[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21181.1

[Show Plain Result]


## Summary of Sequence Search
    1::329
  270::421     4e-05  31% 1148 aa  ICEK_PSESX RecName: Full=Ice nucleation protein;
  215::383     6e-05  42% 1210 aa  ICEN_PSEFL RecName: Full=Ice nucleation protein;
  182::363     2e-04  35% 1034 aa  ICEN_PANAN RecName: Full=Ice nucleation protein inaU;
  322::473     4e-04  31% 1200 aa  ICEN_PSESY RecName: Full=Ice nucleation protein;
 2341::2485    7e-04  26% 9159 aa  HMU_HALWD RecName: Full=Halomucin;Flags: Precursor;
    1::329

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICEK_PSESX      ----------------------------------------------------------------------
ICEN_PSEFL      ----------------------------------------------------------------------
ICEN_PANAN      ----------------------------------------------------------------------
ICEN_PSESY      ----------------------------------------------------------------------
HMU_HALWD       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIISNTVDNGGVTS
ICEK_PSESX      ----------------------------------------------------------------------
ICEN_PSEFL      ----------------------------------------------------------------------
ICEN_PANAN      -------------------------------------------------------------STETAGDSS
ICEN_PSESY      ----------------------------------------------------------------------
HMU_HALWD       ---------------------------------------------------------IVANASATGNVTT


                         +         .         .         .         .         *         .:210
query           TASTLFGAIGSAGSNNMMRYDNTTAVEGLKISASYVPSGTGEVESSVDYGLEYTGYEGLTLGYAMGENNA
ICEK_PSESX      -----YGSTQTSGGDSSLTYGSTTAQEGSNLTAGYGSTGTAGVDSSLIAGYGSTQTSGLTAGYGSTQTAQ
ICEN_PSEFL      -----YGSTGTAGSDSSLGYGSTQTAGGSSLTAGYGSTQTAQVGSNLTAGYGSTGTAGLIAGY--GSTQT
ICEN_PANAN      TLIAGYGSTGTAGSDS-------------TLVAGYGSTQTAGEESSAGYGSTQTGMKGSDLTAGYGSTGT
ICEN_PSESY      -----YGSTQTSGGDSSLTYGSTTAQEGSNLTAGYGSTGTAGVDSSLIAGYGSTQTSGLTAGYGSTQTAQ
HMU_HALWD       TGQRVGGLIGYHRTGTILR--NVTATGDVSTDGQRVGGLVGDTDASITTGEVTTSTTGEYVGGLVGQLRA


                         .         .         .         +         .         .         .:280
query           AGGTSNTDNDTMYVKYAYGPVTVGYQKSEIXXXXXXXXXXXXXYGVTYAVSDSLSVGYAESTYDAGSSTT
ICEK_PSESX      EGSNLXXXXXXXXXXXXXXXLIAGYGSTQ-----------------TSGSDSSLTAGY-------GSTQT
ICEN_PSEFL      AGGESS-------LTAGYGSTQTAQVGSDLXXXXXXXXXXXXXYGSTQTAGSSLTAGY-------GSTQT
ICEN_PANAN      AGGSTQTAGEDSSLTAGYGSTQTAQKGSDLXXXXXXXXXXXXXXXLIAGYGSTQTAG-EESTQTAGSTQT
ICEN_PSESY      EGSNLXXXXXXXXXXXXXXXLIAGYGSTQ-----------------TSGSDSSLTAGY-------GSTQT
HMU_HALWD       QHGDEEVRNVTASGNVSSGGQYVGGLMGYVDDNNNE--------GRYVAMSEAHATGNVNTTYDGGSN--


                         .         *         .         .         .         .         +:350
query           DQENSNLSVSYTQGGMTLAAGFAEEKNRGGxxxxxxxxxxxxxxxxxxx
ICEK_PSESX      AQEGSNLTAGYGSTGSSLIAGYGSTQTSG--------------------
ICEN_PSEFL      AQVGSNLTAGYGSTGSSLIAGYGSTQTAGG-------------------
ICEN_PANAN      AQKGSDLTAGYGSTGSSLIAGYGSTQTAG--------------------
ICEN_PSESY      AQEGSILTAGYGSTGSSLIAGYGSTQTSG--------------------
HMU_HALWD       -------------------------------------------------