_FRAT1 RecName: Full=Methionyl-tRNA synthetase;       
   31::103     7e-06  32% 1178 aa  SYLC_MOUSE RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   12::193     7e-06  28%  499 aa  SYC_PROMA RecName: Full=Cysteinyl-tRNA synthetase;       
   12::139     9e-06  25%  692 aa  SYM_STRMK RecName: Full=Methionyl-tRNA synthetase;       
   12::139     9e-06  25%  693 aa  SYM_STRM5 RecName: Full=Methionyl-tRNA synthetase;       
    1::142     9e-06  23%  677 aa  SYM_IDILO RecName: Full=Methionyl-tRNA synthetase;       
    1::131     9e-06  24%  684 aa  SYM_HAEPS RecName: Full=Methionyl-tRNA synthetase;       
    2::67      9e-06  29%  674 aa  SYM_FRATO RecName: Full=Methionyl-tRNA synthetase;       
   15::199     9e-06  24%  539 aa  SYMM_SCHPO RecName: Full=Probable methionyl-tRNA synthetase,
   18::248     9e-06  24%  457 aa  SYC_NANEQ RecName: Full=Cysteinyl-tRNA synthetase;       
    2::139     1e-05  27%  726 aa  SYM_BORRA RecName: Full=Methionyl-tRNA synthetase;       
    2::139     1e-05  25%  729 aa  SYM_BORHD RecName: Full=Methionyl-tRNA synthetase;       
   28::193     1e-05  27%  582 aa  SYMM_DROME RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   19::109     1e-05  32% 1090 aa  SYLC_YEAST RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
  132::179     1e-05  42%  553 aa  SYR_STAAW RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAT RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAS RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAR RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAN RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAM RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAE RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAC RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAAB RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAA9 RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAA8 RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAA3 RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAA2 RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-05  42%  553 aa  SYR_STAA1 RecName: Full=Arginyl-tRNA synthetase;       
    5::203     1e-05  26%  679 aa  SYM_PSEA7 RecName: Full=Methionyl-tRNA synthetase;       
    5::138     1e-05  23%  682 aa  SYM_PSE14 RecName: Full=Methionyl-tRNA synthetase;       
    2::140     1e-05  24%  724 aa  SYM_BORAP RecName: Full=Methionyl-tRNA synthetase;       
   36::132     1e-05  27% 1123 aa  SYLC_NEUCR RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   38::145     1e-05  27%  476 aa  SYC_PYRKO RecName: Full=Cysteinyl-tRNA synthetase;       
    5::138     2e-05  22%  683 aa  SYM_PSEFS RecName: Full=Methionyl-tRNA synthetase;       
   12::139     2e-05  25%  691 aa  SYM_BORA1 RecName: Full=Methionyl-tRNA synthetase;       
   33::145     2e-05  27%  476 aa  SYC_THEGJ RecName: Full=Cysteinyl-tRNA synthetase;       
   25::106     2e-05  28%  494 aa  SYC_CYAP4 RecName: Full=Cysteinyl-tRNA synthetase;       
   23::228     3e-05  30%  702 aa  SYM_XYLFT RecName: Full=Methionyl-tRNA synthetase;       
   23::228     3e-05  30%  702 aa  SYM_XYLFM RecName: Full=Methionyl-tRNA synthetase;       
   23::228     3e-05  30%  702 aa  SYM_XYLF2 RecName: Full=Methionyl-tRNA synthetase;       
    5::138     3e-05  22%  682 aa  SYM_PSESM RecName: Full=Methionyl-tRNA synthetase;       
   14::138     3e-05  25%  681 aa  SYM_PSEPW RecName: Full=Methionyl-tRNA synthetase;       
    2::121     3e-05  25%  550 aa  SYM_MIMIV RecName: Full=Methionyl-tRNA synthetase;       
   15::144     3e-05  23%  686 aa  SYM_MANSM RecName: Full=Methionyl-tRNA synthetase;       
   59::117     3e-05  34% 1111 aa  SYLC_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
   86::157     3e-05  37%  576 aa  SYR_RICFE RecName: Full=Arginyl-tRNA synthetase;       
   15::131     3e-05  26%  682 aa  SYM_HAEIN RecName: Full=Methionyl-tRNA synthetase;       
   15::131     3e-05  26%  682 aa  SYM_HAEIG RecName: Full=Methionyl-tRNA synthetase;       
   15::131     3e-05  26%  682 aa  SYM_HAEIE RecName: Full=Methionyl-tRNA synthetase;       
   15::131     3e-05  26%  682 aa  SYM_HAEI8 RecName: Full=Methionyl-tRNA synthetase;       
   38::145     3e-05  26%  476 aa  SYC_THEON RecName: Full=Cysteinyl-tRNA synthetase;       
   14::138     4e-05  25%  679 aa  SYM_PSEE4 RecName: Full=Methionyl-tRNA synthetase;       
    4::78      4e-05  28%  687 aa  SYM_BDEBA RecName: Full=Methionyl-tRNA synthetase;       
   33::221     4e-05  27%  477 aa  SYC_PYRAB RecName: Full=Cysteinyl-tRNA synthetase;       
    5::221     4e-05  25%  468 aa  SYC_CLOD6 RecName: Full=Cysteinyl-tRNA synthetase;       
   93::196     6e-05  44%  550 aa  SYR_LAWIP RecName: Full=Arginyl-tRNA synthetase;       
   23::160     6e-05  26%  702 aa  SYM_XYLFA RecName: Full=Methionyl-tRNA synthetase;       
   15::204     6e-05  25%  683 aa  SYM_HAES1 RecName: Full=Methionyl-tRNA synthetase;       
    2::139     6e-05  24%  726 aa  SYM_BORT9 RecName: Full=Methionyl-tRNA synthetase;       
   31::160     6e-05  29%  458 aa  SYC_DEHE1 RecName: Full=Cysteinyl-tRNA synthetase;       
  131::178     7e-05  40%  562 aa  SYR_XYLFT RecName: Full=Arginyl-tRNA synthetase;       
  131::178     7e-05  40%  562 aa  SYR_XYLFA RecName: Full=Arginyl-tRNA synthetase;       
  131::178     7e-05  40%  562 aa  SYR_XYLF2 RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANOR RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANOP RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANOM RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANCP RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANCB RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANC8 RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANC5 RecName: Full=Arginyl-tRNA synthetase;       
  131::200     7e-05  38%  562 aa  SYR_XANAC RecName: Full=Arginyl-tRNA synthetase;       
   86::157     7e-05  37%  576 aa  SYR_RICTY RecName: Full=Arginyl-tRNA synthetase;       
   86::157     7e-05  37%  576 aa  SYR_RICPR RecName: Full=Arginyl-tRNA synthetase;       
  123::248     7e-05  32%  581 aa  SYR_BLOPB RecName: Full=Arginyl-tRNA synthetase;       
   11::139     7e-05  27%  574 aa  SYM_STRAW RecName: Full=Methionyl-tRNA synthetase;       
    5::138     7e-05  22%  682 aa  SYM_PSEU2 RecName: Full=Methionyl-tRNA synthetase;       
   14::138     7e-05  24%  679 aa  SYM_PSEP1 RecName: Full=Methionyl-tRNA synthetase;       
    5::72      7e-05  25%  689 aa  SYM_CHRVO RecName: Full=Methionyl-tRNA synthetase;       
   25::135     7e-05  26%  736 aa  SYMC_DICDI RecName: Full=Probable methionyl-tRNA synthetase,
   33::136     7e-05  24%  465 aa  SYC_UNCTG RecName: Full=Cysteinyl-tRNA synthetase;       
   15::184     7e-05  25%  476 aa  SYC_METMP RecName: Full=Cysteinyl-tRNA synthetase;       
  132::179     1e-04  40%  553 aa  SYR_STAEQ RecName: Full=Arginyl-tRNA synthetase;       
  124::153     1e-04  53%  560 aa  SYR_METTH RecName: Full=Arginyl-tRNA synthetase;       
   14::138     1e-04  23%  679 aa  SYM_PSEPG RecName: Full=Methionyl-tRNA synthetase;       
   12::120     1e-04  25%  703 aa  SYM_MYXXD RecName: Full=Methionyl-tRNA synthetase;       
   14::138     1e-04  24%  681 aa  SYM_AZOVD RecName: Full=Methionyl-tRNA synthetase;       
  132::179     1e-04  40%  553 aa  SYR_STAHJ RecName: Full=Arginyl-tRNA synthetase;       
  132::179     1e-04  40%  553 aa  SYR_STAES RecName: Full=Arginyl-tRNA synthetase;       
   11::121     1e-04  25%  811 aa  SYM_TREPA RecName: Full=Methionyl-tRNA synthetase;       
   11::138     1e-04  27%  697 aa  SYM_PSYWF RecName: Full=Methionyl-tRNA synthetase;       
   11::67      1e-04  30%  686 aa  SYM_MAGSM RecName: Full=Methionyl-tRNA synthetase;       
   15::131     1e-04  22%  683 aa  SYM_HAES2 RecName: Full=Methionyl-tRNA synthetase;       
    4::352     1e-04  26%  530 aa  SYM_ANASP RecName: Full=Methionyl-tRNA synthetase;       
  231::288     1e-04  33%  782 aa  SYMC_SCHPO RecName: Full=Probable methionyl-tRNA synthetase,
   38::107     1e-04  30%  493 aa  SYC_PELPD RecName: Full=Cysteinyl-tRNA synthetase;       
  131::178     2e-04  38%  562 aa  SYR_XYLFM RecName: Full=Arginyl-tRNA synthetase;       
   93::169     2e-04  39%  576 aa  SYR_WIGBR RecName: Full=Arginyl-tRNA synthetase;       
  134::180     2e-04  36%  595 aa  SYR_RALEJ RecName: Full=Arginyl-tRNA synthetase;       
  125::154     2e-04  53%  569 aa  SYR_METMA RecName: Full=Arginyl-tRNA synthetase;       
  125::154     2e-04  53%  569 aa  SYR_METBF RecName: Full=Arginyl-tRNA synthetase;       
  123::152     2e-04  53%  567 aa  SYR_METAC RecName: Full=Arginyl-tRNA synthetase;       
   14::138     2e-04  23%  679 aa  SYM_PSEPK RecName: Full=Methionyl-tRNA synthetase;       
   53::226     2e-04  27%  593 aa  SYMM_HUMAN RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   40::186     2e-04  24%  471 aa  SYC_SULTO RecName: Full=Cysteinyl-tRNA synthetase;       
   99::228     2e-04  31%  644 aa  SYR_THESM RecName: Full=Arginyl-tRNA synthetase;       
   86::157     2e-04  36%  576 aa  SYR_RICAE RecName: Full=Arginyl-tRNA synthetase;       
  121::150     2e-04  50%  558 aa  SYR_METTP RecName: Full=Arginyl-tRNA synthetase;       
  115::402     2e-04  26%  549 aa  SYR_ARCFU RecName: Full=Arginyl-tRNA synthetase;       
   15::273     2e-04  24%  682 aa  SYM_PASMU RecName: Full=Methionyl-tRNA synthetase;       
  205::333     2e-04  23%  751 aa  SYMC_YEAST RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
   34::148     2e-04  25%  917 aa  SYMC_CAEEL RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
   35::143     2e-04  27%  460 aa  SYC_THEMA RecName: Full=Cysteinyl-tRNA synthetase;       
   38::184     2e-04  24%  469 aa  SYC_SULAC RecName: Full=Cysteinyl-tRNA synthetase;       
   38::221     2e-04  22%  481 aa  SYC_PELCD RecName: Full=Cysteinyl-tRNA synthetase;       
  197::300     3e-04  35%  428 aa  TIG_MYCMS RecName: Full=Trigger factor;         Short=TF;
  197::300     3e-04  34%  428 aa  TIG_MYCCT RecName: Full=Trigger factor;         Short=TF;
  143::236     3e-04  32%  603 aa  SYR_PROMA RecName: Full=Arginyl-tRNA synthetase;       
  106::152     3e-04  40%  566 aa  SYR_METMP RecName: Full=Arginyl-tRNA synthetase;       
  106::152     3e-04  40%  566 aa  SYR_METM7 RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURS3 RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURCM RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURCJ RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURCH RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURCC RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURCA RecName: Full=Arginyl-tRNA synthetase;       
  124::186     3e-04  37%  593 aa  SYR_BURA4 RecName: Full=Arginyl-tRNA synthetase;       
    4::118     3e-04  23%  545 aa  SYM_BLOFL RecName: Full=Methionyl-tRNA synthetase;       
   35::143     3e-04  27%  460 aa  SYC_THESQ RecName: Full=Cysteinyl-tRNA synthetase;       
   35::143     3e-04  27%  460 aa  SYC_THEP1 RecName: Full=Cysteinyl-tRNA synthetase;       
   23::104     3e-04  28%  492 aa  SYC_PROM5 RecName: Full=Cysteinyl-tRNA synthetase;       
  122::254     4e-04  27%  576 aa  SYR_YERPN RecName: Full=Arginyl-tRNA synthetase;       
  108::161     4e-04  33%  554 aa  SYR_STACT RecName: Full=Arginyl-tRNA synthetase;       
   86::157     4e-04  34%  576 aa  SYR_RICRS RecName: Full=Arginyl-tRNA synthetase;       
   86::157     4e-04  34%  576 aa  SYR_RICRO RecName: Full=Arginyl-tRNA synthetase;       
   86::157     4e-04  34%  576 aa  SYR_RICPU RecName: Full=Arginyl-tRNA synthetase;       
   86::157     4e-04  34%  576 aa  SYR_RICCN RecName: Full=Arginyl-tRNA synthetase;       
  106::152     4e-04  40%  566 aa  SYR_METM5 RecName: Full=Arginyl-tRNA synthetase;       
  125::215     4e-04  32%  578 aa  SYR_BUCBP RecName: Full=Arginyl-tRNA synthetase;       
   14::138     4e-04  23%  679 aa  SYM_PSEU5 RecName: Full=Methionyl-tRNA synthetase;       
   11::141     4e-04  23%  569 aa  SYM_CAUSK RecName: Full=Methionyl-tRNA synthetase;       
   38::106     4e-04  28%  499 aa  SYC_PROMM RecName: Full=Cysteinyl-tRNA synthetase;       
   11::144     4e-04  25%  476 aa  SYC_METM6 RecName: Full=Cysteinyl-tRNA synthetase;       
  722::818     4e-04  32% 2256 aa  DIDO1_MOUSE RecName: Full=Death-inducer obliterator 1;       
  122::244     5e-04  32%  577 aa  SYR_VIBFM RecName: Full=Arginyl-tRNA synthetase;       
  122::244     5e-04  32%  577 aa  SYR_VIBF1 RecName: Full=Arginyl-tRNA synthetase;       
  130::251     5e-04  33%  557 aa  SYR_THIDA RecName: Full=Arginyl-tRNA synthetase;       
  133::162     5e-04  50%  580 aa  SYR_RHOSK RecName: Full=Arginyl-tRNA synthetase;       
  136::165     5e-04  50%  583 aa  SYR_RHOS4 RecName: Full=Arginyl-tRNA synthetase;       
  133::162     5e-04  50%  580 aa  SYR_RHOS1 RecName: Full=Arginyl-tRNA synthetase;       
  106::152     5e-04  40%  566 aa  SYR_METM6 RecName: Full=Arginyl-tRNA synthetase;       
  123::152     5e-04  50%  567 aa  SYR_METBU RecName: Full=Arginyl-tRNA synthetase;       
  130::199     5e-04  35%  561 aa  SYR_MARAV RecName: Full=Arginyl-tRNA synthetase;       
  140::186     5e-04  38%  593 aa  SYR_BURVG RecName: Full=Arginyl-tRNA synthetase;       
   10::139     5e-04  24%  460 aa  SYC_PSEPF RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     5e-04  28%  499 aa  SYC_PROM3 RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     5e-04  28%  487 aa  SYC_GEOLS RecName: Full=Cysteinyl-tRNA synthetase;       
   35::144     5e-04  28%  462 aa  SYC_FINM2 RecName: Full=Cysteinyl-tRNA synthetase;       
    1::234     5e-04  25%  465 aa  SYC_DICT6 RecName: Full=Cysteinyl-tRNA synthetase;       
  263::354     5e-04  28%  465 aa  SYC_CLOTE RecName: Full=Cysteinyl-tRNA synthetase;       
  263::356     5e-04  21%  464 aa  SYC_CLOAB RecName: Full=Cysteinyl-tRNA synthetase;       
  126::172     6e-04  49%  585 aa  SYR_TRIEI RecName: Full=Arginyl-tRNA synthetase;       
  131::177     6e-04  36%  562 aa  SYR_STRMK RecName: Full=Arginyl-tRNA synthetase;       
  122::245     6e-04  30%  576 aa  SYR_PHOPR RecName: Full=Arginyl-tRNA synthetase;       
  118::147     6e-04  50%  559 aa  SYR_METPE RecName: Full=Arginyl-tRNA synthetase;       
  111::155     6e-04  40%  566 aa  SYR_METJA RecName: Full=Arginyl-tRNA synthetase;       
  133::162     6e-04  50%  585 aa  SYR_BARBK RecName: Full=Arginyl-tRNA synthetase;       
  110::244     6e-04  29%  577 aa  SYR_ALISL RecName: Full=Arginyl-tRNA synthetase;       
   10::139     6e-04  24%  460 aa  SYC_PSEF5 RecName: Full=Cysteinyl-tRNA synthetase;       
   23::104     6e-04  26%  492 aa  SYC_PROMP RecName: Full=Cysteinyl-tRNA synthetase;       
   23::104     6e-04  26%  489 aa  SYC_PROM0 RecName: Full=Cysteinyl-tRNA synthetase;       
   13::144     6e-04  24%  475 aa  SYC_METVS RecName: Full=Cysteinyl-tRNA synthetase;       
  270::355     6e-04  25%  467 aa  SYC_ARCB4 RecName: Full=Cysteinyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPY RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPS RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPP RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPG RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPE RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPB RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERPA RecName: Full=Arginyl-tRNA synthetase;       
  122::254     8e-04  26%  576 aa  SYR_YERP3 RecName: Full=Arginyl-tRNA synthetase;       
  122::244     8e-04  29%  577 aa  SYR_VIBCH RecName: Full=Arginyl-tRNA synthetase;       
  139::189     8e-04  33%  562 aa  SYR_SYNAS RecName: Full=Arginyl-tRNA synthetase;       
  141::170     8e-04  50%  592 aa  SYR_METKA RecName: Full=Arginyl-tRNA synthetase;       
  129::191     8e-04  35%  598 aa  SYR_BURM1 RecName: Full=Arginyl-tRNA synthetase;       
   29::102     8e-04  23%  454 aa  SYC_THEVO RecName: Full=Cysteinyl-tRNA synthetase;       
   35::143     8e-04  25%  460 aa  SYC_THENN RecName: Full=Cysteinyl-tRNA synthetase;       
   36::190     8e-04  26%  447 aa  SYC_STRPN RecName: Full=Cysteinyl-tRNA synthetase;       
   38::234     8e-04  26%  465 aa  SYC_DICTD RecName: Full=Cysteinyl-tRNA synthetase;       
    1::844

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGY
SYL_BARBK       IERYNPRAQEQKWQAIWDEKKIFQTSHEDEGEKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARYKRAKGM
SYL_PARL1       --RYNARAAEPKWQKIWEERGDFLMRDDADKPKYYVLEMFPYPSGRIHMGHVRNYTMGDVIARYKKARGF
SYL_BART1       -ERYNPRAREKKWQEIWDEKKIFQTVQGDGREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BARQU       -ERYNPRAREQKWQAIWDEKKIFQITEENCREKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARYKRAKGF
SYL_AZOC5       -DRYNARDAEPRWQAIWNERGIFRTRNDDPRPKFFVMEMFPYPSGRIHIGHGRNYVMGDVLARYKRMQGF
SYL_BRUA2       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUA1       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUSI       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUO2       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUME       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUMB       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUAB       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUSU       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_BRUC2       -ERYNPRVAEAHWQKVWEENRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_RHIME       -ERYNPRDAEPRWQHQWEAGKVFETKNDDPRDKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARYKRARGF
SYL_RHILO       -ERYNPRASEPKWQKAWAEKKLFEARNDDPKPKYYVLEMFPYPSGRIHIGHTRNYTMGDVVARYKRAKGF
SYL_NITHX       -DRYNARDAEPRWQAAWDQQAIFATKNDDPREKYYVLEMFPYPSGRIHIGHVRNYTLGDVIARYMRAKGY
SYL_OCHA4       -ERYNPRVAEAHWQKVWEEDRTFETDNSDSREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_AGRVS       -ERYNPRDAEPRWQEKWSEAKIFETDNNDPREKYYVLEMFPYPSGRIHIGHVRNYAMGDVVARYKRARGY
SYL_HYPNA       --RYDPQSAEPRWRDAWEKADIFRTXXXXXXXXXFVLEMFPYPSGRLHMGHVRNYAMGDVVARHKRAKGY
SYL_RHORT       -DRYNVKETEAKWQTAWAEGGCFTAREDRTRPKYYVLEMFPYPSGRIHMGHVRNYTLGDVVARFKRAQGF
SYL_RHOPB       -ERYNARESEPRWQRQWDDNAIFATQNDDPRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARTMRARGY
SYL_BARHE       -ERYNPRACERKWQAIWDEKKTFQTVQEDRREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGF
SYL_ZYMMO       --RFNPHVVDGRWQKKWEESGCFHAKDNSDRPHSYILEMFPYPSGRIHMGHVRNYTMGDVLARYYRMKGH
SYL_MARMM       MTRYNPREAEPKWQSAWDACDAFKASASNNKPKYYVLEMFPYPSGRIHVGHSRNYTMGDVVARYKRARGF
SYL_NITWN       -ERYNARDAEPRWQAEWDRQAIFATKNDDPREKYYVLEMFPYPSGRIHIGHVRNYTLGDVIARYMRARGY
SYL_BRASB       -ERYNAREAEPRWQRQWDEKAIFATKNDDPRPKYYVLEMFPYPSGRIHIGHVRNYTLGDVLARFMRAKGF
SYL_SINMW       -ERYNPRDAEPRWQQQWEAGKIFETKNDDPREKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARYKRARGF
SYL_BRASO       -ERYNAREAEPRWQRQWDEKAIFATKNDDPRPKYYVLEMFPYPSGRIHIGHVRNYTLGDVLARFMRAKGF
SYL_RHISN       -ERYNPRDTEPRWQQEWDARKVFETENDDPREKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARYKRARGF
SYL_CAUCR       MARYNPKDTEPKWREAWAKADVFKTEINDGRPKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAQGF
SYL_CAUCN       MARYNPKDTEPKWREAWAKADVFKTEINDGRPKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAQGF
SYL2_RHIL3      -ERYNPRDAEPRWQQKWNEDKVFETDNADPREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRARGY
SYL_RHIE6       -ERYNPRDAEPRWQQKWNEDKVFETDNADPREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRARGY
SYL_OLICO       -ERYNAREVEPRWQQIWDEKGVFASRNDDSRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARYRRAKGH
SYL_MESSB       -ERYNPRTSEPRWQKAWEEARLFETKNDDGRPTYYVLEMFPYPSGRIHIGHTRNYTMGDVVARYKRAKGY
SYL_RHIEC       -ERYNPRDAEPRWQQKWNEDKVFETDNSDPREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRARGY
SYL_MAGSA       -DRYNVKETEARWQQAWEAKRCFEAEIAPGKPKYYVLEMFPYPSGRIHMGHVRNYTLGDVVARYKRAKGF
SYL_RICRS       --------IEQKWQYIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_RICRO       --------IEQKWQYIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_GRABC       ---YDFASAERRWQLAWTERACFTDVPDPGARTYYVLEMFPYPSGQIHMGHVRNYTLGDVVARYKRAQGY
SYL_AGRT5       IERYNPRDAEPRWQQKWNEDKVFVTDNSDPREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRARGF
SYL_RICCN       --------IEQKWQYIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_METSB       -ERYNARETEPKWRDKWERSATFKTDNDDPRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVIARYKRARGF
SYL_WOLPM       --KYDFKSVEKFYQDKWD----FSVSKSGKQEKCYVLEMFPYPSGKIHMGHLRNYAIGDVIARYKRANGF
SYL_RICM5       --------IEQKWQHIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_WOLPP       --KYDFKNVEKFYQNKWD----FXXXXXXXXXXCYVLEMFPYPSGKIHMGHLRNYAIGDVIARYKRARGF
SYL_ORITB       ----NLVKIEKKWQKIWEQNEVFKVKEILNKIKRYILPMFPYPSGKAHVGHVRNYTICDVIARFERSQGH
SYL_RICAE       --------IEQKWQYIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_GLUOX       ---FDFQDREPFWQNEWKRRNTFADVPPADRPKYYVLEMFPYPSGQLHVGHVRNYTLGDVVARYKRARGF
SYL_ACICJ       ------------------------------RRKCYVLEMFPYPSGKIHMGHVRNYAIGDVIARARRAQGY
SYL_RICFE       --------IEQKWQQIWYDEKAFEVSNESSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_RICPU       --------IEQKWQYIWQEEKAFEVSNASSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMTMQGF
SYL_WOLWR       --KYDFKNVERFCQDKWD----FSVSKSSKQEKCYVLEMFPYPSGKIHMGHLRNYAIGDVIARYKRARGF
SYL_RHILW       -ERYNPRDAEPRWQQKWNEDKVFETDNSDPREKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRARGY
SYL_NOVAD       -ERFDPATADTRWQRVWDEKQSFRADDSSTKPRSYVLEMFPYPSGRIHIGHVRNYTMGDVLARYKRMRGF
SYL_BRAJA       -ERYNARDSEPRWQAAWDEKAIFVSKNDDSRPKYYVLEMFPYPSGRIHIGHVRNYTLGDVLARFMRAKGF
SYL_SPHAL       --RFGALAADARWQKAWEAANSFATTDSGQKPKAYILEMFPYPSGRIHMGHVRNYAMGDVLARFKRMTGH
SYL_RHOS5       MSRYDPAATESRWQAAWDEAGVFTARHDPSRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARQKAAAGY
SYL_EHRCJ       ---YDFKKVEQDIQKKWN------FYTDVKKAQCYVLEMFPYPSGNIHMGHLRNYTIGDVIARYKRACGI
SYL_RHOPT       -ERYNARESEPKWQAKWDEAKIFATRNDDLRKKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARTMRARGY
SYL_ROSDO       MTRYTPAEIEARWQKAWRENEVFKAIRSADKPKYYVLEMFPYPSGRIHMGHVRNYTMGDVIARYKLATGH
SYL_RHOSK       MSRYDPAATESRWQAAWDAAGVFTARHDPARPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARQKAAAGF
SYL_RICCK       --------IEQKWQQIWDDEKAFEVSNECNKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVIARFMNMQGF
SYL_RHOS1       MSRYDPAATESRWQAAWDAAGVFTARHDPARPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARQKAAAGF
SYL_RHOCS       MSRYNVRETEAKWQAAWADAGSFAVTADPAKPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARFKRAKGF
SYL_WOLTR       --KYDFKNVEKFYQDRWD----FSIGKNNEQGKCYVLEMFPYPSGKIHMGHLRNYVIGDVIARYKRACGF
SYL_RHOS4       MSRYDPAATESRWQAAWDAAGVFTARHDPARPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARQKAAAGF
SYL_RHOPA       -ERYNARESEPKWQAKWDEAKIFATRNDDLRKKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARTMRARGY
SYL_CAUSK       MARYNPKDTEPKWRAAWASANTFLTPITPARPKYYVLEMFPYPSGRIHMGHVRNYAMGDVVARYKRAQGF
SYL_RHOP5       -ERYNARESEPKWQRRWDDDKIFATQNDDPRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARTMRARGF
SYL_PHEZH       --RYNPKETEPKWRKRWDEAQAFRAVEAPGKRKYYVLEMFPYPSGRLHMGHVRNYALGDVIARYKRAQDF
SYL_RHOPS       -ERYNARESEPKWQAKWDEAKIFATRNDDPRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARTMRARGH
SYL_RHOP2       -ERYNARESEPKWQAKWDEAKIFATRNDDPRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARTMRARGH
SYL_RICBR       ---------------------------ESSKPKYYVLEMLPYPSGKIHVGHVRNYSIGDVVARFMTMQGF
SYL_EHRCR       ---YDFKKVEQDIQGKWN------FYTDAKQAQCYVLEMFPYPSGNIHMGHLRNYTIGDVIARYKRACGI
SYL_RICAH       --------IEQKWQQIWHDEKAFEVSNESSKPKYYVLAMLPYPSGKIHLGHVRNYSIGDVIARFMTMQGF
SYL_SILST       MSRYEASDIEARWQKAWEEAAIFQAKEDHSKPKYYVLEMFPYPSGKLHMGHVRNYTMGDVIARYKLSTGH
SYL_VIBPA       -EQYNPQDIEQKVQKHWDDNKTFVVSEDPNKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRFQRLQGK
SYL_ANAMM       ---YNFKLVEQEIQKRWDFKIAGNDGIN-----CYVLGMFPYPSGNIHMGHIRNYTIGDVIARYKRAHGL
SYL_IDILO       -EQYNPSKIESAMQKRWQEQDVFTAKEQPGKDKFYCLSMFPYPSGKLHMGHVRNYTLGDVISRHQRMLGK
SYL_ALTMD       -NQYNPKDIEQRVQQYWEENQSFKANDDVEKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVISRFQRMQGK
SYL_SILPO       MSRYSATEIEAKWQEAWDKAGIFRAARTADKPKYYVLEMFPYPSGRIHIGHVRNYTMGDVIARYKLSNGF
SYL_RICTY       ----------------------FQVSNDSSKPKYYVLEMLPYPSGKIHIGHIRNYSIGDVIARFMTMQGF
SYL_EHRRG       ---YDFKEVERDVQEKW------DFTVNVKDVQCYVLEMFPYPSGNIHMGHLRNYTIGDVIARYKRACGL
SYL_VIBVU       -EQYNPQDIEQKVQQHWDNNKTFVVTEDPTKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRFQRLQGK
SYL_VIBHB       -EQYNPQDLEQKVQKHWDDNKTFVVSEDPNKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRFQRLQGK
SYL_VIBVY       -EQYNPQDIEQKVQQHWDNNKTFVVTEDPTKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRFQRLQGK
SYL_RICPR       ----------------------FQVSNESSKPKYYVLEMLPYPSGKIHIGHVRNYSIGDVIARFMTMQGF
SYL_SPHWW       --RFNHLKADAHWQGVWESQGTFQARDDSPKPKSYVLEMFPYPSGRIHMGHVRNYTMGDVLARYRRMKGF
SYL_EHRRW       ---YNFKEVERDVQEKW------DFTVNVKDVQCYVLEMFPYPSGNIHMGHLRNYTIGDVIARYKRACGL
SYL_MARMS       -EQYNPQQIEQAAQSFWDENKVFKAIADSSKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVISRYQRMQGK
SYL_THICR       ---YQPQSIEAAIQHVWDEQQVFVAKEDDSKEKFYCLSMFPYPSGKLHMGHVRNYTIGDVVSRFQRMQGK
SYL_PSEHT       -EQYNPQKIESKIQRYWEENKVFKVTEDESKEKYYCLSMFPYPSGRLHMGHVRNYTIGDVVSRFQRLKGK
SYL_GEOUR       -EKYLPSRVEEKWQKFWEANKSFRATEDKTREKYYLLEMFPYPSGRIHMGHVRNYSIGDVIARFKRMKGF
SYL_NEOSM       MSNYDFKKIEQFSQSLWD----FSS-CDFQRKKYYVLSMFPYPSGKLHIGHLRNYVIGDVLARYKRSQGY
SYL_CELJU       -EQYNPAEVEAQAQQYWEEHQSFNVIEDPGKEKFYCLAMFPYPSGKLHMGHVRNYTITDVIARYQRMQGK
SYL_PARDP       ---------EPRWQEAWEQADTFRAVRDE-RPKYYVLEMFPYPSGRIHMGHVRNYTMGDVVARFKRAQGF
SYL_GEOMG       -EKYIPRNVEEKWQKIWEENKTYKVTEDPSKPKYYLLEMFPYPSGRIHMGHVRNYSIGDVVGRFKRLRGF
SYL_CALS8       ---YNFREIEKKWQQKWFSQNKYKVTEDSPKPKYYVLEMFPYPSGKLHMGHVRNYSIGDVFARFMRLKGY
SYL_MARAV       -EQYNPREVEQTARTFWETNETFKVKEEPGKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVISRYQRMQGK
SYL_VIBSL       -EQYNPQEIEQKVQQHWDDSETFVVSEDPNKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRFQRLQGK
SYL_ALCBS       --QYRPDQIEAQAQQYWDDNQSFKVTEDASKEKFYCLSMFPYPSGRLHMGHVRNYSIGDVVSRYQRMLGK
SYL_MAGSM       --KYNPQAIESKWQKIWHQQKTFATPENLDKETFYLLVMFPYPSGRIHMGHVRNYAIGDVIARYQRMQGK
SYL_VIBF1       -EQYNPQDLEQKIQKHWDDNKTFVVTEDANKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRYQRLQGK
SYL_VIBFM       -EQYNPQDLEQKIQKHWDDNKTFVVTEDANKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRYQRLQGK
SYL_PSYIN       ---YNPKEIEKKFQTNWDENQSFKATEDPSKEKYYCLSMFPYPSGKLHMGHVRNYTIGDVISRYQRMQGK
SYL_PHOPR       -EQYRPQDIEQKVQEHWDNNKTFVVNEDPNKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRYQRLQGK
SYL_GEOSM       -EKYNPSAVEEKWQGYWAEHESFKATEDPTRKKYYLLEMFPYPSGKIHMGHVRNYSIGDVIARFKRMQGY
SYL_JANSC       MSRYDPSMIEPKWQKAWAEAGTFTASMEGNKPKYYVLEMFPYPSGRIHIGHVRNYTMGDVIARHKKAMGH
SYL_DESAA       -ERYDPKKIEGKWQAHWDAAGLFKVKEDPSKEKYFLMEMFPYPSGKIHMGHVRNYSIGDVVARFKRMQGF
SYL_HAHCH       ---YHPKKVEQEAQKFWEETDAFKVDEEPGKEKFYCLSMFPYPSGKLHMGHVRNYTIGDVISRYQRMQGK
SYL_FRATN       MNEYNFSDIEKSTQDYWRKNDTFKTIEDNTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIARYQKMQGK
SYL_ALISL       -EQYNPQDLEQKIQKHWDDSKTFVVTEDASKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVVSRYQRLQGK
SYL_GEOSL       -ERYIPKNVEGKWQEIWEENKTFTVTEDPSKPKYYLLEMFPYPSGRIHMGHVRNYSIGDVVGRFKRMRGF
SYL_FRATT       MNEYNFSDIEKSTQEYWRKNDTFKTIEDNTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIARYQKMQGK
SYL_FRAT1       MNEYNFSDIEKSTQEYWRKNDTFKTIEDNTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIARYQKMQGK
SYL_GEOBB       -EKYVPSAVEEKWQGYWAEHKSFKANEDPSRKKYYLLEMFPYP<