[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21236.1

[Show Plain Result]


## Summary of Sequence Search
    1::462
    1::462       0.0 100%  462 aa  ARLY_PELUB RecName: Full=Argininosuccinate lyase;       
    8::459     e-116  46%  466 aa  ARLY1_AGRT5 RecName: Full=Argininosuccinate lyase 1;       
    5::455     e-116  47%  471 aa  ARLY_EHRCJ RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUSU RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUSI RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUME RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUMB RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUC2 RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUAB RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUA2 RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  466 aa  ARLY_BRUA1 RecName: Full=Argininosuccinate lyase;       
    1::461     e-116  44%  473 aa  ARLY_MESSB RecName: Full=Argininosuccinate lyase;       
    5::455     e-115  47%  470 aa  ARLY_EHRCR RecName: Full=Argininosuccinate lyase;       
    1::461     e-114  44%  466 aa  ARLY_OCHA4 RecName: Full=Argininosuccinate lyase;       
    5::451     e-114  45%  462 aa  ARLY_EHRRW RecName: Full=Argininosuccinate lyase;       
    5::451     e-114  45%  466 aa  ARLY_EHRRG RecName: Full=Argininosuccinate lyase;       
    1::461     e-114  44%  466 aa  ARLY1_RHILO RecName: Full=Argininosuccinate lyase 1;       
    9::460     e-114  44%  467 aa  ARLY_RHIL3 RecName: Full=Argininosuccinate lyase;       
    8::460     e-113  45%  467 aa  ARLY_RHIE6 RecName: Full=Argininosuccinate lyase;       
    7::460     e-113  44%  467 aa  ARLY1_RHIME RecName: Full=Argininosuccinate lyase 1;       
   14::460     e-112  44%  467 aa  ARLY_AGRVS RecName: Full=Argininosuccinate lyase;       
    7::460     e-112  47%  467 aa  ARLY_RHISN RecName: Full=Argininosuccinate lyase;       
    4::455     e-112  44%  462 aa  ARLY_NITSB RecName: Full=Argininosuccinate lyase;       
    1::461     e-111  42%  466 aa  ARLY_BARBK RecName: Full=Argininosuccinate lyase;       
    4::456     e-110  46%  460 aa  ARLY_CAMHC RecName: Full=Argininosuccinate lyase;       
    9::460     e-109  44%  467 aa  ARLY_RHIEC RecName: Full=Argininosuccinate lyase;       
    6::456     e-109  44%  462 aa  ARLY_CALS8 RecName: Full=Argininosuccinate lyase;       
    5::464     e-106  42%  468 aa  ARLY_ZYMMO RecName: Full=Argininosuccinate lyase;       
   11::462     e-106  42%  469 aa  ARLY_PARDP RecName: Full=Argininosuccinate lyase;       
    7::461     e-106  43%  466 aa  ARLY_BART1 RecName: Full=Argininosuccinate lyase;       
   13::465     e-106  41%  471 aa  ARLY_RHOS1 RecName: Full=Argininosuccinate lyase;       
    5::449     e-106  42%  463 aa  ARLY_METPB RecName: Full=Argininosuccinate lyase;       
    4::450     e-106  45%  462 aa  ARLY_WOLSU RecName: Full=Argininosuccinate lyase;       
   14::465     e-106  41%  471 aa  ARLY_RHOS4 RecName: Full=Argininosuccinate lyase;       
    5::456     e-106  43%  465 aa  ARLY_RHOPT RecName: Full=Argininosuccinate lyase;       
    5::456     e-106  43%  465 aa  ARLY_RHOPA RecName: Full=Argininosuccinate lyase;       
    5::449     e-106  42%  463 aa  ARLY_METEP RecName: Full=Argininosuccinate lyase;       
    2::456     e-105  43%  462 aa  ARLY_ANATD RecName: Full=Argininosuccinate lyase;       
    5::456     e-105  42%  465 aa  ARLY_RHOPS RecName: Full=Argininosuccinate lyase;       
    5::456     e-105  43%  465 aa  ARLY_BRAJA RecName: Full=Argininosuccinate lyase;       
    5::449     e-105  42%  463 aa  ARLY_METC4 RecName: Full=Argininosuccinate lyase;       
    5::455     e-105  42%  459 aa  ARLY_LACLA RecName: Full=Argininosuccinate lyase;       
    6::455     e-105  42%  458 aa  ARLY_GEOSF RecName: Full=Argininosuccinate lyase;       
    1::452     e-104  42%  455 aa  ARLY_CAUSK RecName: Full=Argininosuccinate lyase;       
   12::461     e-104  44%  466 aa  ARLY_ARCB4 RecName: Full=Argininosuccinate lyase;       
    4::455     e-104  42%  456 aa  ARLY_LISMC RecName: Full=Argininosuccinate lyase;       
   22::472     e-104  41%  476 aa  ARLY_JANSC RecName: Full=Argininosuccinate lyase;       
    5::449     e-104  42%  459 aa  ARLY_METRJ RecName: Full=Argininosuccinate lyase;       
    6::456     e-103  41%  458 aa  ARLY_GEOLS RecName: Full=Argininosuccinate lyase;       
    4::455     e-103  42%  456 aa  ARLY_LISMF RecName: Full=Argininosuccinate lyase;       
    8::463     e-103  41%  466 aa  ARLY_ROSDO RecName: Full=Argininosuccinate lyase;       
    6::451     e-103  41%  471 aa  ARLY_MAGSA RecName: Full=Argininosuccinate lyase;       
    4::455     e-103  42%  456 aa  ARLY_LISIN RecName: Full=Argininosuccinate lyase;       
    4::455     e-103  42%  456 aa  ARLY_LISMH RecName: Full=Argininosuccinate lyase;       
    4::455     e-103  42%  456 aa  ARLY_LISMO RecName: Full=Argininosuccinate lyase;       
    1::452     e-103  42%  455 aa  ARLY_CAUCR RecName: Full=Argininosuccinate lyase;       
    4::457     e-102  41%  462 aa  ARLY_STRA5 RecName: Full=Argininosuccinate lyase;       
    5::456     e-102  42%  465 aa  ARLY_RHOP2 RecName: Full=Argininosuccinate lyase;       
    4::457     e-102  41%  462 aa  ARLY_STRA1 RecName: Full=Argininosuccinate lyase;       
   13::465     e-102  40%  471 aa  ARLY_RHOS5 RecName: Full=Argininosuccinate lyase;       
    4::453     e-102  41%  462 aa  ARLY_BACCN RecName: Full=Argininosuccinate lyase;       
    4::457     e-102  41%  462 aa  ARLY_STRA3 RecName: Full=Argininosuccinate lyase;       
    4::458     e-102  41%  461 aa  ARLY_STRTD RecName: Full=Argininosuccinate lyase;       
    4::458     e-102  41%  461 aa  ARLY_STRT2 RecName: Full=Argininosuccinate lyase;       
    4::458     e-102  41%  461 aa  ARLY_STRT1 RecName: Full=Argininosuccinate lyase;       
    6::456     e-102  42%  460 aa  ARLY_LACS1 RecName: Full=Argininosuccinate lyase;       
    5::456     e-101  43%  464 aa  ARLY_SULNB RecName: Full=Argininosuccinate lyase;       
    3::456     e-101  44%  461 aa  ARLY_STRGC RecName: Full=Argininosuccinate lyase;       
    4::455     e-101  41%  456 aa  ARLY_LISW6 RecName: Full=Argininosuccinate lyase;       
    6::455     e-101  40%  458 aa  ARLY_GEOMG RecName: Full=Argininosuccinate lyase;       
    4::454     e-101  42%  460 aa  ARLY_SULDN RecName: Full=Argininosuccinate lyase;       
    1::460     e-101  41%  463 aa  ARLY_DINSH RecName: Full=Argininosuccinate lyase;       
   11::460     e-101  42%  472 aa  ARLY_SYNAS RecName: Full=Argininosuccinate lyase;       
    4::453     e-101  40%  462 aa  ARLY_BACCZ RecName: Full=Argininosuccinate lyase;       
    5::455     e-101  40%  460 aa  ARLY_PARL1 RecName: Full=Argininosuccinate lyase;       
    4::449     e-100  40%  461 aa  ARLY_SYMTH RecName: Full=Argininosuccinate lyase;       
    4::457     e-100  41%  460 aa  ARLY_STRU0 RecName: Full=Argininosuccinate lyase;       
   18::455     e-100  43%  478 aa  ARLY_RHORT RecName: Full=Argininosuccinate lyase;       
    6::453     e-100  42%  467 aa  ARLY_LACPL RecName: Full=Argininosuccinate lyase;       
    6::455     e-100  41%  458 aa  ARLY_GEOUR RecName: Full=Argininosuccinate lyase;       
    4::453     e-100  40%  462 aa  ARLY_BACAH RecName: Full=Argininosuccinate lyase;       
    6::455     e-100  40%  458 aa  ARLY_GEOSL RecName: Full=Argininosuccinate lyase;       
   12::467     e-100  41%  472 aa  ARLY_MARMM RecName: Full=Argininosuccinate lyase;       
    1::458     e-100  42%  466 aa  ARLY_CAMC1 RecName: Full=Argininosuccinate lyase;       
    6::456      e-99  43%  458 aa  ARLY_PELPD RecName: Full=Argininosuccinate lyase;       
    1::392      e-99  45%  438 aa  ARLY_CLOTE RecName: Full=Argininosuccinate lyase;       
    6::456     1e-99  41%  461 aa  ARLY_LACRJ RecName: Full=Argininosuccinate lyase;       
    6::456     1e-99  41%  461 aa  ARLY_LACRD RecName: Full=Argininosuccinate lyase;       
   25::467     1e-99  42%  481 aa  ARLY_GLUOX RecName: Full=Argininosuccinate lyase;       
    6::456     2e-99  41%  464 aa  ARLY_STRSY RecName: Full=Argininosuccinate lyase;       
    6::456     2e-99  41%  464 aa  ARLY_STRS2 RecName: Full=Argininosuccinate lyase;       
    5::458     2e-99  40%  460 aa  ARLY_STRMU RecName: Full=Argininosuccinate lyase;       
    4::454     3e-99  40%  458 aa  ARLY_ANOFW RecName: Full=Argininosuccinate lyase;       
    5::456     6e-99  41%  463 aa  ARLY_BRASO RecName: Full=Argininosuccinate lyase;       
    3::460     1e-98  40%  463 aa  ARLY_SILPO RecName: Full=Argininosuccinate lyase;       
    4::449     1e-98  40%  462 aa  ARLY_EXISA RecName: Full=Argininosuccinate lyase;       
    1::392     1e-98  47%  437 aa  ARLY_CLOAB RecName: Full=Argininosuccinate lyase;       
    1::392     2e-98  44%  438 aa  ARLY_CLOK5 RecName: Full=Argininosuccinate lyase;       
    1::392     2e-98  44%  438 aa  ARLY_CLOK1 RecName: Full=Argininosuccinate lyase;       
    5::447     2e-98  42%  463 aa  ARLY_BRASB RecName: Full=Argininosuccinate lyase;       
    1::438     3e-98  43%  456 aa  ARLY_CARHZ RecName: Full=Argininosuccinate lyase;       
    3::456     4e-98  43%  460 aa  ARLY_STRSV RecName: Full=Argininosuccinate lyase;       
    5::456     4e-98  41%  462 aa  ARLY_METNO RecName: Full=Argininosuccinate lyase;       
    4::453     4e-98  40%  462 aa  ARLY_BACCR RecName: Full=Argininosuccinate lyase;       
   18::468     7e-98  41%  476 aa  ARLY_GLUDA RecName: Full=Argininosuccinate lyase;       
    4::453     7e-98  40%  462 aa  ARLY_BACC2 RecName: Full=Argininosuccinate lyase;       
    1::453     9e-98  39%  459 aa  ARLY_OCEIH RecName: Full=Argininosuccinate lyase;       
    1::456     9e-98  41%  469 aa  ARLY_NOVAD RecName: Full=Argininosuccinate lyase;       
    4::453     9e-98  40%  462 aa  ARLY_BACWK RecName: Full=Argininosuccinate lyase;       
    4::457     1e-97  41%  463 aa  ARLY_STRZJ RecName: Full=Argininosuccinate lyase;       
    4::457     1e-97  41%  463 aa  ARLY_STRP7 RecName: Full=Argininosuccinate lyase;       
    6::456     1e-97  39%  458 aa  ARLY_GEOSM RecName: Full=Argininosuccinate lyase;       
    4::453     1e-97  40%  462 aa  ARLY_BACC4 RecName: Full=Argininosuccinate lyase;       
    5::456     3e-97  40%  462 aa  ARLY_XANP2 RecName: Full=Argininosuccinate lyase;       
    6::456     3e-97  39%  458 aa  ARLY_GEOBB RecName: Full=Argininosuccinate lyase;       
    4::453     3e-97  40%  462 aa  ARLY_BACAN RecName: Full=Argininosuccinate lyase;       
    4::453     3e-97  40%  462 aa  ARLY_BACAC RecName: Full=Argininosuccinate lyase;       
    4::453     3e-97  40%  462 aa  ARLY_BACAA RecName: Full=Argininosuccinate lyase;       
    4::457     6e-97  40%  463 aa  ARLY_STRR6 RecName: Full=Argininosuccinate lyase;       
    4::457     6e-97  40%  463 aa  ARLY_STRPI RecName: Full=Argininosuccinate lyase;       
    4::457     6e-97  40%  463 aa  ARLY_STRP2 RecName: Full=Argininosuccinate lyase;       
   28::478     6e-97  41%  480 aa  ARLY_RUTMC RecName: Full=Argininosuccinate lyase;       
    5::455     6e-97  42%  459 aa  ARLY_LACLM RecName: Full=Argininosuccinate lyase;       
    4::453     6e-97  40%  463 aa  ARLY_BACC7 RecName: Full=Argininosuccinate lyase;       
    4::453     6e-97  40%  462 aa  ARLY_BACC1 RecName: Full=Argininosuccinate lyase;       
    6::455     8e-97  41%  460 aa  ARLY_LAWIP RecName: Full=Argininosuccinate lyase;       
    5::455     8e-97  42%  459 aa  ARLY_LACLS RecName: Full=Argininosuccinate lyase;       
    4::453     8e-97  40%  463 aa  ARLY_BACHK RecName: Full=Argininosuccinate lyase;       
   13::461     1e-96  40%  465 aa  ARLY_VARPS RecName: Full=Argininosuccinate lyase;       
    6::455     2e-96  40%  459 aa  ARLY_SULSY RecName: Full=Argininosuccinate lyase;       
    4::455     2e-96  40%  459 aa  ARLY_PROM9 RecName: Full=Argininosuccinate lyase;       
    4::442     2e-96  41%  472 aa  ARLY_HELHP RecName: Full=Argininosuccinate lyase;       
   27::455     3e-96  42%  467 aa  ARLY_CAMC5 RecName: Full=Argininosuccinate lyase;       
    4::453     3e-96  39%  457 aa  ARLY_BACP2 RecName: Full=Argininosuccinate lyase;       
    4::453     3e-96  39%  462 aa  ARLY_BACC0 RecName: Full=Argininosuccinate lyase;       
   21::481     5e-96  40%  485 aa  ARLY_ACIAC RecName: Full=Argininosuccinate lyase;       
    4::454     7e-96  39%  459 aa  ARLY_GEOSW RecName: Full=Argininosuccinate lyase;       
    4::445     7e-96  40%  458 aa  ARLY_BACHD RecName: Full=Argininosuccinate lyase;       
    5::456     9e-96  40%  465 aa  ARLY_RHOPB RecName: Full=Argininosuccinate lyase;       
    4::451     9e-96  40%  462 aa  ARLY2_BACSK RecName: Full=Argininosuccinate lyase 2;       
    6::450     1e-95  39%  461 aa  ARLY_PELCD RecName: Full=Argininosuccinate lyase;       
    1::460     1e-95  38%  465 aa  ARLY_HYPNA RecName: Full=Argininosuccinate lyase;       
    5::448     2e-95  41%  465 aa  ARLY_NITWN RecName: Full=Argininosuccinate lyase;       
    6::456     2e-95  40%  460 aa  ARLY_LACF3 RecName: Full=Argininosuccinate lyase;       
   13::479     3e-95  41%  483 aa  ARLY_RHOFD RecName: Full=Argininosuccinate lyase;       
    4::455     6e-95  40%  459 aa  ARLY_PROM0 RecName: Full=Argininosuccinate lyase;       
    1::458     7e-95  39%  464 aa  ARLY_PSEPG RecName: Full=Argininosuccinate lyase;       
    1::448     7e-95  41%  471 aa  ARLY_DEIRA RecName: Full=Argininosuccinate lyase;       
    4::455     9e-95  39%  459 aa  ARLY_PROMP RecName: Full=Argininosuccinate lyase;       
    7::447     9e-95  39%  465 aa  ARLY_DESAA RecName: Full=Argininosuccinate lyase;       
    6::450     2e-94  40%  457 aa  ARLY_STACT RecName: Full=Argininosuccinate lyase;       
    1::458     2e-94  39%  464 aa  ARLY_PSEE4 RecName: Full=Argininosuccinate lyase;       
    5::454     2e-94  39%  466 aa  ARLY_METSB RecName: Full=Argininosuccinate lyase;       
    4::455     3e-94  40%  459 aa  ARLY_PROMS RecName: Full=Argininosuccinate lyase;       
    8::454     3e-94  40%  461 aa  ARLY_NITEC RecName: Full=Argininosuccinate lyase;       
    1::393     3e-94  42%  461 aa  ARLY_DESHY RecName: Full=Argininosuccinate lyase;       
    1::393     3e-94  42%  461 aa  ARLY_DESHD RecName: Full=Argininosuccinate lyase;       
    1::445     3e-94  39%  464 aa  ARLY_AZOVD RecName: Full=Argininosuccinate lyase;       
   14::462     4e-94  39%  467 aa  ARLY_METPP RecName: Full=Argininosuccinate lyase;       
    1::458     5e-94  39%  464 aa  ARLY_PSEPW RecName: Full=Argininosuccinate lyase;       
    1::458     5e-94  39%  464 aa  ARLY_PSEPK RecName: Full=Argininosuccinate lyase;       
    1::456     5e-94  39%  464 aa  ARLY_PSE14 RecName: Full=Argininosuccinate lyase;       
    1::447     5e-94  42%  468 aa  ARLY_ALHEH RecName: Full=Argininosuccinate lyase;       
   18::469     5e-94  40%  471 aa  ARLY_ACICJ RecName: Full=Argininosuccinate lyase;       
    6::455     6e-94  39%  460 aa  ARLY_STAHJ RecName: Full=Argininosuccinate lyase;       
    4::455     6e-94  39%  459 aa  ARLY_PROM2 RecName: Full=Argininosuccinate lyase;       
    6::455     6e-94  38%  458 aa  ARLY_NEIG1 RecName: Full=Argininosuccinate lyase;       
    1::456     8e-94  39%  464 aa  ARLY_PSESM RecName: Full=Argininosuccinate lyase;       
    3::449     1e-93  39%  469 aa  ARLY_SACD2 RecName: Full=Argininosuccinate lyase;       
    1::456     1e-93  38%  464 aa  ARLY_PSEU2 RecName: Full=Argininosuccinate lyase;       
    8::454     1e-93  40%  461 aa  ARLY_NITEU RecName: Full=Argininosuccinate lyase;       
    4::454     1e-93  38%  459 aa  ARLY_GEOTN RecName: Full=Argininosuccinate lyase;       
    6::450     2e-93  39%  463 aa  ARLY_STAES RecName: Full=Argininosuccinate lyase;       
    6::450     2e-93  39%  463 aa  ARLY_STAEQ RecName: Full=Argininosuccinate lyase;       
    1::456     2e-93  39%  464 aa  ARLY_PSEFS RecName: Full=Argininosuccinate lyase;       
    2::452     2e-93  39%  457 aa  ARLY_MACCJ RecName: Full=Argininosuccinate lyase;       
   13::459     2e-93  40%  465 aa  ARLY_AZOSE RecName: Full=Argininosuccinate lyase;       
    1::456     3e-93  38%  464 aa  ARLY_PSEA7 RecName: Full=Argininosuccinate lyase;       
    1::393     3e-93  42%  458 aa  ARLY_CLOTH RecName: Full=Argininosuccinate lyase;       
    1::456     4e-93  38%  464 aa  ARLY2_PSEPF RecName: Full=Argininosuccinate lyase 2;       
    1::451     5e-93  39%  458 aa  ARLY_SPHWW RecName: Full=Argininosuccinate lyase;       
    1::456     1e-92  38%  464 aa  ARLY_PSEMY RecName: Full=Argininosuccinate lyase;       
    1::445     1e-92  39%  464 aa  ARLY_PSEF5 RecName: Full=Argininosuccinate lyase;       
    6::455     1e-92  38%  458 aa  ARLY_NEIMF RecName: Full=Argininosuccinate lyase;       
    6::455     1e-92  38%  458 aa  ARLY_NEIMB RecName: Full=Argininosuccinate lyase;       
    6::455     1e-92  38%  458 aa  ARLY_NEIM0 RecName: Full=Argininosuccinate lyase;       
    1::453     1e-92  38%  458 aa  ARLY_EUBE2 RecName: Full=Argininosuccinate lyase;       
    4::455     2e-92  38%  459 aa  ARLY_PROM5 RecName: Full=Argininosuccinate lyase;       
    5::456     2e-92  40%  465 aa  ARLY_NITHX RecName: Full=Argininosuccinate lyase;       
    4::444     2e-92  40%  457 aa  ARLY_EXIS2 RecName: Full=Argininosuccinate lyase;       
    6::455     3e-92  38%  458 aa  ARLY_NEIMA RecName: Full=Argininosuccinate lyase;       
    1::452     3e-92  37%  459 aa  ARLY_CLOCE RecName: Full=Argininosuccinate lyase;       
   11::465     4e-92  40%  469 aa  ARLY_POLNA RecName: Full=Argininosuccinate lyase;       
    9::462     6e-92  38%  468 aa  ARLY_METFK RecName: Full=Argininosuccinate lyase;       
    2::450     6e-92  42%  460 aa  ARLY_CAMJR RecName: Full=Argininosuccinate lyase;       
    6::450     7e-92  39%  459 aa  ARLY_STAS1 RecName: Full=Argininosuccinate lyase;       
    2::450     7e-92  42%  460 aa  ARLY_CAMJD RecName: Full=Argininosuccinate lyase;       
    3::448     7e-92  38%  464 aa  ARLY_ALCBS RecName: Full=Argininosuccinate lyase;       
    5::455     1e-91  39%  460 aa  ARLY_LEUMM RecName: Full=Argininosuccinate lyase;       
    1::459     2e-91  37%  464 aa  ARLY_PSEA8 RecName: Full=Argininosuccinate lyase;       
   13::454     2e-91  38%  476 aa  ARLY_NITMU RecName: Full=Argininosuccinate lyase;       
    1::453     2e-91  41%  460 aa  ARLY_DESRM RecName: Full=Argininosuccinate lyase;       
    2::450     2e-91  41%  460 aa  ARLY_CAMJE RecName: Full=Argininosuccinate lyase;       
    1::456     2e-91  38%  464 aa  ARLY_PSEU5 RecName: Full=Argininosuccinate lyase;       
    1::459     2e-91  37%  464 aa  ARLY_PSEAE RecName: Full=Argininosuccinate lyase;       
   13::472     2e-91  39%  476 aa  ARLY_LEPCP RecName: Full=Argininosuccinate lyase;       
    5::450     2e-91  41%  458 aa  ARLY_HELMO RecName: Full=Argininosuccinate lyase;       
    4::454     2e-91  38%  459 aa  ARLY_BACLD RecName: Full=Argininosuccinate lyase;       
    1::449     3e-91  38%  467 aa  ARLY_CHRSD RecName: Full=Argininosuccinate lyase;       
    2::450     3e-91  41%  460 aa  ARLY_CAMJJ RecName: Full=Argininosuccinate lyase;       
    1::448     3e-91  39%  460 aa  ARLY_ALKMQ RecName: Full=Argininosuccinate lyase;       
    1::392     5e-91  42%  438 aa  ARLY_CLOD6 RecName: Full=Argininosuccinate lyase;       
    2::450     5e-91  41%  460 aa  ARLY_CAMJ8 RecName: Full=Argininosuccinate lyase;       
   14::461     5e-91  41%  473 aa  ARLY_BORPE RecName: Full=Argininosuccinate lyase;       
   14::461     5e-91  41%  473 aa  ARLY_BORPA RecName: Full=Argininosuccinate lyase;       
   14::461     5e-91  41%  473 aa  ARLY_BORBR RecName: Full=Argininosuccinate lyase;       
    1::456     6e-91  38%  464 aa  ARLY_PSEAB RecName: Full=Argininosuccinate lyase;       
   12::399     6e-91  44%  468 aa  ARLY_BURPP RecName: Full=Argininosuccinate lyase;       
   12::456     6e-91  40%  468 aa  ARLY_BURP8 RecName: Full=Argininosuccinate lyase;       
   21::398     6e-91  44%  480 aa  ARLY_AZOSB RecName: Full=Argininosuccinate lyase;       
    1::453     8e-91  38%  464 aa  ARLY_MOOTA RecName: Full=Argininosuccinate lyase;       
    6::438     8e-91  40%  461 aa  ARLY_DEHSB RecName: Full=Argininosuccinate lyase;       
    4::453     8e-91  38%  458 aa  ARLY_BACA2 RecName: Full=Argininosuccinate lyase;       
    1::448     1e-90  41%  457 aa  ARLY_PSYA2 RecName: Full=Argininosuccinate lyase;       
    1::462     1e-90  38%  465 aa  ARLY_DEIDV RecName: Full=Argininosuccinate lyase;       
    6::438     1e-90  40%  461 aa  ARLY_DEHSC RecName: Full=Argininosuccinate lyase;       
   12::399     1e-90  44%  468 aa  ARLY_BURXL RecName: Full=Argininosuccinate lyase;       
   12::458     2e-90  40%  469 aa  ARLY_RALME RecName: Full=Argininosuccinate lyase;       
    1::452     2e-90  38%  461 aa  ARLY_CLOB8 RecName: Full=Argininosuccinate lyase;       
    4::453     2e-90  37%  461 aa  ARLY_BACSU RecName: Full=Argininosuccinate lyase;       
    1::448     5e-90  40%  457 aa  ARLY_PSYCK RecName: Full=Argininosuccinate lyase;       
    9::459     5e-90  37%  464 aa  ARLY_DESPS RecName: Full=Argininosuccinate lyase;       
    6::455     5e-90  38%  460 aa  ARLY_DESAD RecName: Full=Argininosuccinate lyase;       
    1::448     5e-90  39%  466 aa  ARLY_CLOPE RecName: Full=Argininosuccinate lyase;       
   12::456     7e-90  40%  469 aa  ARLY_BURM1 RecName: Full=Argininosuccinate lyase;       
    4::454     9e-90  37%  459 aa  ARLY_GEOKA RecName: Full=Argininosuccinate lyase;       
    6::438     1e-89  41%  461 aa  ARLY_DEHE1 RecName: Full=Argininosuccinate lyase;       
    7::452     1e-89  38%  461 aa  ARLY_ANAVT RecName: Full=Argininosuccinate lyase;       
   19::470     1e-89  39%  477 aa  ARLY_ACIBS RecName: Full=Argininosuccinate lyase;       
   19::470     1e-89  39%  477 aa  ARLY_ACIBC RecName: Full=Argininosuccinate lyase;       
    7::449     2e-89  41%  465 aa  ARLY_METCA RecName: Full=Argininosuccinate lyase;       
    1::448     2e-89  39%  466 aa  ARLY_CLOP1 RecName: Full=Argininosuccinate lyase;       
   19::470     2e-89  39%  477 aa  ARLY_ACIBY RecName: Full=Argininosuccinate lyase;       
   19::470     2e-89  39%  477 aa  ARLY_ACIB5 RecName: Full=Argininosuccinate lyase;       
   19::470     2e-89  39%  477 aa  ARLY_ACIB3 RecName: Full=Argininosuccinate lyase;       
    1::452     2e-89  44%  468 aa  ARLY_SPHAL RecName: Full=Argininosuccinate lyase;       
   10::460     2e-89  37%  464 aa  ARLY_MAGSM RecName: Full=Argininosuccinate lyase;       
    7::457     2e-89  38%  461 aa  ARLY_ANASP RecName: Full=Argininosuccinate lyase;       
   12::456     3e-89  39%  469 aa  ARLY_BURTA RecName: Full=Argininosuccinate lyase;       
    5::448     3e-89  40%  457 aa  ARLY_AQUAE RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAW RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAS RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAR RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAN RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAM RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAE RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAAC RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAA9 RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAA8 RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAA2 RecName: Full=Argininosuccinate lyase;       
    6::450     3e-89  40%  459 aa  ARLY_STAA1 RecName: Full=Argininosuccinate lyase;       
   12::456     3e-89  39%  469 aa  ARLY_BURMS RecName: Full=Argininosuccinate lyase;       
   12::456     3e-89  39%  469 aa  ARLY_BURMA RecName: Full=Argininosuccinate lyase;       
   12::456     3e-89  39%  469 aa  ARLY_BURM9 RecName: Full=Argininosuccinate lyase;       
   12::456     3e-89  39%  469 aa  ARLY_BURM7 RecName: Full=Argininosuccinate lyase;       
   12::454     3e-89  40%  469 aa  ARLY_BURCH RecName: Full=Argininosuccinate lyase;       
   12::454     3e-89  40%  469 aa  ARLY_BURCA RecName: Full=Argininosuccinate lyase;       
   19::467     3e-89  43%  477 aa  ARLY_ACIAD RecName: Full=Argininosuccinate lyase;       
    4::454     5e-89  40%  460 aa  ARLY_PELTS RecName: Full=Argininosuccinate lyase;       
   12::399     5e-89  43%  469 aa  ARLY_BURCC RecName: Full=Argininosuccinate lyase;       
   21::481     6e-89  39%  486 aa  ARLY_DIAST RecName: Full=Argininosuccinate lyase;       
   12::399     6e-89  43%  469 aa  ARLY_BURCJ RecName: Full=Argininosuccinate lyase;       
   21::481     6e-89  39%  486 aa  ARLY_ACISJ RecName: Full=Argininosuccinate lyase;       
    1::459     2e-88  37%  462 aa  ARLY_THICR RecName: Full=Argininosuccinate lyase;       
    6::450     2e-88  40%  459 aa  ARLY_STAAT RecName: Full=Argininosuccinate lyase;       
    6::450     2e-88  40%  459 aa  ARLY_STAA3 RecName: Full=Argininosuccinate lyase;       
   13::460     2e-88  38%  470 aa  ARLY_BORA1 RecName: Full=Argininosuccinate lyase;       
    1::434     2e-88  44%  439 aa  ARLY_THETN RecName: Full=Argininosuccinate lyase;       
    5::448     2e-88  38%  462 aa  ARLY_METS4 RecName: Full=Argininosuccinate lyase;       
    1::460     2e-88  36%  468 aa  ARLY_HAHCH RecName: Full=Argininosuccinate lyase;       
    6::446     3e-88  40%  459 aa  ARLY_STAAB RecName: Full=Argininosuccinate lyase;       
    1::453     3e-88  37%  462 aa  ARLY_CLOPH RecName: Full=Argininosuccinate lyase;       
    7::453     4e-88  38%  461 aa  ARLY_NOSP7 RecName: Full=Argininosuccinate lyase;       
    1::434     7e-88  39%  441 aa  ARLY_THEPX RecName: Full=Argininosuccinate lyase;       
    1::434     7e-88  39%  441 aa  ARLY_THEP3 RecName: Full=Argininosuccinate lyase;       
    8::458     9e-88  38%  460 aa  ARLY_PELPB RecName: Full=Argininosuccinate lyase;       
    1::461     1e-87  38%  465 aa  ARLY_DEIGD RecName: Full=Argininosuccinate lyase;       
    1::438     1e-87  41%  440 aa  ARLY_CLOBM RecName: Full=Argininosuccinate lyase;       
    4::454     2e-87  39%  459 aa  ARLY_DESAP RecName: Full=Argininosuccinate lyase;       
    1::458     2e-87  36%  461 aa  ARLY_PELLD RecName: Full=Argininosuccinate lyase;       
    5::452     2e-87  37%  460 aa  ARLY_LACC3 RecName: Full=Argininosuccinate lyase;       
    4::453     6e-87  38%  461 aa  ARLY_SCHPO RecName: Full=Argininosuccinate lyase;       
   13::469     6e-87  38%  472 aa  ARLY_RALEH RecName: Full=Argininosuccinate lyase;       
    1::392     6e-87  44%  437 aa  ARLY_CLONN RecName: Full=Argininosuccinate lyase;       
    1::453     6e-87  38%  465 aa  ARLY_CLOBB RecName: Full=Argininosuccinate lyase;       
   12::456     6e-87  39%  469 aa  ARLY_BURVG RecName: Full=Argininosuccinate lyase;       
   12::399     7e-87  42%  469 aa  ARLY_BURS3 RecName: Full=Argininosuccinate lyase;       
    1::453     9e-87  38%  465 aa  ARLY_CLOBA RecName: Full=Argininosuccinate lyase;       
   13::400     1e-86  42%  470 aa  ARLY_RALEJ RecName: Full=Argininosuccinate lyase;       
    8::453     2e-86  36%  463 aa  ARLY_THEEB RecName: Full=Argininosuccinate lyase;       
    1::454     2e-86  37%  460 aa  ARLY_PROMH RecName: Full=Argininosuccinate lyase;       
    1::438     2e-86  38%  441 aa  ARLY_PETMO RecName: Full=Argininosuccinate lyase;       
    1::449     2e-86  37%  455 aa  ARLY_SHEHH RecName: Full=Argininosuccinate lyase;       
    6::446     2e-86  36%  462 aa  ARLY_DECAR RecName: Full=Argininosuccinate lyase;       
    1::438     2e-86  40%  440 aa  ARLY_CLOBJ RecName: Full=Argininosuccinate lyase;       
    1::438     2e-86  40%  440 aa  ARLY_CLOB6 RecName: Full=Argininosuccinate lyase;       
    3::457     3e-86  38%  460 aa  ARLZ_SCHPO RecName: Full=Probable argininosuccinate lyase;       
   12::462     4e-86  41%  471 aa  ARLY_RALPJ RecName: Full=Argininosuccinate lyase;       
    8::447     4e-86  37%  470 aa  ARLY_LEPIN RecName: Full=Argininosuccinate lyase;       
    8::447     4e-86  37%  470 aa  ARLY_LEPIC RecName: Full=Argininosuccinate lyase;       
    7::456     4e-86  36%  462 aa  ARLY_CYAP8 RecName: Full=Argininosuccinate lyase;       
   12::460     5e-86  36%  464 aa  ARLY_JANMA RecName: Full=Argininosuccinate lyase;       
    1::438     5e-86  40%  440 aa  ARLY_CLOBH RecName: Full=Argininosuccinate lyase;       
    1::438     5e-86  40%  440 aa  ARLY_CLOB1 RecName: Full=Argininosuccinate lyase;       
    1::454     6e-86  39%  455 aa  ARLY_SHEDO RecName: Full=Argininosuccinate lyase;       
    7::456     6e-86  35%  466 aa  ARLY_MICAN RecName: Full=Argininosuccinate lyase;       
    1::392     6e-86  43%  440 aa  ARLY_CLOBL RecName: Full=Argininosuccinate lyase;       
    5::454     8e-86  37%  462 aa  ARLY_PROMA RecName: Full=Argininosuccinate lyase;       
   10::402     8e-86  41%  472 aa  ARLY_POLNS RecName: Full=Argininosuccinate lyase;       
   12::399     1e-85  42%  471 aa  ARLY_RALSO RecName: Full=Argininosuccinate lyase;       
    7::456     1e-85  36%  462 aa  ARLY_CYAP7 RecName: Full=Argininosuccinate lyase;       
    1::395     2e-85  41%  456 aa  ARLY_SHEAM RecName: Full=Argininosuccinate lyase;       
    5::445     2e-85  39%  458 aa  ARLY_HYDS0 RecName: Full=Argininosuccinate lyase;       
    5::454     2e-85  37%  462 aa  ARLY_PROM4 RecName: Full=Argininosuccinate lyase;       
    1::392     2e-85  43%  440 aa  ARLY_CLOBK RecName: Full=Argininosuccinate lyase;       
    6::455     4e-85  36%  461 aa  ARLY_SYNY3 RecName: Full=Argininosuccinate lyase;       
    1::457     4e-85  38%  472 aa  ARLY_POLSQ RecName: Full=Argininosuccinate lyase;       
    9::459     5e-85  37%  463 aa  ARLY_PROM1 RecName: Full=Argininosuccinate lyase;       
    8::447     5e-85  37%  470 aa  ARLY_LEPBJ RecName: Full=Argininosuccinate lyase;       
    1::459     5e-85  36%  461 aa  ARLY_CHLCH RecName: Full=Argininosuccinate lyase;       
    1::449     7e-85  37%  461 aa  ARLY_SHEPW RecName: Full=Argininosuccinate lyase;       
    9::459     7e-85  37%  463 aa  ARLY_PROMT RecName: Full=Argininosuccinate lyase;       
    8::447     7e-85  37%  470 aa  ARLY_LEPBL RecName: Full=Argininosuccinate lyase;       
   12::460     7e-85  36%  464 aa  ARLY_HERAR RecName: Full=Argininosuccinate lyase;       
   12::458     1e-84  37%  467 aa  ARLY_NITOC RecName: Full=Argininosuccinate lyase;       
    6::442     1e-84  38%  460 aa  ARLY_DESVV RecName: Full=Argininosuccinate lyase;       
    6::442     1e-84  38%  460 aa  ARLY_DESVH RecName: Full=Argininosuccinate lyase;       
    9::459     2e-84  35%  464 aa  ARLY_CYAA5 RecName: Full=Argininosuccinate lyase;       
    1::441     3e-84  39%  624 aa  ARLY_VIBVY RecName: Full=Bifunctional protein argH;Includes:
    1::441     3e-84  39%  624 aa  ARLY_VIBVU RecName: Full=Bifunctional protein argH;Includes:
   13::460     4e-84  36%  477 aa  ARLY_SYNJB RecName: Full=Argininosuccinate lyase;       
    5::452     4e-84  37%  466 aa  ARLY_SYNFM RecName: Full=Argininosuccinate lyase;       
    7::455     4e-84  36%  466 aa  ARLY_DESDA RecName: Full=Argininosuccinate lyase;       
    1::454     1e-83  36%  456 aa  ARLY_SHEPA RecName: Full=Argininosuccinate lyase;       
    1::453     1e-83  37%  457 aa  ARLY_HAEIE RecName: Full=Argininosuccinate lyase;       
   11::460     1e-83  38%  463 aa  ARLY_CHLTE RecName: Full=Argininosuccinate lyase;       
    1::453     1e-83  37%  457 aa  ARLY_HAEIG RecName: Full=Argininosuccinate lyase;       
   10::460     2e-83  36%  466 aa  ARLY_SYNE7 RecName: Full=Argininosuccinate lyase;       
    6::457     4e-83  37%  462 aa  ARLY_THET8 RecName: Full=Argininosuccinate lyase;       
    1::441     4e-83  38%  459 aa  ARLY_BUCAP RecName: Full=Argininosuccinate lyase;       
    1::449     4e-83  35%  460 aa  ARLY_ALTMD RecName: Full=Argininosuccinate lyase;       
    2::456     5e-83  35%  461 aa  ARLY_LARHH RecName: Full=Argininosuccinate lyase;       
    1::453     5e-83  37%  457 aa  ARLY_HAEI8 RecName: Full=Argininosuccinate lyase;       
   12::448     6e-83  36%  465 aa  ARLY_HALHL RecName: Full=Argininosuccinate lyase;       
    1::453     6e-83  37%  457 aa  ARLY_HAEIN RecName: Full=Argininosuccinate lyase;       
    1::449     6e-83  37%  458 aa  ARLY_ACTP2 RecName: Full=Argininosuccinate lyase;       
   10::460     8e-83  36%  466 aa  ARLY_SYNP6 RecName: Full=Argininosuccinate lyase;       
    6::442     8e-83  36%  460 aa  ARLY_DESDG RecName: Full=Argininosuccinate lyase;       
    1::449     8e-83  37%  458 aa  ARLY_ACTPJ RecName: Full=Argininosuccinate lyase;       
    2::454     1e-82  37%  460 aa  ARLY_PROA2 RecName: Full=Argininosuccinate lyase;       
    1::454     1e-82  36%  458 aa  ARLY_HAEPS RecName: Full=Argininosuccinate lyase;       
    1::449     2e-82  36%  458 aa  ARLY_ACTP7 RecName: Full=Argininosuccinate lyase;       
   12::447     2e-82  37%  463 aa  ARLY_THIDA RecName: Full=Argininosuccinate lyase;       
   10::446     3e-82  35%  467 aa  ARLY_THISH RecName: Full=Argininosuccinate lyase;       
   13::460     3e-82  36%  489 aa  ARLY_SYNJA RecName: Full=Argininosuccinate lyase;       
    8::453     3e-82  37%  464 aa  ARLY_CHLPD RecName: Full=Argininosuccinate lyase;       
    6::448     4e-82  37%  468 aa  ARLY_GLOVI RecName: Full=Argininosuccinate lyase;       
    6::456     7e-82  37%  462 aa  ARLY_LEUCK RecName: Full=Argininosuccinate lyase;       
    4::461     9e-82  38%  463 aa  ARLY_CHLP8 RecName: Full=Argininosuccinate lyase;       
   10::459     9e-82  36%  468 aa  ARLY2_ANAPL RecName: Full=Argininosuccinate lyase;       
    1::383     1e-81  41%  455 aa  ARLY_SHESM RecName: Full=Argininosuccinate lyase;       
    1::383     2e-81  42%  624 aa  ARLY_VIBPA RecName: Full=Bifunctional protein argH;Includes:
    1::383     2e-81  41%  455 aa  ARLY_SHESR RecName: Full=Argininosuccinate lyase;       
    1::441     2e-81  37%  457 aa  ARLY_ENTS8 RecName: Full=Argininosuccinate lyase;       
   38::469     2e-81  36%  476 aa  ARLY_ACAM1 RecName: Full=Argininosuccinate lyase;       
    1::446     3e-81  37%  457 aa  ARLY_SHESH RecName: Full=Argininosuccinate lyase;       
    1::454     3e-81  36%  458 aa  ARLY_BUCBP RecName: Full=Argininosuccinate lyase;       
   11::458     3e-81  36%  472 aa  ARLY_SYNS3 RecName: Full=Argininosuccinate lyase;       
    1::383     3e-81  41%  455 aa  ARLY_SHESA RecName: Full=Argininosuccinate lyase;       
    1::383     5e-81  41%  455 aa  ARLY_SHEON RecName: Full=Argininosuccinate lyase;       
    1::454     5e-81  38%  459 aa  ARLY_PHOLL RecName: Full=Argininosuccinate lyase;       
    1::453     6e-81  36%  458 aa  ARLY_PSEA6 RecName: Full=Argininosuccinate lyase;       
    1::441     8e-81  36%  470 aa  ARGHA_MORPR RecName: Full=Bifunctional protein argHA;Includes:
    8::444     1e-80  36%  467 aa  ARLY_RANCA RecName: Full=Argininosuccinate lyase;       
    6::442     1e-80  35%  460 aa  ARLY_DESVM RecName: Full=Argininosuccinate lyase;       
    4::394     2e-80  41%  487 aa  ARLY_NATTJ RecName: Full=Argininosuccinate lyase;       
    1::441     2e-80  36%  629 aa  ARGHA_MORAB RecName: Full=Bifunctional protein argHA;Includes:
   11::463     2e-80  35%  470 aa  ARLY_SYNPW RecName: Full=Argininosuccinate lyase;       
    1::449     2e-80  36%  457 aa  ARLY_SALAR RecName: Full=Argininosuccinate lyase;       
    7::455     3e-80  35%  459 aa  ARLY_CHRVO RecName: Full=Argininosuccinate lyase;       
    1::441     4e-80  36%  460 aa  ARLY_ACTSZ RecName: Full=Argininosuccinate lyase;       
    1::382     9e-80  41%  453 aa  ARLY_SHELP RecName: Full=Argininosuccinate lyase;       
    1::382     1e-79  41%  455 aa  ARLY_SHESW RecName: Full=Argininosuccinate lyase;       
    1::449     1e-79  36%  458 aa  ARLY_HAEDU RecName: Full=Argininosuccinate lyase;       
    1::382     1e-79  41%  455 aa  ARLY_SHEPC RecName: Full=Argininosuccinate lyase;       
    1::454     1e-79  38%  457 aa  ARLY_PECCP RecName: Full=Argininosuccinate lyase;       
    1::441     1e-79  35%  460 aa  ARLY_MANSM RecName: Full=Argininosuccinate lyase;       
    4::461     1e-79  37%  463 aa  ARLY_CHLL2 RecName: Full=Argininosuccinate lyase;       
    1::453     2e-79  36%  457 aa  ARLY_PASMU RecName: Full=Argininosuccinate lyase;       
    1::454     2e-79  37%  460 aa  ARLY_BUCCC RecName: Full=Argininosuccinate lyase;       
    1::382     2e-79  41%  455 aa  ARLY_SHEB5 RecName: Full=Argininosuccinate lyase;       
    1::454     3e-79  36%  457 aa  ARLY_ERWT9 RecName: Full=Argininosuccinate lyase;       
   10::457     4e-79  37%  466 aa  ARLY_COLLI RecName: Full=Argininosuccinate lyase;       
    1::453     6e-79  38%  457 aa  ARLY_KLEP3 RecName: Full=Argininosuccinate lyase;       
    6::387     7e-79  40%  411 aa  ARLY_LEGPH RecName: Full=Argininosuccinate lyase;       
   11::464     9e-79  35%  473 aa  ARLY_CHLRE RecName: Full=Argininosuccinate lyase;       
    7::464     9e-79  37%  468 aa  ARLY_CANAL RecName: Full=Argininosuccinate lyase;       
    1::453     1e-78  38%  457 aa  ARLY_KLEP7 RecName: Full=Argininosuccinate lyase;       
    1::454     1e-78  38%  457 aa  ARLY_ERWCT RecName: Full=Argininosuccinate lyase;       
    8::448     1e-78  35%  473 aa  ARLY_BOVIN RecName: Full=Argininosuccinate lyase;       
    6::387     2e-78  40%  411 aa  ARLY_LEGPL RecName: Full=Argininosuccinate lyase;       
    1::441     2e-78  36%  457 aa  ARLY_ESCF3 RecName: Full=Argininosuccinate lyase;       
    1::454     2e-78  37%  457 aa  ARLY_SERP5 RecName: Full=Argininosuccinate lyase;       
    1::454     2e-78  34%  457 aa  ARLY_HAES2 RecName: Full=Argininosuccinate lyase;       
    1::454     2e-78  34%  457 aa  ARLY_HAES1 RecName: Full=Argininosuccinate lyase;       
    8::457     2e-78  36%  466 aa  ARLY2_CHICK RecName: Full=Argininosuccinate lyase;       
    1::382     3e-78  41%  456 aa  ARLY_SHEWM RecName: Full=Argininosuccinate lyase;       
    1::382     4e-78  41%  455 aa  ARLY_SHEB9 RecName: Full=Argininosuccinate lyase;       
    6::387     4e-78  39%  411 aa  ARLY_LEGPA RecName: Full=Argininosuccinate lyase;       
    1::453     5e-78  36%  457 aa  ARLY_YERE8 RecName: Full=Argininosuccinate lyase;       
   13::463     5e-78  36%  471 aa  ARLY_SYNPX RecName: Full=Argininosuccinate lyase;       
    1::449     6e-78  37%  458 aa  ARLY_SALA4 RecName: Full=Argininosuccinate lyase;       
    8::452     6e-78  36%  466 aa  ARLY_ANSAN RecName: Full=Argininosuccinate lyase;       
    1::453     8e-78  36%  457 aa  ARLY_YERPY RecName: Full=Argininosuccinate lyase;       
    1::445     8e-78  38%  461 aa  ARLY_TOLAT RecName: Full=Argininosuccinate lyase;       
    1::382     8e-78  40%  455 aa  ARLY_SHEB2 RecName: Full=Argininosuccinate lyase;       
    8::456     8e-78  34%  464 aa  ARLY_MOUSE RecName: Full=Argininosuccinate lyase;       
    6::457     8e-78  35%  478 aa  ARLY_LEPBP RecName: Full=Argininosuccinate lyase;       
    6::457     8e-78  35%  478 aa  ARLY_LEPBA RecName: Full=Argininosuccinate lyase;       
    1::449     1e-77  36%  458 aa  ARLY_SALTI RecName: Full=Argininosuccinate lyase;       
    6::387     1e-77  39%  411 aa  ARLY_LEGPC RecName: Full=Argininosuccinate lyase;       
    1::449     1e-77  38%  457 aa  ARLY_ECO57 RecName: Full=Argininosuccinate lyase;       
    1::449     1e-77  38%  457 aa  ARLY_ECO5E RecName: Full=Argininosuccinate lyase;       
    8::457     1e-77  35%  466 aa  ARLY1_ANAPL RecName: Full=Delta-1 crystallin;AltName: Full=Delta
    1::453     2e-77  36%  457 aa  ARLY_YERPP RecName: Full=Argininosuccinate lyase;       
    1::453     2e-77  36%  457 aa  ARLY_YERPN RecName: Full=Argininosuccinate lyase;       
    1::453     2e-77  36%  457 aa  ARLY_YERPG RecName: Full=Argininosuccinate lyase;       
    1::453     2e-77  36%  457 aa  ARLY_YERPE RecName: Full=Argininosuccinate lyase;       
    1::453     2e-77  36%  457 aa  ARLY_YERPA RecName: Full=Argininosuccinate lyase;       
    1::453     2e-77  36%  457 aa  ARLY_YERP3 RecName: Full=Argininosuccinate lyase;       
    1::449     2e-77  36%  458 aa  ARLY_SALPC RecName: Full=Argininosuccinate lyase;       
    1::449     2e-77  36%  458 aa  ARLY_SALPB RecName: Full=Argininosuccinate lyase;       
    1::449     2e-77  36%  458 aa  ARLY_SALCH RecName: Full=Argininosuccinate lyase;       
    1::441     2e-77  38%  457 aa  ARLY_ECOSE RecName: Full=Argininosuccinate lyase;       
    1::441     2e-77  38%  457 aa  ARLY_ECO8A RecName: Full=Argininosuccinate lyase;       
    1::441     2e-77  38%  457 aa  ARLY_ECO55 RecName: Full=Argininosuccinate lyase;       
    1::441     2e-77  38%  457 aa  ARLY_ECO24 RecName: Full=Argininosuccinate lyase;       
    1::441     2e-77  38%  457 aa  ARLY_SHISS RecName: Full=Argininosuccinate lyase;       
    1::441     2e-77  38%  457 aa  ARLY_SHIDS RecName: Full=Argininosuccinate lyase;       
    1::449     2e-77  36%  458 aa  ARLY_SALSV RecName: Full=Argininosuccinate lyase;       
    8::456     2e-77  34%  461 aa  ARLY_RAT RecName: Full=Argininosuccinate lyase;         Short=ASAL;
    1::454     2e-77  39%  459 aa  ARLY_BUCAI RecName: Full=Argininosuccinate lyase;       
    1::453     3e-77  36%  457 aa  ARLY_YERPS RecName: Full=Argininosuccinate lyase;       
    1::453     3e-77  36%  457 aa  ARLY_YERPB RecName: Full=Argininosuccinate lyase;       
    1::441     3e-77  37%  458 aa  ARLY_SALTY RecName: Full=Argininosuccinate lyase;       
    1::441     3e-77  37%  458 aa  ARLY_SALNS RecName: Full=Argininosuccinate lyase;       
    1::449     3e-77  36%  458 aa  ARLY_SALG2 RecName: Full=Argininosuccinate lyase;       
    1::449     3e-77  36%  458 aa  ARLY_SALEP RecName: Full=Argininosuccinate lyase;       
    1::449     3e-77  36%  458 aa  ARLY_SALDC RecName: Full=Argininosuccinate lyase;       
    1::449     3e-77  37%  457 aa  ARLY_CITK8 RecName: Full=Argininosuccinate lyase;       
    1::449     4e-77  36%  458 aa  ARLY_SALHS RecName: Full=Argininosuccinate lyase;       
   13::462     4e-77  37%  470 aa  ARLY_PROM3 RecName: Full=Argininosuccinate lyase;       
    8::456     4e-77  34%  464 aa  ARLY_HUMAN RecName: Full=Argininosuccinate lyase;       
    1::395     4e-77  38%  461 aa  ARLY_AERS4 RecName: Full=Argininosuccinate lyase;       
   13::462     5e-77  37%  470 aa  ARLY_PROMM RecName: Full=Argininosuccinate lyase;       
    6::457     9e-77  35%  462 aa  ARLY_THET2 RecName: Full=Argininosuccinate lyase;       
    8::447     1e-76  38%  463 aa  ARLY_SACDO RecName: Full=Argininosuccinate lyase;       
    8::459     2e-76  37%  463 aa  ARLY_YEAST RecName: Full=Argininosuccinate lyase;       
    1::382     2e-76  40%  455 aa  ARLY_SHEB8 RecName: Full=Argininosuccinate lyase;       
    1::449     2e-76  36%  458 aa  ARLY_SALPK RecName: Full=Argininosuccinate lyase;       
    1::449     2e-76  36%  458 aa  ARLY_SALPA RecName: Full=Argininosuccinate lyase;       
    8::456     2e-76  34%  464 aa  ARLY_MACFA RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOLU RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOLI RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOLC RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOHS RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECODH RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOBW RecName: Full=Argininosuccinate lyase;       
    1::450     2e-76  34%  461 aa  ARLY_AERHH RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOUT RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOL6 RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOL5 RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECOK1 RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECO81 RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECO7I RecName: Full=Argininosuccinate lyase;       
    1::441     2e-76  38%  457 aa  ARLY_ECO45 RecName: Full=Argininosuccinate lyase;       
    1::441     3e-76  38%  457 aa  ARLY_SHIFL RecName: Full=Argininosuccinate lyase;       
    1::441     3e-76  38%  457 aa  ARLY_SHIF8 RecName: Full=Argininosuccinate lyase;       
    1::441     3e-76  38%  457 aa  ARLY_SHIBS RecName: Full=Argininosuccinate lyase;       
    1::441     3e-76  38%  457 aa  ARLY_SHIB3 RecName: Full=Argininosuccinate lyase;       
    1::441     3e-76  38%  457 aa  ARLY_ECO27 RecName: Full=Argininosuccinate lyase;       
   13::461     8e-76  36%  472 aa  ARLY_SYNS9 RecName: Full=Argininosuccinate lyase;       
    1::382     1e-75  41%  624 aa  ARLY_VIBF1 RecName: Full=Bifunctional protein argH;Includes:
   13::461     1e-75  35%  472 aa  ARLY_SYNSC RecName: Full=Argininosuccinate lyase;       
    1::453     1e-75  37%  457 aa  ARLY_ENT38 RecName: Full=Argininosuccinate lyase;       
   21::394     4e-75  37%  465 aa  ARLY_METST RecName: Full=Argininosuccinate lyase;       
    1::445     5e-75  35%  454 aa  ARLY_HERA2 RecName: Full=Argininosuccinate lyase;       
    1::449     6e-75  38%  460 aa  ARLY_EDWI9 RecName: Full=Argininosuccinate lyase;       
    1::441     5e-74  40%  458 aa  ARLY_VIBCM RecName: Full=Argininosuccinate lyase;       
    1::441     5e-74  40%  458 aa  ARLY_VIBCH RecName: Full=Argininosuccinate lyase;       
    1::441     5e-74  40%  458 aa  ARLY_VIBC3 RecName: Full=Argininosuccinate lyase;       
   10::393     9e-74  43%  484 aa  ARLY_METJA RecName: Full=Argininosuccinate lyase;       
   21::394     5e-73  36%  468 aa  ARLY_METTH RecName: Full=Argininosuccinate lyase;       
   36::467     5e-73  32%  474 aa  ARLY_ANADF RecName: Full=Argininosuccinate lyase;       
    1::449     6e-73  35%  485 aa  ARLY_NITMS RecName: Full=Argininosuccinate lyase;       
    1::450     1e-72  34%  455 aa  ARLY_ROSS1 RecName: Full=Argininosuccinate lyase;       
   29::460     2e-72  34%  467 aa  ARLY_ANASK RecName: Full=Argininosuccinate lyase;       
   29::460     2e-72  34%  467 aa  ARLY_ANAD2 RecName: Full=Argininosuccinate lyase;       
    1::462     3e-72  33%  475 aa  ARLY_STRGG RecName: Full=Argininosuccinate lyase;       
    1::441     4e-72  35%  457 aa  ARLY_SODGM RecName: Full=Argininosuccinate lyase;       
   29::460     9e-72  34%  467 aa  ARLY_ANADE RecName: Full=Argininosuccinate lyase;       
   27::389     1e-71  41%  497 aa  ARLY_UNCMA RecName: Full=Argininosuccinate lyase;       
   10::393     1e-71  38%  481 aa  ARLY_METVS RecName: Full=Argininosuccinate lyase;       
    1::449     3e-71  34%  477 aa  ARLY_STRAW RecName: Full=Argininosuccinate lyase;       
    6::395     1e-70  38%  492 aa  ARLY_METLZ RecName: Full=Argininosuccinate lyase;       
    1::459     1e-70  35%  487 aa  ARLY_META3 RecName: Full=Argininosuccinate lyase;       
   23::386     4e-70  39%  491 aa  ARLY_METMA RecName: Full=Argininosuccinate lyase;       
    1::449     5e-70  33%  475 aa  ARLY_STRCO RecName: Full=Argininosuccinate lyase;       
    1::439     1e-69  33%  460 aa  ARLY_SOLUE RecName: Full=Argininosuccinate lyase;       
   24::453     1e-69  33%  460 aa  ARLY_RHOBA RecName: Full=Argininosuccinate lyase;       
   10::393     4e-69  39%  481 aa  ARLY_METM6 RecName: Full=Argininosuccinate lyase;       
   10::393     5e-69  38%  481 aa  ARLY_METM7 RecName: Full=Argininosuccinate lyase;       
   10::457     2e-68  33%  466 aa  ARLY1_CHICK RecName: Full=Delta-1 crystallin;AltName: Full=Delta
   10::386     3e-68  39%  481 aa  ARLY_METMP RecName: Full=Argininosuccinate lyase;       
   10::457     6e-68  33%  466 aa  ARLY1_MELGA RecName: Full=Delta-1 crystallin;AltName: Full=Delta
   10::386     8e-68  40%  481 aa  ARLY_METM5 RecName: Full=Argininosuccinate lyase;       
   25::397     2e-67  36%  492 aa  ARLY_METMJ RecName: Full=Argininosuccinate lyase;       
   23::386     3e-67  37%  491 aa  ARLY_METBF RecName: Full=Argininosuccinate lyase;       
   18::460     3e-67  32%  488 aa  ARLY_CORJK RecName: Full=Argininosuccinate lyase;       
    1::448     8e-67  35%  464 aa  ARLY_FRASC RecName: Full=Argininosuccinate lyase;       
    1::392     1e-66  35%  464 aa  ARLY_ACIBL RecName: Full=Argininosuccinate lyase;       
   20::386     2e-66  37%  491 aa  ARLY_METAC RecName: Full=Argininosuccinate lyase;       
    7::455     2e-66  32%  477 aa  ARLY_COREF RecName: Full=Argininosuccinate lyase;       
    1::465     3e-66  33%  490 aa  ARLY_BIFLI RecName: Full=Argininosuccinate lyase;       
    1::465     1e-65  32%  490 aa  ARLY_BIFLO RecName: Full=Argininosuccinate lyase;       
    1::465     1e-65  32%  490 aa  ARLY_BIFLD RecName: Full=Argininosuccinate lyase;       
    7::456     3e-65  30%  488 aa  ARLY2_RHIME RecName: Full=Argininosuccinate lyase 2;       
   17::456     1e-64  32%  480 aa  ARLY_SACEN RecName: Full=Argininosuccinate lyase;       
    5::454     1e-64  30%  461 aa  ARLY_CHLSY RecName: Full=Argininosuccinate lyase;       
    5::454     1e-64  30%  461 aa  ARLY_CHLAA RecName: Full=Argininosuccinate lyase;       
    1::450     7e-64  31%  455 aa  ARLY_ROSCS RecName: Full=Argininosuccinate lyase;       
    5::442     9e-64  33%  483 aa  ARLY_ARCFU RecName: Full=Argininosuccinate lyase;       
    6::463     6e-63  33%  476 aa  ARLY_THEFY RecName: Full=Argininosuccinate lyase;       
    7::463     1e-62  31%  477 aa  ARLY_CORDI RecName: Full=Argininosuccinate lyase;       
   24::395     1e-62  35%  494 aa  ARLY_METPE RecName: Full=Argininosuccinate lyase;       
   16::455     1e-62  33%  497 aa  ARLY_CLAM3 RecName: Full=Argininosuccinate lyase;       
    7::449     8e-62  31%  477 aa  ARLY_CORGB RecName: Full=Argininosuccinate lyase;       
    5::397     2e-61  32%  505 aa  ARLY_RHOFA RecName: Full=Argininosuccinate lyase;       
    7::449     2e-61  31%  477 aa  ARLY_CORGL RecName: Full=Argininosuccinate lyase;       
    1::448     5e-61  31%  471 aa  ARLY_RENSM RecName: Full=Argininosuccinate lyase;       
    1::381     1e-60  34%  487 aa  ARLY_METTP RecName: Full=Argininosuccinate lyase;       
    4::446     2e-59  31%  470 aa  ARLY_MYCMM RecName: Full=Argininosuccinate lyase;       
    4::446     4e-59  31%  470 aa  ARLY_MYCUA RecName: Full=Argininosuccinate lyase;       
    9::395     1e-58  34%  493 aa  ARLY_METHJ RecName: Full=Argininosuccinate lyase;       
    1::447     1e-58  32%  473 aa  ARLY_STRCL RecName: Full=Argininosuccinate lyase;       
   16::455     1e-58  33%  493 aa  ARLY_CLAMS RecName: Full=Argininosuccinate lyase;       
   23::386     2e-58  35%  491 aa  ARLY_METBU RecName: Full=Argininosuccinate lyase;       
    8::457     6e-57  29%  475 aa  ARLY1_PSEPF RecName: Full=Argininosuccinate lyase 1;       
   83::446     8e-57  32%  486 aa  ARLY_ACIC5 RecName: Full=Argininosuccinate lyase;       
    7::449     1e-56  29%  472 aa  ARLY_RHOOB RecName: Full=Argininosuccinate lyase;       
   13::457     2e-56  33%  481 aa  ARLY_KINRD RecName: Full=Argininosuccinate lyase;       
   72::459     1e-55  32%  475 aa  ARLY_LEIXX RecName: Full=Argininosuccinate lyase;       
    5::454     1e-55  29%  462 aa  ARLY_CHLAD RecName: Full=Argininosuccinate lyase;       
    1::454     2e-55  30%  468 aa  ARLY_PROAC RecName: Full=Argininosuccinate lyase;       
    7::454     3e-55  31%  472 aa  ARLY_MYCPA RecName: Full=Argininosuccinate lyase;       
    7::446     3e-55  32%  472 aa  ARLY_MYCA1 RecName: Full=Argininosuccinate lyase;       
    4::454     1e-54  30%  470 aa  ARLY_MYCLE RecName: Full=Argininosuccinate lyase;       
    4::454     1e-54  30%  470 aa  ARLY_MYCLB RecName: Full=Argininosuccinate lyase;       
    1::383     8e-54  30%  452 aa  ARLY_TREPR RecName: Full=Argininosuccinate lyase;       
    7::449     8e-54  29%  472 aa  ARLY_RHOSR RecName: Full=Argininosuccinate lyase;       
    4::459     4e-53  31%  469 aa  ARLY_MYCS2 RecName: Full=Argininosuccinate lyase;       
    4::446     8e-52  30%  470 aa  ARLY_MYCTU RecName: Full=Argininosuccinate lyase;       
    4::446     8e-52  30%  470 aa  ARLY_MYCTA RecName: Full=Argininosuccinate lyase;       
    4::446     8e-52  30%  470 aa  ARLY_MYCBT RecName: Full=Argininosuccinate lyase;       
    4::446     8e-52  30%  470 aa  ARLY_MYCBP RecName: Full=Argininosuccinate lyase;       
    4::446     8e-52  30%  470 aa  ARLY_MYCBO RecName: Full=Argininosuccinate lyase;       
   70::394     5e-51  34%  498 aa  ARLY1_BACSK RecName: Full=Argininosuccinate lyase 1;       
   22::410     2e-50  33%  489 aa  ARLY_ACIC1 RecName: Full=Argininosuccinate lyase;       
    4::450     2e-50  29%  473 aa  ARLY_MYCA9 RecName: Full=Argininosuccinate lyase;       
    4::455     5e-50  29%  470 aa  ARLY_NOCSJ RecName: Full=Argininosuccinate lyase;       
    4::454     5e-49  30%  470 aa  ARLY_MYCSJ RecName: Full=Argininosuccinate lyase;       
    4::460     1e-48  29%  470 aa  ARLY_MYCSS RecName: Full=Argininosuccinate lyase;       
    4::460     1e-48  29%  470 aa  ARLY_MYCSK RecName: Full=Argininosuccinate lyase;       
    4::446     1e-48  33%  470 aa  ARLY_MYCGI RecName: Full=Argininosuccinate lyase;       
   18::374     5e-48  34%  447 aa  ARLY_SULAC RecName: Full=Argininosuccinate lyase;       
    6::367     1e-47  34%  444 aa  ARLY_SULSO RecName: Full=Argininosuccinate lyase;       
    5::387     6e-47  29%  447 aa  ARLY_BACFN RecName: Full=Argininosuccinate lyase;       
    5::387     1e-46  29%  447 aa  ARLY_BACFR RecName: Full=Argininosuccinate lyase;       
   27::385     3e-46  35%  490 aa  ARLY_NATPD RecName: Full=Argininosuccinate lyase;       
    5::387     3e-46  29%  446 aa  ARLY_BACV8 RecName: Full=Argininosuccinate lyase;       
    4::460     8e-46  29%  470 aa  ARLY_MYCVP RecName: Full=Argininosuccinate lyase;       
    5::387     1e-45  32%  446 aa  ARLY_BACTN RecName: Full=Argininosuccinate lyase;       
   91::396     2e-45  35%  499 aa  ARLY_HALMA RecName: Full=Argininosuccinate lyase;       
    5::387     9e-45  29%  446 aa  ARLY_PARD8 RecName: Full=Argininosuccinate lyase;       
   90::386     5e-42  33%  459 aa  ARLY_PYRFU RecName: Full=Argininosuccinate lyase;       
    8::450     4e-41  30%  473 aa  ARLY_NOCFA RecName: Full=Argininosuccinate lyase;       
   65::374     5e-41  32%  446 aa  ARLY_SULTO RecName: Full=Argininosuccinate lyase;       
   21::390     8e-41  30%  398 aa  ARLY_THENN RecName: Full=Argininosuccinate lyase;       
   45::399     1e-40  28%  504 aa  ARLY2_AGRT5 RecName: Full=Argininosuccinate lyase 2;       
   10::392     5e-40  26%  508 aa  ARLY_METKA RecName: Full=Argininosuccinate lyase;       
   23::327     8e-36  30%  431 aa  ARLY_XANOP RecName: Full=Argininosuccinate lyase;       
   23::327     8e-36  30%  431 aa  ARLY_XANOM RecName: Full=Argininosuccinate lyase;       
   19::332     2e-35  31%  445 aa  ARLY_XYLFT RecName: Full=Argininosuccinate lyase;       
    8::332     2e-34  32%  445 aa  ARLY_XYLFA RecName: Full=Argininosuccinate lyase;       
   23::327     4e-34  29%  432 aa  ARLY_XANAC RecName: Full=Argininosuccinate lyase;       
   23::327     1e-33  29%  432 aa  ARLY_XANC5 RecName: Full=Argininosuccinate lyase;       
   23::331     2e-33  29%  431 aa  ARLY_STRMK RecName: Full=Argininosuccinate lyase;       
   23::331     4e-33  29%  431 aa  ARLY_STRM5 RecName: Full=Argininosuccinate lyase;       
  533::827     1e-32  31%  927 aa  ARLY2_RHILO RecName: Full=Argininosuccinate lyase 2;       
   23::327     2e-32  33%  431 aa  ARLY_XANCP RecName: Full=Argininosuccinate lyase;       
   23::327     2e-32  33%  431 aa  ARLY_XANC8 RecName: Full=Argininosuccinate lyase;       
   14::379     2e-32  29%  429 aa  ARLY_PYRIL RecName: Full=Argininosuccinate lyase;       
   23::327     4e-32  33%  431 aa  ARLY_XANCB RecName: Full=Argininosuccinate lyase;       
   24::385     3e-31  30%  485 aa  ARLY_HALSA RecName: Full=Argininosuccinate lyase;       
   24::385     3e-31  30%  485 aa  ARLY_HALS3 RecName: Full=Argininosuccinate lyase;       
   14::386     6e-31  27%  429 aa  ARLY_PYRAE RecName: Full=Argininosuccinate lyase;       
   74::379     3e-30  28%  429 aa  ARLY_PYRCJ RecName: Full=Argininosuccinate lyase;       
   14::384     2e-29  27%  429 aa  ARLY_PYRAR RecName: Full=Argininosuccinate lyase;       
    2::386     9e-29  28%  430 aa  ARLY_SORC5 RecName: Full=Argininosuccinate lyase;       
   73::379     6e-25  25%  429 aa  ARLY_THENV RecName: Full=Argininosuccinate lyase;       
   63::339     5e-14  28%  450 aa  PUR8_PYRHO RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   84::344     2e-13  25%  437 aa  PUR8_AQUAE RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   81::334     7e-13  26%  431 aa  PUR8_BACSU RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   63::303     6e-12  27%  450 aa  PUR8_PYRAB RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  114::416     1e-11  27%  475 aa  ASPA_BACSU RecName: Full=Aspartate ammonia-lyase;       
   79::292     4e-11  24%  431 aa  PUR8_SYNY3 RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  130::413     5e-11  25%  460 aa  FUMC_CHLPN RecName: Full=Fumarate hydratase class II;       
   79::303     6e-11  25%  432 aa  PUR8_STRMU RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   73::416     6e-11  26%  463 aa  FUMC_RICCN RecName: Full=Fumarate hydratase class II;       
   73::416     8e-11  25%  461 aa  FUMC_RICFE RecName: Full=Fumarate hydratase class II;       
  105::410     1e-10  26%  438 aa  FUMC_SULSO RecName: Full=Fumarate hydratase class II;       
   53::341     5e-10  23%  431 aa  PUR8_THEMA RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   81::349     4e-09  25%  440 aa  PUR8_HELPY RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  133::416     4e-09  24%  461 aa  FUMC_RICTY RecName: Full=Fumarate hydratase class II;       
  133::331     8e-09  28%  467 aa  FUMC_STRAW RecName: Full=Fumarate hydratase class II;       
  133::416     1e-08  24%  461 aa  FUMC_RICPR RecName: Full=Fumarate hydratase class II;       
  136::368     2e-08  28%  488 aa  FUMH_YEAST RecName: Full=Fumarate hydratase, mitochondrial;        
  181::412     2e-08  26%  473 aa  FUMC_COREF RecName: Full=Fumarate hydratase class II;       
  133::416     3e-08  26%  463 aa  FUMC_RICBR RecName: Full=Fumarate hydratase class II;       
  134::413     4e-08  26%  473 aa  FUMC_XYLFT RecName: Full=Fumarate hydratase class II;       
  134::413     4e-08  26%  473 aa  FUMC_XYLFA RecName: Full=Fumarate hydratase class II;       
  133::342     5e-08  26%  463 aa  FUMC_HELPJ RecName: Full=Fumarate hydratase class II;       
  133::342     7e-08  26%  463 aa  FUMC_HELPY RecName: Full=Fumarate hydratase class II;       
   75::303     9e-08  23%  431 aa  PUR8_STAAW RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAAS RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAAR RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAAN RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAAM RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAAC RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAAB RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAA8 RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     9e-08  23%  431 aa  PUR8_STAA3 RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   68::347     1e-07  25%  449 aa  PUR8_METTH RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  110::413     1e-07  25%  463 aa  FUMC_BRUSU RecName: Full=Fumarate hydratase class II;       
  110::413     1e-07  25%  463 aa  FUMC_BRUME RecName: Full=Fumarate hydratase class II;       
  130::345     1e-07  26%  463 aa  FUMC_CHLTR RecName: Full=Fumarate hydratase class II;       
   75::303     2e-07  23%  431 aa  PUR8_STAHJ RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     3e-07  25%  431 aa  PUR8_STAES RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   75::303     3e-07  25%  431 aa  PUR8_STAEQ RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  127::325     3e-07  27%  461 aa  FUMC_STRCO RecName: Full=Fumarate hydratase class II;       
  130::345     3e-07  26%  463 aa  FUMC_CHLMU RecName: Full=Fumarate hydratase class II;       
  189::439     4e-07  23%  526 aa  ASPA_CORGL RecName: Full=Aspartate ammonia-lyase;       
  140::446     6e-07  25%  494 aa  FUMH_RHIOR RecName: Full=Fumarate hydratase, mitochondrial;        
  135::439     6e-07  26%  461 aa  FUMC_PROMP RecName: Full=Fumarate hydratase class II;       
   75::295     2e-06  23%  431 aa  PUR8_STAS1 RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  139::371     2e-06  28%  492 aa  FUM1_ARATH RecName: Full=Fumarate hydratase 1, mitochondrial;      
  168::412     2e-06  23%  473 aa  FUMC_CORGL RecName: Full=Fumarate hydratase class II;       
  131::414     3e-06  24%  464 aa  FUMC2_PSEAE RecName: Full=Fumarate hydratase class II 2;       
  130::340     4e-06  24%  460 aa  FUMC_CHLCV RecName: Full=Fumarate hydratase class II;       
  132::342     5e-06  28%  463 aa  FUMC_CAMJE RecName: Full=Fumarate hydratase class II;       
  181::343     1e-05  30%  474 aa  FUMC_MYCTU RecName: Full=Fumarate hydratase class II;       
  181::343     1e-05  30%  474 aa  FUMC_MYCBO RecName: Full=Fumarate hydratase class II;       
  132::437     1e-05  24%  468 aa  ASPA_HELPY RecName: Full=Aspartate ammonia-lyase;       
   81::348     2e-05  25%  435 aa  PUR8_DEIRA RecName: Full=Adenylosuccinate lyase;         Short=ASL;
   78::337     2e-05  29%  460 aa  PUR8_BUCBP RecName: Full=Adenylosuccinate lyase;         Short=ASL;
  146::378     2e-05  25%  499 aa  FUM2_ARATH RecName: Full=Fumarate hydratase 2, chloroplastic;      
  139::431     2e-05  24%  474 aa  ASPA_PSEAE RecName: Full=Aspartate ammonia-lyase;       
  132::437     3e-05  24%  468 aa  ASPA_HELPJ RecName: Full=Aspartate ammonia-lyase;       
  143::425     7e-05  24%  478 aa  ASPA_PSEFL RecName: Full=Aspartate ammonia-lyase;       
  136::437     1e-04  25%  485 aa  FUMH_DICDI RecName: Full=Fumarate hydratase, mitochondrial;        
  183::433     2e-04  24%  461 aa  FUMC_OCEIH RecName: Full=Fumarate hydratase class II;       
  165::398     2e-04  28%  520 aa  FUMH_SCHPO RecName: Full=Fumarate hydratase, mitochondrial;        
  134::332     2e-04  24%  465 aa  FUMC_PROMA RecName: Full=Fumarate hydratase class II;       
  180::426     3e-04  25%  464 aa  FUMC_WIGBR RecName: Full=Fumarate hydratase class II;       
  101::336     3e-04  27%  455 aa  FUMC_LISIN RecName: Full=Fumarate hydratase class II;       
   96::308     4e-04  22%  447 aa  YBN5_SCHPO RecName: Full=Uncharacterized protein C8E4.05c;
 1102::1202    6e-04  30% 1816 aa  Y8827_DICDI RecName: Full=Uncharacterized helicase DDB_G0278827;     
  255::375     6e-04  26%  568 aa  SYP_MACCJ RecName: Full=Prolyl-tRNA synthetase;       
  127::336     6e-04  25%  455 aa  FUMC_LISMF RecName: Full=Fumarate hydratase class II;       
  131::341     8e-04  22%  464 aa  FUMC_PSEPK RecName: Full=Fumarate hydratase class II;       
  112::345     8e-04  24%  464 aa  FUMC_DEIRA RecName: Full=Fumarate hydratase class II;       
    1::462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVKNKNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQXXXXXXXXXXXXXGLN
ARLY_PELUB      MVKNKNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQXXXXXXXXXXXXXGLN
ARLY1_AGRT5     ----KSSNQMWGGRFASGPSAIMEEINASIGFDKKLYAQDIRGSIAHATMLAEKGIISQEDKEKIVHGLN
ARLY_EHRCJ      ---------LWGGRFTTSSSDIMKKINESISFDKTLYEEDIAGSIAHCKMLVNQRIISKYEGQLIIHGLE
ARLY_BRUSU      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUSI      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUME      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUMB      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUC2      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUAB      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUA2      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_BRUA1      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHKQIENGLK
ARLY_MESSB      MNENKASNRMWGGRFASGPDAIMEAINASIGFDRKLYAQDIRGSLAHAAMLAETGIISTEDEKKIAHGLN
ARLY_EHRCR      ---------LWGGRFTVSPSDIMKKINESISFDKILYEEDISGSIAHCKMLVNQKIISKYEGQLIIHGLE
ARLY_OCHA4      MSEQKSSNQMWGGRFASGPDAIMEEINASIGFDRKLYAQDIQGSLAHAAMLAKTGIIAAEDHRQIEDGLK
ARLY_EHRRW      ---------LWGGRFTTSSNDIMKKINESISFDQALYEEDILTSIAHCKMLVNQKIISKYEGQLIIHGLE
ARLY_EHRRG      ---------LWGGRFTTSSNDIMKKINESISFDQALYEEDILTSIAHCKMLVNQKIISKYEGQLIIHGLE
ARLY1_RHILO     MSDKKTSNQMWGGRFASGPAAIMEAINASISFDRKLYAQDIRGSIAHSEMLAQTGIISTADQEKIAHGLN
ARLY_RHIL3      ----KSSNQMWGGRFASGPDAIMEEINASIGFDKKLFAQDIRGSIAHATMLAHQEIISAEDKDKIVHGLN
ARLY_RHIE6      ---SKSSNQMWGGRFASGPDAIMEEINASIGFDKKLFAQDIRGSIAHATMLAHQGIISAEDKDKIVHGLN
ARLY1_RHIME     --ETKSSNQMWGGRFASGPDAIMEEINASIGFDKKLYAQDIRGSIAHATMLAHQGIISAEDKDKIVHGLD
ARLY_AGRVS      ---------MWGGRFASGPAAIMEEINASIGFDKKLYAQDIRGSIAHATMLAHQGIISGEDKDKIVTGLN
ARLY_RHISN      --ETKSSNQMWGGRFASGPDAIMEEINASIGFDKKLYAQDIRGSIAHATMLAHKGIISAEDKDKIVHGLE
ARLY_NITSB      ---------MWSGRFNANASTLLDQFNASLPFDKELYLQDIQGSIAHATMLAKQGILSQEEAESIIHGLK
ARLY_BARBK      MTGDKLSNQMWGGRFAAGPAAIMEEINASIDFDQKLYRQDIEGSLSHAAMLAQTKIISHSDYEKIVHGLQ
ARLY_CAMHC      ---------LWEGRFSEASSALLEEFNASINFDKKLYKDDIEGSIAHSSMLANCGILSKDEVDKIKNGLN
ARLY_RHIEC      ----KSSNQMWGGRFASGPDAIMEEINASIGFDKKLFAQDIRGSIAHATMLAHQGIISSDDKDKIVHGLN
ARLY_CALS8      ---------LWQGRFSKDTARIFDEFNASIMVDINLFEYDVMGSVAHVKMLSKCDIIPEDEGKLIVNTLY
ARLY_ZYMMO      --RQTDSNAMWGGRFSEGPTAIMREINASIPFDKRLWQQDIAGSKAHLKMLVSRNIITAEDGQKILEGLD
ARLY_PARDP      ---------MWGGRFAAGPDAIMEAINASIGFDQRLYAQDIRGSRAHAAMLAAQGIISTSDAEAIGEGLL
ARLY_BART1      ----KNQM--WGGRFIAGPAAVMEEINASIDVDQKLYRQDIEGSLSHAAMLAQTKIILQSDYEKISHGLK
ARLY_RHOS1      --------AMWGGRFAAGPDAIMQAINASIGFDKRLYAQDIRGSRAHAAMLAAQGILTSRDAEAIGEGLL
ARLY_METPB      ---------MWGGRFASGPAEIMEEINASIGFDRRLAPQDIRGSLAHVAMLGSRGILPAEDVAAIEAGLK
ARLY_WOLSU      ---------LWAGRFLEASSELLERFNASLPFDKALYFEDIKGSKAHAKMLAKQEIITAKECEEILAGLE
ARLY_RHOS4      ---------MWGGRFAAGPDAIMQAINASIGFDKRLYAQDIRGSRAHAAMLAAQGILTSRDAEAIGEGLL
ARLY_RHOPT      ---------MWGGRFTDRPDAIMEEINVSIDVDRHLYAQDITASKAHAAMLAAQGIITANDAKNIGKGLD
ARLY_RHOPA      ---------MWGGRFTDRPDAIMEEINVSIDVDRHLYAQDITASKAHAAMLAAQGIITANDAKNIGKGLD
ARLY_METEP      ---------MWGGRFASGPAEIMEEINASIGFDRRLASQDIRGSLAHVAMLGSQGILPAEDVAAIEAGLK
ARLY_ANATD      -----SNLKLWEGRFSKSTAQIFDLFNASIMTDIKLFEYDILGSVAHVKMLAKCNIIREDEAKLIIDSLY
ARLY_RHOPS      ---------MWGGRFTDRPDAIMEEINVSIDVDRHLYAQDIXXXXXXXXXXXXQGIITANDAKNIGKGLD
ARLY_BRAJA      ---------MWGGRFSERPDEIMEEINVSIDVDRHLYAQDIAASKAHAAMLATQGIITASDAKNIGKGLD
ARLY_METC4      ---------MWGGRFASGPAEIMEEINASIGFDRRLASQDIRGSLAHVAMLGSQGILPAEDVAAIEAGLK
ARLY_LACLA      ---------LWGGRFEASLDKQTEEFGASIKFEQRLAPFDLKGSLAHVKMLGETGIITTEESKKIAEGLK
ARLY_GEOSF      ---------LWGGRFTQPTDKFVEEFTASIDFDKRLYHQDIRGSIAHARMLGKQRIIPMEDVEKIVHGLQ
ARLY_CAUSK      ---------MWGGRFSAKPAELMQAINVSIGFDKRLWAQDLAGSRAHARMLISQGVIARDDGEEILKGLD
ARLY_ARCB4      --------------LKNTNAQILDEFNASIMFDKELYAQDIKGSIAHSKMLASQGILTNEEQKAIEKGLF
ARLY_LISMC      ---------LWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAMLSKCGIIPASEAAEITAGLK
ARLY_JANSC      ---------MWGGRFAAGPDAIMEAINASISFDQRMARQDIEGSRAHAAMLAATGIVESSDVDVIREGLL
ARLY_METRJ      ---------MWGGRFASGPAEIMEEINASIGFDKRLAPQDIRGSLAHVAMLGKAGILPAEDVAAIEAGLK
ARLY_GEOLS      ---------LWGGRFTQPTDKFVEEFTASIDFDKRLYHQDIRGSVAHARMLGRQGIIPQQDVEQIVHGLK
ARLY_LISMF      ---------LWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAMLSKCGIIPASEAAEITAGLK
ARLY_ROSDO      ----KSSNQMWGGRFADGPDAIMEAINASIGFDKRMAAQDIAGSRAHAAMLGATGIVEPSDAQAMGEGLL
ARLY_MAGSA      --KTKAASSMWGGRFAGGPAAIMQRINASIDFDKRLYAQDIRGSKAHCRMLVKQQILTEADGALILDGLD
ARLY_LISIN      ---------LWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAMLAKCGIISDSEASEITAGLK
ARLY_LISMH      ---------LWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAMLSKCGIIPASEAAEITAGLK
ARLY_LISMO      ---------LWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAMLGKCGIIPASEAAEITAGLK
ARLY_CAUCR      ---------MWGGRFSAKPAELMQAINVSIGFDKRLWAQDLAGSRAHARMLMNQGVIASHDGEEILEGLA
ARLY_STRA5      ------NHKLWGGRFESSLEKWVEEFGASISFDQKLAPYDMKASMAHVTMLGKTDIISQEEAGLIKDGLK
ARLY_RHOP2      ---------MWGGRFTDRPDAIMEEINVSIDVDRHLYAQDIXXXXXXXXXXXXQGIITANDAKNIGKGLD
ARLY_STRA1      ------NHKLWGGRFESSLEKWVEEFGASISFDQKLAPYDMKASMAHVTMLGKTDIISQEEAGLIKDGLK
ARLY_RHOS5      --------AMWGGRFAAGPDAIMQAINASIGFDKRLYAQDIRGSRAHAAMLAAQGILSSRDAEAIGEGLL
ARLY_BACCN      ---------LWGGRFTEEAEAWVEEFGASISFDKQLVKQDIEGSIAHVMMLAKQGIVTNDEAEKIKEGLQ
ARLY_STRA3      ------NHKLWGGRFESSLEKWVEEFGASISFDQKLAPYDMKASMAHVTMLGKTDIISQEEAGLIKDGLK
ARLY_STRTD      ------NHKLWGGRFEASLEKWVEEFGASISFDQKMAEFDLKGSIAHVTMLGETGIIAQEEALQIKQGLE
ARLY_STRT2      ------NHKLWGGRFEASLEKWVEEFGASISFDQKMAEFDLKGSIAHVTMLGETGIIAQEEALQIKQGLE
ARLY_STRT1      ------NHKLWGGRFEASLEKWVEEFGASISFDQKMAEFDLKGSIAHVTMLGETGIIAQEEALQIKQGLE
ARLY_LACS1      ---------MWGGRFQEGSSKLVDEFGASISFDKHMAYEDLEGSLAHVKMLKHTNILSADDADKIIAGLH
ARLY_SULNB      ---------IASARISEKSSKLLQDLNNSLPFDKVLYREDIEGSRAHAFMLSEQGIISREDQEKIDAGLQ
ARLY_STRGC      ------NHKLWGGRFEASLEGWVEEFGASIGFDYRLAPYDLEGSLAHVKMLGQTGXXXXXXXXXXXXGLE
ARLY_LISW6      ---------LWGGRFQGKSEAWIDDFGASISFDQKMAKEDLTGSLAHVAMLGKCGIISDAEAAEITAGLK
ARLY_GEOMG      ---------LWGGRFSEPTDKFVEEFTASIDFDKRLYHQDIRGSIAHARMLGKQGIIPMEDVEKITAGLQ
ARLY_SULDN      ---------MWSGRFSATASSLLDQFNASIMFDRKLYREDIEGSIAHATMLAKQGILTTDELSQITKGLS
ARLY_DINSH      MSDTKSN-AMWGGRFAAGPDAIMEAINASIGFDRRLARQDIDGSRAHAAMLAQQGILSSKDAEAIREGLL
ARLY_SYNAS      ----------WGGRFQEPTNELVEAFTASISFDRRLYRYDIEGSIAHARMLVRQEIINRKEGFAIVEGLK
ARLY_BACCZ      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_PARL1      ---------MWGGRFGEGPDRIMEEINASIGFDQRFFAQDIRGSKAHCRMLAEKGIISSEDAAQIVAGLD
ARLY_SYMTH      ---------LWGGRFTKPADKTAEGFTSSLAFDRRLYKQDIRGSIAHVRMLGRQGIIPAADAARIEQGLR
ARLY_STRU0      ------NQKLWGGRFEKGLEQWVEEFGASISFDYKLATFDIKASIAHVSMLGQQGIISKDEAELIKTGLE
ARLY_RHORT      ---------IWGGRFDSGPSAVMEAINASIGFDKRLYRQDIAGSKAHCTMLVATGILSKADGEAILGGLD
ARLY_LACPL      ---------LWGGRFTETGAKYVDDFGASISFDQLLAAEDIAGSLAHVKMLKKTGILPAADVDQIVAGLE
ARLY_GEOUR      ---------LWGGRFTQPTDKFVEEFTASIDFDKRLYHQDIRGSIAHARMLGKQKIIPMADVEKIVQGLQ
ARLY_BACAH      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_GEOSL      ---------LWGGRFSEPTDQFVEEFTASIDFDKRLYHQDIRGSIAHARMLGKQGILPMAEVEKIVAGLQ
ARLY_MARMM      ----KASSAMWGGRFSAGPSAVMEAINASIDIDQRMADQDIDGSLAHSRMLAATGVISSADAAAIQRGLE
ARLY_CAMC1      MKKNENHKKMWEGRFSEASSKLLEEFNASINFDKNLFEEDIAGSKAHAKMLGICGILKKDESEAIIKGLD
ARLY_PELPD      ---------LWGGRFTQPTDAFVEEFTASIQFDKRLYHQDIRGSIAHARMLGKQGIIPQADVEAIVEGLQ
ARLY_CLOTE      -------MKLWGGRFKGEENKLMEDFNSSLSFDKRLYKEDILGSKAHVKMLGNCNILKDYEVEEIIKGLD
ARLY_LACRJ      ---------MWGGRFEEAGDQLVNQFNASISFDQEMAQEDIEGSLAHVKMLKETQILSAEDADKIIAGLK
ARLY_LACRD      ---------MWGGRFEEAGDQLVNQFNASISFDQEMAQEDIEGSLAHVKMLKETQILSAEDADKIIAGLK
ARLY_GLUOX      ----------WGGRFASGPAAIMGEINASIGFDKILWRQDIRGSLAHAAMLQKVGLLTETELAEIRQGLG
ARLY_STRSY      ---------LWGGRFEASLEEWVEEFGASIRFDQKLAKYDIQGSLAHVKMLGQTRIISQAEAQVIQAGXX
ARLY_STRS2      ---------LWGGRFEASLEEWVEEFGASIRFDQKLAKYDIQGSLAHVKMLGQTRIISQAEAQVIQAGXX
ARLY_STRMU      ------NHKLWGGRFEAGLAQWVEEFGASISFDQKLAEFDLKGSIAHVTMLGEKGIISQEDAATIKAGLE
ARLY_ANOFW      ---------LWGGRFTKTAAQWVDDFGASIHFDQQLVEEDIEGSIAHVTMLGECGILPKEDVETIKKGLT
ARLY_BRASO      ---------MWGGRFTERPDEIMEDINVSIDVDRHLYAQDIXXXXXXXXXXXXQGIITSGDAKNMARGLD
ARLY_SILPO      ---DKTSNQMWGGRFAAGPDAIMEAINASIGFDKRLAAQDIAGSRAHAAMLAATGVITDSDAEAIREGLL
ARLY_EXISA      ---------LWGGRFEKTASDWVDAFGASIEFDAQLVLEDLEGSMAHVTMLGDQGILLKEEVTQILDGLQ
ARLY_CLOAB      -------MKLWGGRFRESESELMEEFNASLSFDKKLYEEDIEGSIAHVKMLXXXXXXXXXXXXXXLSGLK
ARLY_CLOK5      -------MKLWGGRFKKSESKLMEDFNSSLSFDRQLYKEDIEGSMVHVKMLAKCNILSSEESKAILSGLE
ARLY_CLOK1      -------MKLWGGRFKKSESKLMEDFNSSLSFDRQLYKEDIEGSMVHVKMLAKCNILSSEESKAILSGLE
ARLY_BRASB      ---------MWGGRFSERPDEIMEDINVSIDVDRHLYAQDIXXXXXXXXXXXXQGIITASDAKNIGKGLD
ARLY_CARHZ      -------MKLWGGRFEKDTDREMRDFHASIHFDWRLYEEDIRGSIAHVTMLARQGIITNEEKEKIIGALT
ARLY_STRSV      ------NHKLWGGRFEASLEDWVEEFGASIGFDYRLAPYDLQGSLAHVKMLGQTGXXXXXXXXXXXXGLE
ARLY_METNO      ---------MWGGRFASGPAEIMEEINASIGFDKRLAPQDIRGSLAHVAMLGKTGILPQADVAAIQAGLK
ARLY_BACCR      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSMAHVTMLAKQGIVTQEEAEKIKIGLQ
ARLY_GLUDA      --------AQWGGRFAGGPSAIMQDINASIGFDHVLWRQDIAGSLAHAAMLARTGIISADDEAAIRRGLT
ARLY_BACC2      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDIKGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_OCEIH      -------MKLWGGRFTKPTNELVDEYASSIQFDKKLAAYDIEGSLAHVAMLKKCEIIPAEDADKIAEGLK
ARLY_NOVAD      MSGNSGSNQMWGGRFAGGPSAIMREINASIPFDKALWRQDIAASKAHVDMLGAQGIVSAEDAALIASGLD
ARLY_BACWK      ---------LWGGRFTEEAEAWVEEFGASISFDKQLVSQDIKGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_STRZJ      ------NTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDVIGSLAHVQMLGQTGILSLEESEKIQVGXX
ARLY_STRP7      ------NTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDVIGSLAHVQMLGQTGILSLEESEKIQVGXX
ARLY_GEOSM      ---------LWGGRFTQPTDKFVEEFTASINFDKRLYHQDIRGSIAHATMLGKQGIIPIADVENIVSGLK
ARLY_BACC4      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSMAHVTMLAKQGIVTQEEAEKIKIGLQ
ARLY_XANP2      ---------MWGGRFTSAPDAIMEEINASIGFDQRLYAQDIAGSKAHAKMLAAQGIVAAQDADRIAEGLD
ARLY_GEOBB      ---------LWGGRFTQPTDKFVEEFTASINFDKRLYHQDIRGSIAHATMLGKQGIIPVADVESIVSGLK
ARLY_BACAN      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_BACAC      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_BACAA      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_STRR6      ------NTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDVIGSLAHVQMLGQTGILSLEESEKIQVGXX
ARLY_STRPI      ------NTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDVIGSLAHVQMLGQTGILSLEESEKIQVGXX
ARLY_STRP2      ------NTKLWGGRFEGTVEDWVERFGASISFDQKLAKFDVIGSLAHVQMLGQTGILSLEESEKIQVGXX
ARLY_RUTMC      ----------WGGRFNEPTDEFVKIFGASIFFDKILAPYDIQGSIAHATMLQEVGLLTENEKNKIIKGLE
ARLY_LACLM      ---------LWGGRFEASLDKQTEEFGASIKFEQRLAPFDLKGSLAHVKMLXXXXXXXXXXXXXXXXXLI
ARLY_BACC7      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_BACC1      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_LAWIP      ---------LWGGRFHEKTASPVEQYTQSISYDKKMYAQDIAGSKAHASMLGRQGILTSEEVLLLLNGLD
ARLY_LACLS      ---------LWGGRFEASLDKQTEEFGASIKFEQRLAPFDLKGSLAHVKMLXXXXXXXXXXXXXXXXXLI
ARLY_BACHK      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_VARPS      ----------WSALFSEPMSDLVKRYTASVFFDKRLWQADIEGSLAHAGMLAAQGIIGKQDHAEIERGMA
ARLY_SULSY      ---------LWGGRFSESTDAFVEEFTESISFDKELALYDIKGSMAHAKMLGKQGIIPQEDAEKIVKGLQ
ARLY_PROM9      ---------VWSKRFDNTLNPFIEKFNASISFDKKLILEDLECSIAHAKMLGKTKVLSSSETLLIINGLE
ARLY_HELHP      ---------LWGGRFELDSSALLEEFNASIFFDKQLWQEDIKGSKAHAKMLHKIGVLSEEETQEIINGLE
ARLY_CAMC5      ----------------------------SIGFDKNLYREDIAGSKAHAKMLGACGILKPEEAAAIVAGLD
ARLY_BACP2      ---------LWGGRFQKTPEKWVDEFGASIHFDKQLVKEDLTGSLAHASMLNTCGILDDEEAATIKDGLN
ARLY_BACC0      ---------LWGGRFTEEAEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQ
ARLY_ACIAC      ----------WSALFSEPMSDLVKRYTSSVFFDKRLWQADIAGSLAHADMLAAQGIISADDHAAIRRGMA
ARLY_GEOSW      ---------LWGGRFKKTAEEWVDEFGASIPFDQELVEEDIEGSIAHATMLGKCGILPSEDVEKIKAGLF
ARLY_BACHD      ---------LWGGRFTKTAEAWVDEFGASIGFDQQLVEEDIEGSLAHVTMLEKSGILANEEVEQIKKGLH
ARLY_RHOPB      ---------MWGGRFSERPDAIMEEINVSIDVDRHLYAQDIXXXXXXXXXXXXQGIVTAKDAKNIAKGLD
ARLY2_BACSK     ---------LWGGRFTKTAEQWVDEFGASIGFDQQLVEEDITGSIAHVTMLAKQHILSEEEAAQIKNGLK
ARLY_PELCD      ----------WAGRFTQPTDAFVEAFTASIDFDQRLYRYDIQGSMAHARMLSRQGIITGAEAQTIISGLE
ARLY_HYPNA      MADDKGQM-MWGGRFAATPSAIMEEINASLDIDRRMAEEDVAGSRAHADMLAEMGILSVADNEAIQGGLD
ARLY_NITWN      ---------MWGGRFGEGPDAIMEEINVSIDVDRHLYAQDIAASKVHAEMLAAQGIIAANDAKKIGKGLD
ARLY_LACF3      ---------MWGGRFEATGAKWVEEFGASISFDQQMAAEDLEGSLAHVTMLKETKILPAADADQIITGLK
ARLY_RHOFD      ----------WSALFSEPMSDLVKRYTASVFFDKRLWQADIAGSLAHADMLAAQKIISSEDHNAIQSGMA
ARLY_PROM0      ---------VWSKRFDNALDPFIEKFNASIGFDKKLILEDLDCSIAHAKMLGKTKVLSPSETLQIINGLE
ARLY_PSEPG      MSTDKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAQVGVLSDAERDTIIDGLK
ARLY_DEIRA      MTNQKQETKLWGGRFAEKTAELVELFNASVGFDQRLAEQDIRGSLAHVAMLGGQGILTAEEVSQITDGLN
ARLY_PROMP      ---------VWSNRFDGSLNPFIEEFNASISFDKTLILEDIECSIAHAKMLSKTKVLSTDESLKIIEGLE
ARLY_DESAA      ----------WDGRFAEKTDDMVEAFTSSIQVDKRLYAHDITGSIAHARTLAEAGVITSDEADAMEKGLR
ARLY_STACT      ----------WGGRFQSEPEAWVDAFNASINFDHLLIDEDIQGSIAHATMLAQQGILTEDESNTIIKGLQ
ARLY_PSEE4      MSTDKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAQVGVLNDKERDTIIDGLK
ARLY_METSB      ---------MWGGRFASGPDAIMEEINASIGFDYRLAMQDIAGSKAHVAMLADVGIVSADDAADITQGLE
ARLY_PROMS      ---------VWSKRFDNALDTFIEKFNASIFFDRKLILEDLDCSIAHAKMLGKTEVLSSTEALQIINGLE
ARLY_NITEC      ----------WSGRFSEPVALLVQRYTASVGFDYRLAEYDIQGSFAHARMLAATNIIPQTDLEAIEKGLT
ARLY_DESHY      -------MKLWGGRFEKSTDALVEDFHSSISFDQRLYKQDIQGSIAHARMLGEIGVLTSAEAQQIIEGLK
ARLY_DESHD      -------MKLWGGRFEKSTDALVEDFHSSISFDQRLYKQDIQGSIAHARMLGEIGVLTSAEAQQIIEGLK
ARLY_AZOVD      MSAEKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHASMLEQAGVLSAAERDAIIDGLK
ARLY_METPP      ----------WSALFSEPMSELVKRYTASVDFDQRLWRADIDGSLAHAEMLAAQGILTAEDHAAIVRGMA
ARLY_PSEPW      MSTDKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAQVGVLSDAERDTIIDGLN
ARLY_PSEPK      MSTEKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAQVGVLSDAERDTIIDGLK
ARLY_PSE14      MSTDKTNQS-WGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAERDTIVDGLN
ARLY_ALHEH      MTDKNTSEQLWTGRFTEATDAFVEQFSASEHFDRRLYRQDIAGSMAHARMLAEVGVLTAEERDRIVDGLT
ARLY_ACICJ      ----------WGGRFAAGPASVMQAINASIGFDQRLWREDIEGSLAHAGMLAAMGIISAEDXXXXXXXXX
ARLY_STAHJ      ----------WGGRFQQQPEDWVDEFNASIDFDQTLLDEDVQGSIAHATMLANQNIISQDDKDAIINGLK
ARLY_PROM2      ---------VWSKRFDNALDPFIEKFNASIGFDRKLILEDLDCSIAHAKMLGKTQVLTSSESSQIINGLE
ARLY_NEIG1      ----------WSGRFNEPVSELVKQYTASIGFDQRLAEWDIQGSLAHAQMLTRSGVLSENDLTDIRRGMS
ARLY_PSESM      MSTDKTNQS-WGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAERDTIVDGLN
ARLY_SACD2      MSQEENPVKPWGGRFSEPTDAFVERFTASVTFDQRLYHHDINGSIAHATMLASVGVLSEDEKTAIIDGLE
ARLY_PSEU2      MSTDKTNQS-WGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAERDTIVDGLN
ARLY_NITEU      ----------WSGRFSEPVAQLVQRYTASIGFDYRLAEYDIQGSLAHARMLAATGIIQPADLAAIEQGLA
ARLY_GEOTN      ---------LWGGRFTKTAEEWVDEFGASIPFDQELVEEDIEGSLAHVTMLGECGILPAEDVEKIKDGLL
ARLY_STAES      ----------WGGRFETQPEEWVDDFNASIDFDKNLIKQDVQGSIAHATMLAKQHIITDDEAQSIINELK
ARLY_STAEQ      ----------WGGRFETQPEEWVDDFNASIDFDKNLIKQDVQGSIAHATMLAKQHIITDDEAQSIINELK
ARLY_PSEFS      MSTDKTNQS-WGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAERDSIIDGLN
ARLY_MACCJ      ------NKALWGGRFKESMSEQVADFNQSIEVDARLFYQDIKGSIAHVTMLEKTHIITSDEANQIINGLQ
ARLY_AZOSE      ----------WSGRFSEPVSDLVKRYTASVSFDQRMAQQDIRGSLAHAKMLARQGIIGATDLADIERGMV
ARLY_PSEA7      MSVEKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAKVGVLSDAERDAIVDGLQ
ARLY_CLOTH      -------MKLWGGRFEKNTDKSVDDFNSSIRFDCRMYKQDILGSIAHAKMLGKCKIISEEDSILIQNTLR
ARLY2_PSEPF     MSTDKTNQS-WGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAERDSIIDGLK
ARLY_SPHWW      ---------MWGGRFAEGPAAVMREINASIPFDKRLWQQDIAGSKAHVAMLAKQKIVTEADAAEISRGLD
ARLY_PSEMY      MSSEKTNQS-WGGRFSEPVDAFVARFTASVEFDKRLYRHDIMGSIAHASMLAKVGVLTDAERDAIEGGLK
ARLY_PSEF5      MSTDKTNQS-WGGRFSEPVDAFVARFTASVTFDQRLYRHDIMGSIAHATMLAKVGVLTDAERDSIIDGLK
ARLY_NEIMF      ----------WSGRFNEPVSELVKQYTASIGFDRRLAEWDIQGSLAHAQMLKETGVLDEGDLADIRRGMA
ARLY_NEIMB      ----------WSGRFNEPVSELVKQYTASIGFDRRLAEWDIQGSLAHAQMLKETGVLDEGDLADIRRGMA
ARLY_NEIM0      ----------WSGRFNEPVSELVKQYTASIGFDRRLAEWDIQGSLAHAQMLKETGVLDEGDLADIRRGMA
ARLY_EUBE2      -------MKLWGGRFTKETNELVNNFNASISFDQKFYKQDIEGSIAHATMLGKQGIIPESESEQIVEGLK
ARLY_PROM5      ---------VWSNRFESSLNPFIEEFNASIGFDKTLIFEDIDCSIAHAKMLGKTKVLSADESQKIIEGLE
ARLY_NITHX      ---------MWGGRFGEGPDAIMEEINVSIDVDRHLYAQDIAASKVHAAMLAAQGIITADDAKNIDKGLD
ARLY_EXIS2      ---------LWGGRFTESASAQAEAFGASISFDQKLAAVDLQGSLAHAQMLYEQGILEKTEWEQIEAGLK
ARLY_NEIMA      ----------WSGRFNEPVSELVKQYTASIGFDRRLAEWDIQGSLAHAQMLKETGVLDEGDLADIRRGMA
ARLY_CLOCE      -------MKLWGGRFAKGTDKLVDDFNSSIRFDSRMYRHDILGSIAHANMLGKCGIISADESSLIQSSLK
ARLY_POLNA      ----------WSALFSEPMSDLVKRYTSSVFFDKRLWQADIAGSLAHADMLAAQSIIAPADHAAIQYGMA
ARLY_METFK      ---NQPSSKTWSGRFNEPVAELVKQYTASVGFDYRLAEYDIQGSLAHARMLGAQGIISQDDVAQIEQGLG
ARLY_CAMJR      ----KNEM--WSGRFSGASDELLKEFNASLNVDKTLFNEDIQGSIAHATMLESCGILKKEELDAIIKGLE
ARLY_STAS1      ----------WGGRFSEQPEDWVDEFNASIHFDKTLIQYDVQGSIAHAKMLAKQDIITDSDCDQIIEGLN
ARLY_CAMJD      ----KNEM--WSGRFSGASDELLKEFNASLNVDKTLFNEDIQGSIAHATMLESCGILKKEELDAIVKGLE
ARLY_ALCBS      ---DKQQNKLWGGRFSESTDQFVQEFTASVNFDRRMYRQDIYGSQAHATMLAEVGVLTDEERDAIIVGLR
ARLY_LEUMM      ---------LWGGRFTAKAAEWVDEFGASIHFDQKMAAEDIEGSIAHAKMLGKQGIISPEESEKIVSGLK
ARLY_PSEA8      MSVEKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAKVGVLSDAERDAIIDGLQ
ARLY_NITMU      -----DNTNTWSGRFDEPVSELVQRYTASVGFDKRLAEYDIQGSLAHARMLAAGGIIGPHDLDAIERGLS
ARLY_DESRM      -------MKLWGGRFQKTTDSLVEDFHSSISFDQRLYKQDIRGSIAHATMLGKVGIISLEEAAQIVTGLK
ARLY_CAMJE      ----KNEM--WSGRFSGASDELLKEFNASLNVDKTLFNEDIQGSIAHATMLESCGILKKEELDAIIKGLE
ARLY_PSEU5      MSTDKTNQS-WGGRFSEPVDAFVARFTASVEFDKRLYRHDIMGSIAHATMLAKAGVLTDAERDQIIANLK
ARLY_PSEAE      MSVEKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAKVGVLSDAERDAIVDGLQ
ARLY_LEPCP      ----------WSALFSEPMSELVKRYTASVFFDKRLWQADIAGSLAHAEMLAAQQIIGAQDLADIQRGMA
ARLY_HELMO      ---------LWGGRFEKGTDKVVEDFHSSIRFDQRLYKQDIRGSIAHARMLGRQGXXXXXXXXXXXXGLE
ARLY_BACLD      ---------LWGGRFQKTPEKWVDEFGASIHFDKTLVKEDIAGSLAHASMLEKCGILTEAEAVKIKEGLT
ARLY_CHRSD      -MSNTTNQS-WGGRFSEPTDAFVARFTASVDFDRRLYHHDIRGSIAHATMLERVGVLTADERDAILQGLG
ARLY_CAMJJ      ----KNEM--WSGRFSSASDELLKEFNASLNVDKTLFNEDIQGSIAHATMLESCGILKKEELDAIIKGLE
ARLY_ALKMQ      -------MKLWGGRFSKNTAALVDQFNASIEFDQKLYKYDIAGSVAHAKMLAHANIITKQESQLIVEGLQ
ARLY_CLOD6      -------MKLWGGRFRKAENQLMEEFNKSFGYDCVLYKKDIEGSVAHVHMQVKCGLLTEEEGKSITEGLK
ARLY_CAMJ8      ----KNEM--WSGRFSGASDELLKEFNASLNVDKTLFNEDIQGSIAHATMLESCGILKKEELDAIIKGLE
ARLY_BORPE      -----NKAQAWSARFSEPVSDLVKRYTASVDFDKRMARHDIRGSLAHADMLAAQGIISAQDLADIQRGMQ
ARLY_BORPA      -----NKAQAWSARFSEPVSDLVKRYTASVDFDKRMARHDIRGSLAHADMLAAQGIISAQDLADIQRGMQ
ARLY_BORBR      -----NKAQAWSARFSEPVSDLVKRYTASVDFDKRMARHDIRGSLAHADMLAAQGIISAQDLADIQRGMQ
ARLY_PSEAB      MSVEKTNQS-WGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAKVGVLSDAERDAIVDGLQ
ARLY_BURPP      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIEGSLAHASMLAAQKIIAADDLAAIQRGMA
ARLY_BURP8      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIEGSLAHASMLAAQKIISADDLAAIQRGMA
ARLY_AZOSB      ----------WSGRFSEPVSDLVKRYTASVFFDNRMAEQDIRGSLAHAKMLARQGIIGAQDLADIERGMA
ARLY_MOOTA      -------MKLWGGRFTRTTDRLVEDFHSSISFDQRLYKEDIAGSIAHARMLAAVGLITPAEGEAIIKGLE
ARLY_DEHSB      ------------SRFSKPADELVVRYTTSLPFDWRLYKEDIKCSTAHARMLSKQGIISTEDSQSIINGLN
ARLY_BACA2      ---------LWGGRFQKTPEKWVDEFGASITFDQNLVKEDITGSLAHAAMLKKCGILTEEEEGAIRQGLQ
ARLY_PSYA2      ---------MWGGRFSEATDSFVAAFTASVGFDQRFARHDIQGSIAHATMLKECSILEADDVATIIDGLQ
ARLY_DEIDV      MTPSTQDKKLWGGRFAEATDGLVELFNASVGFDQRLAEQDIRGSLAHVAMLGQVGILTSEEVTQISDGLG
ARLY_DEHSC      ------------SRFSKPADELVVRYTTSLPFDWRLYKEDIKCSTAHARMLSKQGIISAEDSQSIINGLN
ARLY_BURXL      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIEGSLAHASMLAAQKIIAADDLTAIQRGMA
ARLY_RALME      ----------WSARFSEPMSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAEADRAEIERGMT
ARLY_CLOB8      -------MKLWGGRFKKGTDKLVNDFNSSINVDSRMYKEDIEGSLAHASMLGNQNIISKEASDRITSGLL
ARLY_BACSU      ---------LWGGRFQKTPEKWVDEFGASISFDQNLVAEDITGSLAHAAMLKKCGILTAEEELKIREGLN
ARLY_PSYCK      ---------MWGGRFSEATDSFVAAFTASVGFDQRFARHDIQGSIAHATMLRECGILEADDVATIIDGLH
ARLY_DESPS      ---------LWGGRFSEAMAASVEKFSESISYDVRLYKYDIAGSKAHATMLSSQGIISPEELEQIIAGLS
ARLY_DESAD      ---------LWGGRFAAKTAQSVEDYTESVSYDQNLYREDISGSQAHAKMLAEQGVLTAEEAEILVKGLD
ARLY_CLOPE      -------MKLWGGRFTHQVDDLVNTFNSSISFDSRMYKEDIIGSIAHVTMLGEEKIIPKEDSKKIASGLY
ARLY_BURM1      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHANMLAAQKIISADDLAAIERGMA
ARLY_GEOKA      ---------LWGGRFTKTAEEWVDEFGASIPFDQELVEEDIEGSLAHVTMLGECGILPEGDVEQIKGGLI
ARLY_DEHE1      ------------SRFSKPADELVVRYTTSLPFDWRLYQEDIKCSTAHARMLGKQSIISAGDSQSIINGLS
ARLY_ANAVT      ----------WSQRFESALHPAIALFNASISFDIELIEYDLTGSQAHAQMLAHTGIISPAEGEQLVAGLE
ARLY_ACIBS      ---------MWGGRFSEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLS
ARLY_ACIBC      ---------MWGGRFSEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLS
ARLY_METCA      ---------LWGGRFEEATDAFVEAFTASVDFDKRLASHDIRGSIAHATMXXXXXXXXXXXXQAIVSGLE
ARLY_CLOP1      -------MKLWGGRFTHQVDDLVNTFNSSISFDSRMYKEDIIGSIAHVTMLGEEKIIPKEDSKKIASGLY
ARLY_ACIBY      ---------MWGGRFSEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLS
ARLY_ACIB5      ---------MWGGRFSEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLS
ARLY_ACIB3      ---------MWGGRFSEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLS
ARLY_SPHAL      MANTPDKSSMWGGRFGGGPAAIMQEINASIPIDKRLWEEDIAASRAHAAMLGACRXXXXXXXXXXXRGLA
ARLY_MAGSM      ---------LWGGRFSEPTNAFVEAFSASIDYDARLYRHDIRGSIAHCAMLGRQGIIPQADAERIIQGLQ
ARLY_ANASP      ----------WSQRFESALHPAIALFNASISFDIELIEYDLTGSQAHAQMLAHTGIISPAEGEQLVAGLE
ARLY_BURTA      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISADDLAAIEHGMA
ARLY_AQUAE      ----------WSGRFKEETDKFVEDFTESVSFDKELAFEDIEQDIAHVKTLQKAGILTEEEARXXXXXXX
ARLY_STAAW      ----------WGGRFEVQPEEWVDDFNASITFDQTLINQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAAS      ----------WGGRFEVQPEEWVDDFNASITFDQTLINQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAAR      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAAN      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAAM      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAAE      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAAC      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAA9      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAA8      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAA2      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAA1      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_BURMS      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISADDLAAIERGMA
ARLY_BURMA      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISADDLAAIERGMA
ARLY_BURM9      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISADDLAAIERGMA
ARLY_BURM7      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHAGMLAAQKIISADDLAAIERGMA
ARLY_BURCH      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHANMLAAQKIINADDLAAIERGMA
ARLY_BURCA      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHANMLAAQKIINADDLAAIERGMA
ARLY_ACIAD      ---------MWGGRFTEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEAERDDIIQGLS
ARLY_PELTS      ---------LWGGRFQKETDRLVEDFHSSISFDRRLYKYDIRGSIAHARMLGKAGIIPPEEARAIADGLQ
ARLY_BURCC      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHANMLAAQKIISADDLAAIERGMA
ARLY_DIAST      ----------WSALFSEPMSDLVKRYTSSVFFDKRLWQADIAGSLAHAEMLAAQGIISAQDHADIQKGMA
ARLY_BURCJ      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHANMLAAQKIISADDLAAIERGMA
ARLY_ACISJ      ----------WSALFSEPMSDLVKRYTSSVFFDKRLWQADIAGSLAHAEMLAAQGIISAQDHADIQKGMA
ARLY_THICR      MSNQHNQEKLSSARFSEATDAFVEEFTASIQFDKRMYRQDIQGSVAHAKMLHKVGILDKQELKDIIDGLE
ARLY_STAAT      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_STAA3      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_BORA1      -----NKAQAWSARFSEPVSDLVKRYTASVDFDKRLARHDIRGSLAHADMLAAQGIISAQDLADIERGMQ
ARLY_THETN      -------MKLWGGRFKKDLDKLMEDFNSSISFDIRLLKYDIMGSIAHAKGLYKAGVLTXXXXXXXXXXXX
ARLY_METS4      ---------MWGGRFASGPAEIMEEINASIGFDKRLAPQDIRGSLAHVAMLGKTGILPQADVAAIEAGLK
ARLY_HAHCH      MTKQDTTDKLWGGRFTEATDAFVERFTASVDFDRRMYHHDIRGSIAHATMLAKVGVLTEEERDQIINGLR
ARLY_STAAB      ----------WGGRFEVQPEEWVDDFNASITFDQTLIDQDIEGSIAHATMLANXXXXXXXXXXXXXXXLK
ARLY_CLOPH      -------MKLWGGRFTKETNQLVHNFNASISFDQKFYVQDIRGSIAHVTMLAKQGILNDEEKNKIIDGLN
ARLY_NOSP7      ----------WSQRFESALHPAIARFNASIGFDIELIEYDLTGSQAHAKMLAHTGIISSEEGEQLVAGLE
ARLY_THEPX      -------MKLWGGRFKSETDKLMEEFNSSISFDIRLLKHDILGSIAHAKGLYKAGVLTEDELNLIEKGLK
ARLY_THEP3      -------MKLWGGRFKSETDKLMEEFNSSISFDIRLLKHDILGSIAHAKGLYKAGVLTEDELNLIEKGLK
ARLY_PELPB      ---------LWQSRFSLPFDRDALLFSSSVHVDKKLYREDIQGSIAHVTMLAEEHIVSAEDATQIIAGLR
ARLY_DEIGD      MTNTTQDKKLWGGRFAEATDGLVELFNASVAFDQRLAEQDIRGSLAHVAMLGQTGILTPDEVAQIEEGLQ
ARLY_CLOBM      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIKGSIAHVKMLVNQXXXXXXXXXXXXXXXX
ARLY_DESAP      ---------LWGGRFRKETDPLVEEFHSSLSFDRRLYAYDIRGSIAHARMLGRVGIISAEEARTLEAGLY
ARLY_PELLD      -MSNKKEL-LWASRFNEPFDSEALRFSSSVHVDGKLYREDIQGSIAHATMLGEEGIISADDAHAICRGLK
ARLY_LACC3      ---------LWGGRFTEKAAHWVDAFGASIGFDQQMAQEDLEGSLAHVKMLGKTGIIPQADADTITAGLQ
ARLY_SCHPO      ----KSSKKLWGGRFSGATDPLMAEFNKSIYSGKEMCEEDVIGSMAYAKALCQKNVISEEELNSILKGLE
ARLY_RALEH      ----------WSARFSEPMSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAEADRAEIERGMA
ARLY_CLONN      -------MKLWGGRFKNAESKLMEDFNSSLKFDKRLYKEDIKGSIAHVKMLSKCXXXXXXXXXXXXXXXX
ARLY_CLOBB      -------MKLWGGRFKKGTDELVNDFNSSINIDSRMYKEDIEGSLAHATMLGEQNIISKEASLKITSGLL
ARLY_BURVG      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHASMLAAQKIISADDLAAIERGMA
ARLY_BURS3      ----------WSARFSEPMSELVKRYTSSVFFDKRLALVDIAGSLAHANMLAAQKIISADDLAAIERGMA
ARLY_CLOBA      -------MKLWGGRFKKGTDELVNDFNSSINIDSRMYKEDIEGSLAHASMLGEQNIISKEDSLKITSGLL
ARLY_RALEJ      ----------WSARFSEPMSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAEADRAEIERGMA
ARLY_THEEB      ----------WSQRFEQALHPAIARFNASIGFDIRLIEYDLSGSQAHARMLAKTGIISPEEAETLIQGLE
ARLY_PROMH      -------MALWGGRFSQQADQRFKQFNDSLRFDYRLAQQDIFGSVAWSKALVTVGVLSQDEQAQLEQALY
ARLY_PETMO      -------MKLWGGRFKEKIAEDMEIFNSSINVDIRLLPYDIEASLAHAEGLKKAKIISEEEFEQIERAL-
ARLY_SHEHH      -------MALWGGRFSQESSALFKLFNDSLPVDFRLIEQDIVGSIAWASAITQVGILTEQECKDLHHALN
ARLY_DECAR      ------NQYTWAGRFSEPVSDLVKRYTASVDFDQRMWRQDIRGSLAHARMLAKQGIIAAADLADIERGMA
ARLY_CLOBJ      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIKGSIAHVKMLTNQNXXXXXXXXXXXXXXX
ARLY_CLOB6      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIKGSIAHVKMLANQNXXXXXXXXXXXXXXX
ARLZ_SCHPO      -----SSQKLWGGRFTGATDPLMTAYNESIHYDKRMFNADIDGSKAYAKALEQRGIISADELDKMLDGLE
ARLY_RALPJ      ----------WSARFNEPVSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAEADRAAIEQGMA
ARLY_LEPIN      ---------LWGGRFQENASSILERIGQSISFDHKLYKEDIQGSIAHARMLKQIGILNSEELSKIEIALA
ARLY_LEPIC      ---------LWGGRFQENASSILERIGQSISFDHKLYKEDIQGSIAHARMLKQIGILNSEELSKIEIALA
ARLY_CYAP8      ----------WSDRFEGSLHPAIVEFNASIGFDIELIEYDLTGSIAHAQMLAHTGIISPEEAQKLTQGLE
ARLY_JANMA      ----------WSARFNEPVSDLVKRYTASVFFDKRLAQVDIQGSLAHAEMLAHQKIISQQDHAEIQRGMA
ARLY_CLOBH      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIKGSIAHVKMLTNQNXXXXXXXXXXXXXXX
ARLY_CLOB1      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIKGSIAHVKMLTNQNXXXXXXXXXXXXXXX
ARLY_SHEDO      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVIGSIAWADAIASVGVISXXXXXXXXXXXX
ARLY_MICAN      ----------WSDRFEGSLHPTIVEFNASIGFDIELIEYDLTGSIAHAKMLAYTGIISPEEADSLVSGLE
ARLY_CLOBL      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIKGSIAHVKMLVNQNXXXXXXXXXXXXXXX
ARLY_PROMA      ----------WSDRFEEGLNPFIESFNASINFDFLLIEEDLDGSIAHARMLAKTGIITSEEADQLEAALQ
ARLY_POLNS      -----NKAQAWSARFAEPVDELVQRYTASIGFDQRFAMVDIAGSLAHAEMLATQKIISAQDLADIQKGMA
ARLY_RALSO      ----------WSARFNEPMSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAEADRAAIEQGMA
ARLY_CYAP7      ----------WSDRFEGSLHPAIAYFNASIEFDIELIEYDLTGSIAHAKMLAHTGIISETEAQQLVTGLE
ARLY_SHEAM      -------MALWGGRFQGQASALFQLFNDSLPVDYRLFVQDVEGSIAWADAIASVGILNADECSRLKAALT
ARLY_HYDS0      ----------WSGRFKEDTSKDVELFTESISFDKALAMYDLEQDFAHLEALLKAGVISKDSYENIKSGLK
ARLY_PROM4      ----------WSDRFEVGLHPFIESFNASIKFDFLLLQEDLDGSIAHARMLGKTGIINADEASQLEKGLN
ARLY_CLOBK      -------MKLWGGRFKEEESKLMEDFNSSLSFDKKLYYEDIRGSIAHVKMLANQNXXXXXXXXXXXXXXX
ARLY_SYNY3      ----------WSDRFEGTLHPAIALFNASIGFDIELIEYDLDGSIAHGKMLAKTGIISPGEAEQLVQGLE
ARLY_POLSQ      MSSSKNSLAAWSARFTEPVDELVQRYTASIGFDQRFAMVDIAGSLAHAEMLATQKIISAQDLADIQKGMA
ARLY_PROM1      ----------WSDRFDKGLNPFIEKFNASIEFDICLLEEDLDGSIAHARMLGIQGIITKEEALRLENGLQ
ARLY_LEPBJ      ---------LWGGRFQEKPSSILERIGESVSFDHKLYKEDIQGSIAHARMLKQIGILSGDELSKIETSLS
ARLY_CHLCH      -MSSKNKELLWQSRFSLPFDRDALRFSSSVHVDKALYREDIQGSIAHVTMLAEQQIVSHEEAQAIIAGLQ
ARLY_SHEPW      -------MALWGGRFSQESSALFKLFNDSLPVDYRLIEQDIIGSIAWASAITQVGVLTTDECTQLHAALN
ARLY_PROMT      ----------WSERFDKGLNPFIEKFNASIEFDICLLEEDLDGSIAHARMLGIQGIITKEEALRLENGLQ
ARLY_LEPBL      ---------LWGGRFQEKPSSILERIGESVSFDHKLYKEDIQGSIAHARMLKQIGILSGDELSKIETSLL
ARLY_HERAR      ----------WSARFNEPVSDLVKRYTASVFFDKRLAQVDIQGSLAHAEMLAHQNIISQEDHAEIRRGMA
ARLY_NITOC      ----------WSGRFHEPTDTFVEEFTASIGFDHRLYRQDIHGSIAHARMLAKVGVLSREECDAIIQGLE
ARLY_DESVV      ---------MWGGRFKQGTATLVEEYTESVSYDRALYAQDIAGSMAHARMLARQGVLTAEEAAIIVDGLA
ARLY_DESVH      ---------MWGGRFKQGTATLVEEYTESVSYDRALYAQDIAGSMAHARMLARQGVLTAEEAAIIVDGLA
ARLY_CYAA5      ----------WSDRFEGSLHPAIVEFNASITFDIELIEYDLTGSIAHAKMLAKTGIISEAEAQKLVNGLE
ARLY_VIBVY      -------MALWGGRFTQAADTRFKDFNDSLRFDYRLAEQDIVGSIAWSKALLSVNVLSKEEQQKLEFALN
ARLY_VIBVU      -------MALWGGRFTQAADTRFKDFNDSLRFDYRLAEQDIVGSIAWSKALLSVNVLSKEEQQKLEFALN
ARLY_SYNJB      ----------WSQRFEGSLHPAIARFNASIGFDIRLLPYDVAGSLAHVQMLAACGILTQQEADQIRWGLE
ARLY_SYNFM      ---------LWQGRFDQPTNRQVEDYTASIHFDNRLYRYDIEGSIAHCRMLAQCKIISHDDASLIVQGLG
ARLY_DESDA      ----------WGGRFAEGPKEAVAQYTDSQSYDRALYAQDIRASQAHARMLGRQGVITPEEAQLLVEGLD
ARLY_SHEPA      -------MALWGGRFSQESSALFKLFNDSLPVDFRLIEQDIVGSIAWASAITQVGILTEKECTELHQALN
ARLY_HAEIE      -------MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALVKVNVLTIEEQHQLEQALN
ARLY_CHLTE      ---------LWQSRFSEPFDREALKFSSSVHVDGLLYREDIQGSIAHATMLGEQGIISKEEAGQIVTGLK
ARLY_HAEIG      -------MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALVKVNVLTVEEQHQLEQALN
ARLY_SYNE7      ----------WSDRFETALHPAIVVFNASIGFDLALIEYDLTGSQAHAQMLAEQDIISREEGEAIVAGLE
ARLY_THET8      ----------WGGRFGEGPDALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
ARLY_BUCAP      -------MSLWGGRFLDESNETFKKFNASLPFDYILVKEDIFASIAWSKSLVEVGVLTQEEQKKIESALI
ARLY_ALTMD      -------MALWGGRFESGASSMFKQVNDSLPFDQVMASQDIQGSISWSRALQKAGVLTADEQAQLEGALS
ARLY_LARHH      -----NDNKAWSGRFAEPVAELVKTYTASVDFDRRMAEFDIQGSLAHAQMLTRAGVLSETDLDAIRSGMH
ARLY_HAEI8      -------MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALVKVNVLTVEEQHQLEQALN
ARLY_HALHL      ---------LWTGRFTEATDAFVERFSASVQFDARLALQDIQGSEAHARMLAARGVLTEAERDAILQGLA
ARLY_HAEIN      -------MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALVKVNVLTIEEQHQLEQALN
ARLY_ACTP2      -------MALWGGRFKQEADAKFKFFNDSLRFDYRLALQDIDGSIGWAKAITSVGILTEQEHQQLVVALK
ARLY_SYNP6      ----------WSDRFETALHPAIVVFNASIGFDLALIEYDLTGSQAHAQMLAEQDIISREEGEAIVAGLE
ARLY_DESDG      ---------LWGGRFRERTAGLVEEYTESVSYDRALYAQDIAGSKAHARMLARQGVISAGDAGRITEGLE
ARLY_ACTPJ      -------MALWGGRFKQEADAKFKFFNDSLRFDYRLALQDIDGSIGWAKAITSVGILTEQEHQQLVVALK
ARLY_PROA2      ---SKKKELLWQSRFSEPFDREALLFSSSVDVDKELYQEDITGSIAHVTMLSEEAIIPAEEARXXXXXXX
ARLY_HAEPS      -------MALWGGRFTQQADQQFKYFNDSLRFDYRLALQDIDGSIGWAKAIHSVGIINQAELVELIAALK
ARLY_ACTP7      -------MALWGGRFKQEADAKFKFFNDSLRFDYRLALQDIDGSIGWAKAITSVGILTEQEHQQLVVALK
ARLY_THIDA      ----------WSGRFSEPVSEIVKRYTASIPFDYRLAEFDIQGSLAHAAMLHHVGVLSADDLAAIRGGMG
ARLY_THISH      ---------LWGGRFSEPTDAFVEAFTASVSFDQRLYRHDIQGSKAHARMLARVGVLTEEECDKIHDGLD
ARLY_SYNJA      ----------WSGRFAGSLHPRIARFNASIGFDIRLLPYDVAGSLAHVQMLGACGILSREEAEQIRQGLE
ARLY_CHLPD      ---------LWQSRFSEPFDRDALRFSSSVHIDKALFREDIEGSIAHVTMLAEQDIISDAECADLVQGLR
ARLY_GLOVI      ----------WSARFEAGLHPTVAAFNASIGFDIELIEYDLSGSAAHARMLAHSGILSXXXXXXLVGGLE
ARLY_LEUCK      ---------LWGGRFTAKAAEWVDEFGASIHFDEQMAAEDIEGSIAHAKMLGKQQIISESESAEIVAGLV
ARLY_CHLP8      --QSKQKELLWQSRFSEPFDREALQFSSSVHVDGLLYREDIQGSIAHATMLXXXXXXXXXXXXQIVEGLK
ARLY2_ANAPL     ---------LWGGRFSGSTDPIMEKLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
ARLY_SHESM      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_VIBPA      -------MALWGGRFTQAADTRFKEFNDSLRFDYRLAEQDIVGSIAWSKALLSVGVLSXXXXXXXXXXXX
ARLY_SHESR      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_ENTS8      -------MALWGGRFTQAADGRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLTAQEQSQLEGALN
ARLY_ACAM1      ----------------------------SIHFDIALIEYDLTGSQAHVQMLAHSGIISQAEADAIDQGLE
ARLY_SHESH      -------MALWGGRFSQESSALFKLFNDSLPVDYRLVEQDIVGSIAWAGAITQVGILSEAECQQLQQALK
ARLY_BUCBP      -------MKLWGGRFVHEXXXXXXXXXXXIQTDYKLVEQDIFSSMSWADALLKSGVLIKSECNEIKNALQ
ARLY_SYNS3      --------ATWSDRFEQGLHPAIERFNASIGFDITLLQEDLDGSIAHARMLADCGVIQVEEADQLVGGLE
ARLY_SHESA      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_SHEON      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_PHOLL      -------MALWGGRFSQKADQRFKQFNDSLRFDYRLAEQDITGSVAWSKALITVGVLTVXXXXXXXXXXX
ARLY_PSEA6      -------MSLWGGRFQDGSSAMFRTVNDSLPFDRVLASQDIRGSIAWARAIAKAGVLNQDEHQQXXXXXX
ARGHA_MORPR     -------MALWGGRFSQAADARFKNFNDSLRFDYRLAEQDITGSVAWSKALVSVGILTQDEQLTIEAALN
ARLY_RANCA      ---------LWGGRFVGSIDPIMEMFNSSVSYDQRMWSADIRGSQAYVKALEKAGLVSPTEMEHILTGLD
ARLY_DESVM      ---------MWGGRFRQATAALVEEYTQSVSFDRALYAQDIAGSKAHARMLAKQGVLTADEAARIVEGLD
ARLY_NATTJ      ---------LWGGRFSKQTDQLVDEFNASIEFDNRLIFYDLLGSQAHVKMLFQQGIIDTTDYKQITEGLD
ARGHA_MORAB     -------MALWGGRFSQAADARFKSFNDSLRFDYRLAEQDITGSVAWSKALVSVGILTQDEQLTIEAALN
ARLY_SYNPW      --------ATWSDRFEQGLHPAIERFNASIGFDITLLQEDLDGSMAHARMLAQCGVISEAEADQLCGGLE
ARLY_SALAR      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQLEDALN
ARLY_CHRVO      ----------WSGRFSEPVSELVKHYTASIGFDYRLAEVDIEGSLAHAAMLNRSGVLSDADLEAIRRGMA
ARLY_ACTSZ      -------MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIEGSIGWSKALVSVNILTQDEQRQLEKALN
ARLY_SHELP      -------MALWGGRFSQESSALFKLFNDSLPVDYRLVEEDIVGSIAWADAITGVGILSQQECQSLKQALQ
ARLY_SHESW      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECRDLKKALN
ARLY_HAEDU      -------MALWGGRFQQEADAKFKFFNDSLRFDYRLALQDIDGSIGWAKAITAVGILTEAECAKLVDALK
ARLY_SHEPC      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKQALN
ARLY_PECCP      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIVGSIGWSKALVTXXXXXXXXXXXXXXXXX
ARLY_MANSM      -------MALWGGRFTQAADQRFKDFNDSLRFDYRLAEQDIEGSVGWSKALVSVGVLTTDEQQQLERALN
ARLY_CHLL2      -MSNKKEL-LWQSRFSEPFDRDALRFSSSVHVDKALFREDIEGSTAHVTMLAXXXXXXXXXXXQIIRGLR
ARLY_PASMU      -------MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIEGSIGWSKALVSVGVLTVQEQQQLESALN
ARLY_BUCCC      -------MSLWGGRFTKISNTEFDSFNNSLRIDHRLIKDDIKSSIAWSKILLDVQVLTKKEQKIIENTLL
ARLY_SHEB5      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_ERWT9      -------MALWGGRFTQPADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVNVLTAAEQQQLESALT
ARLY_COLLI      -----------GGRFVGSTDPVMEMLSASITIDQRLAEVDIQGSMAYAKALEKAGILSKSELEKTLSGLE
ARLY_KLEP3      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_LEGPH      ----------WGGRFKKSLDSSVNQFNASLSFDHVLFDQDINGSQVHVKQLAKQKILTEAECQEIYSALE
ARLY_CHLRE      -----NTKKLWGGRFTGKTDPLMEKFNESLPFDKRLWAEDIKGSQAYAKALAKAGILAHDEAVTIVEGLA
ARLY_CANAL      --KQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADLTGTKVYTQGLNKLGLITTEELNLIHQGLE
ARLY_KLEP7      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ERWCT      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIVGSIGWSKALVTXXXXXXXXXXXXXXXXX
ARLY_BOVIN      ---------LWGGRFVGTVDPIMEKFNSSITYDRHLWEADVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
ARLY_LEGPL      ----------WGGRFKKSLDSGVNQFNASLSFDHVLFDQDINGSQVHVKQLAKQKILTEAECQGIYSALE
ARLY_ESCF3      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQVQLEEALN
ARLY_SERP5      -------MALWGGRFSQAADQRFKQLNDSLRFDYRLAEQDIVGSVAWSKALVTVNVLTXXXXXXXXXXXX
ARLY_HAES2      -------MALWGGRFTQATDKRFKDFNDSLRFDYRLAEQDIEGSIGWSKALVTVNVLTQQEQQVLENALS
ARLY_HAES1      -------MALWGGRFTQATDKRFKDFNDSLRFDYRLAEQDIEGSIGWSKALVTVNVLTQQEQQVLENALS
ARLY2_CHICK     ---------LWGGRFSGSTDPIMEMLNSSIACDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLE
ARLY_SHEWM      -------MALWGGRFSQESSALFKLFNDSLPVDYRLVEQDIVGSIAWAAAITQVGILSQDECEKLQQALK
ARLY_SHEB9      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_LEGPA      ----------WGGRFKKSLDSSVNQFNASLSFDHVLFDQDINGSQVHVKQLAKQKILTEAECQGIYSALE
ARLY_YERE8      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLTTAEQQQLEQALS
ARLY_SYNPX      ----------WSDRFEQGLHPFVEAFNASIGFDLTLLQEDLDGSIAHARMLASCGVIAEEEAVQLVDGLE
ARLY_SALA4      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_ANSAN      ---------LMGGRFVGSTDPIMQMLSTSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
ARLY_YERPY      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_TOLAT      -------MALWGGRFSQAADTRFKQFNDSLRFDYRLAEQDIVGSIGWSKALVSVGILTXXXXXXXXXXXX
ARLY_SHEB2      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVIGSIAWADAIASVGIISATECRDLKKALN
ARLY_MOUSE      ---------LWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLD
ARLY_LEPBP      ---------LWGGRFDAAPSSLMIRIGESISFDQELYRHDIEGSISHSRMLRRIGILSESEQRKIETGLG
ARLY_LEPBA      ---------LWGGRFDAAPSSLMIRIGESISFDQELYRHDIEGSISHSRMLRRIGILSESEQRKIETGLG
ARLY_SALTI      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_LEGPC      ----------WGGRFKKSLDSGVNQFNASLSFDHVLFDQDINGSQVHVKQLAKQKILTEVESQAIYSALE
ARLY_ECO57      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO5E      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY1_ANAPL     ---------LMGGRFVGSTDPIMQMLSTSISTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLE
ARLY_YERPP      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_YERPN      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_YERPG      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_YERPE      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_YERPA      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_YERP3      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_SALPC      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALPB      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALCH      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_ECOSE      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO8A      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO55      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO24      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SHISS      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SHIDS      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SALSV      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_RAT        ---------LWGGRFAGSVDPTMDKFNSSIAYDRHLWNVDLQGSKAYSRGLEKAGLLTKAEMQQILQGLD
ARLY_BUCAI      -------MGLWGGRFINESNKLFKEFNRSLSFDYILAEEDVISSVAWSKILMXXXXXXXXXXXXXXXALF
ARLY_YERPS      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_YERPB      -------MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALS
ARLY_SALTY      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALNS      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALG2      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALEP      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALDC      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_CITK8      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADXXXXXXXXXX
ARLY_SALHS      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_PROM3      ----------WSKRFEEGLHPVIERFNASISFDITLLQEDLDGSIAHARMLGECGVISXXXXXXXXXXXX
ARLY_HUMAN      ---------LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
ARLY_AERS4      -------MALWGGRFSQGADSRFKQFNDSLRFDYRLAEQDIQGSMAWAKALVKVGVLTADEQGKLQQAME
ARLY_PROMM      ----------WSKRFEEGLHPVIERFNASISFDITLLQEDLDGSIAHARMLGECGVISXXXXXXXXXXXX
ARLY_THET2      ----------WGGRFGEGPDALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLD
ARLY_SACDO      ---------LWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQKLGLLTDAELAKIHEGLA
ARLY_YEAST      ---------LWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQKLGLLTETELAKIHEGLA
ARLY_SHEB8      -------MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKKALN
ARLY_SALPK      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_SALPA      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTADEQRQXXXXXX
ARLY_MACFA      ---------LWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLD
ARLY_ECOLU      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOLI      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOLC      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOHS      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECODH      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOBW      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_AERHH      -------MALWGGRFSQGADSRFKQFNDSLRFDYRLAEQDIQGSMAWAKALVKVGVLTADEQGKLQQAME
ARLY_ECOUT      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOL6      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOL5      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECOK1      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO81      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO7I      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO45      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SHIFL      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SHIF8      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SHIBS      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SHIB3      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_ECO27      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGXXXXXXXXXXXXXXX
ARLY_SYNS9      ----------WSDRFEQGLHPFIEVFNASIGFDLTLLQEDLDGSIAHARMLGSCGVISVEEAEQLVQGLE
ARLY_VIBF1      -------MALWGGRFSQAADTRFKQFNDSLRIDYRLAEQDIVGSIAWSKALLSVGVITXXXXXXXXXXXX
ARLY_SYNSC      ----------WSDRFEQGLHPFIEAFNASIGFDLTLLQEDLDGSIAHARMLASVGVITEAEAEQLVEGLE
ARLY_ENT38      -------MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLSADXXXXXXXXXX
ARLY_METST      ---------------------------SSIEFDKRIFKSDIKCNRAHTTMLIEEGIIPKESGKKILKALD
ARLY_HERA2      ---------MWGGRFSGSLAEHMRLFNDSFPIDRRLWAEDIRGSIAWANGLERAGILQAAECQELIAGLR
ARLY_EDWI9      -------MALWGGRFSLAADRRFKQFNDSLRFDYRLAEQDIIGSVAWSRAXXXXXXXXXXXXXXXXXXXX
ARLY_VIBCM      -------MALWGGRFTQAADSRFKSFNDSLRFDYRLAEQDIVGSIAWSKAXXXXXXXXXXXXXXXXXXXX
ARLY_VIBCH      -------MALWGGRFTQAADSRFKSFNDSLRFDYRLAEQDIVGSIAWSKAXXXXXXXXXXXXXXXXXXXX
ARLY_VIBC3      -------MALWGGRFTQAADSRFKSFNDSLRFDYRLAEQDIVGSIAWSKAXXXXXXXXXXXXXXXXXXXX
ARLY_METJA      -----------GNSIKEDVA----KYTTSLSFDKEIFEADILCDIAHVIMLYEQGXXXXXXXXXXXXGLK
ARLY_METTH      ---------------------------SSLTFDHHIFEADIECNMAHTRMLAHEGIIPEEVAAKIIDALE
ARLY_ANADF      ----------------------------SIQDDGALYAEDIRGSQAHVTMLAEQGIVPKASARRIVAALD
ARLY_NITMS      ---------MYRSRLGNDLSDITLDYVSSIDDDAAITFYDIVGSQAHVLMLYQQKIITKSDAKKILSSLE
ARLY_ROSS1      ---------MWGGRFNEQVDALMAQFNNSFSFDRRMWREDIRGSIAWARQLARVGVISAEERDTLVDGLN
ARLY_ANASK      ----------------------------SIQDDGALYAEDIRGSQAHVSMLAAQGIVPKAAARRIVAALD
ARLY_ANAD2      ----------------------------SIQDDGALYAEDIRGSQAHVSMLAAQGIVPKAAARRIVAALD
ARLY_STRGG      MSSNNGDVRLWGARFADGPAEALAKLSASVHFDWRLAPYDIAGSRAHARVLSKAGLLSEDELTRMLAGLD
ARLY_SODGM      -------MALWGGRFSQAADQRFKSFNDSLRFDYRLTEQDIVGSVAWSRALVTVGVLSETEQQQLEDALN
ARLY_ANADE      ----------------------------SIQDDGALYAEDIRGSQAHVSMLAAQGIVPKAAARRIVAALD
ARLY_UNCMA      ----------------------------SIPADRWLFPSDLLVDKAHTVMLARQGXXXXXXXXXXXXXXX
ARLY_METVS      -----------GSSVKEDV----MKFTTSLEFDKEIFQSDILCDIAHTTMLMEQKIVSIEFGEKVIEELK
ARLY_STRAW      MSSNSGDVRLWGGRFADGPAEALAKLSASVHFDWRLAPYDIAGSRAHARVLHKANLLTDDELDRMLAGLD
ARLY_METLZ      ---------IRNGRLEGERSALIEQYLSSMEADKQIAESDIRVDIAHILMLRKQNLIDGASAKKLLTALG
ARLY_META3      MQKNNENIGRLGSSTKKEVMNYM----TSLSFDKEIFESDIFCDIAHTKMLMEQNIILEEDGIKIINELK
ARLY_METMA      ---------------------------SSMEADRWIFNADIVVDLAHTVMLREQGIIKEEDCSKILSGLL
ARLY_STRCO      MSSNSGDVRLWGGRFADGPAEALAKLSASVHFDWRLAPYDIAGSRAHARVLHAAGLLTEDELTRMIAGLD
ARLY_SOLUE      -------MKLWGGRFESGPGEVFERFSGSLDFDRRLIDCDIRGSQAFARALENVGILTATERAQIVEAFD
ARLY_RHOBA      ----------------------------SISFDSRLYEHDIRGSIAHANMLREVGLLTEDEFKLIRDTLE
ARLY_METM6      -----------GSNVKEDV----MKFTTSLEFDKEIFESDILCDIAHTTMLVEQNVISEENGXXXXXXXX
ARLY_METM7      -----------GSNVKEDV----MKFTTSLEFDKEIFESDILCDIAHTTMLIEQNVISEENGXXXXXXXX
ARLY1_CHICK     -----------GGRFVGSTDPIMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLE
ARLY_METMP      -----------GSNVKEDV----MKFTTSLEFDKEIFESDILCDIAHTTMLVEQNVISEENGXXXXXXXX
ARLY1_MELGA     -----------GGRFVGSVDPIMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLE
ARLY_METM5      -----------GSNVKEDV----MKFTTSLEFDKEIFESDILCDIAHTTMLVEQNVISEENGXXXXXXXX
ARLY_METMJ      ----------------------------SMDADRWIARADLLVDMAHLLGLSRQGIIDEAPARALMAALL
ARLY_METBF      ---------------------------SSMEADRWIFDADIAVDLAHTVMLKEQGIINREDCSKILSGLL
ARLY_CORJK      -----NEGALWGGRFSGGPSEAMFALSVSTHFDWVLAPYDVLASKAHAKVLNKAGLLSDADLETMLGGLD
ARLY_FRASC      -------MRLWGGRFAGGPAEALARLSISVQFDWRLAPYDLLASKSHARVLHRAGXXXXXXXXXXXXXXX
ARLY_ACIBL      -------MKMWSGRFSQSLDPEFESWQRSLPFDKKLLRHEVAASGAHATALAKAGVLSSEELALIKSGLA
ARLY_METAC      ------------------------RYASSMETDRWIFSADIAVDLAHTVMLKEQGIISAEDCSKILAGLL
ARLY_COREF      -----NEGALWGGRFSGGPSEAMFALSVSTHFDWVLAPYDVLASKAHAKVLHSAGLLSDADLDTMLEGLD
ARLY_BIFLI      MTENNEHLALWGGRFTSGPSPELARLSKSTQFDWRLADDDIXXXXXXXXXXXXXXXXXXDELQRMEDALD
ARLY_BIFLO      MTENNEHLALWGGRFTSGPSPELARLSKSTQFDWRLADDDIXXXXXXXXXXXXXXXXXXDELQRMEDALD
ARLY_BIFLD      MTENNEHLALWGGRFTSGPSPELARLSKSTQFDWRLADDDIXXXXXXXXXXXXXXXXXXDELQRMEDALD
ARLY2_RHIME     ---------LWGGRFKSGPSEALANLSRAPRSYFRLYKEDIAGSRAHASELKRAGVLDESEFSAIRAALE
ARLY_SACEN      ---------LWGGRFASGPAEAMAALSLSTHFDWRLAPYDIAGSRAHTRVLHKAGLLTADELERMLAGLD
ARLY_CHLSY      ---------LWGGRFSEPTAAEMRRFNDSFHFDVRLAEVDIAGSIAWAGALLQAGLINETEHADLVRGLE
ARLY_CHLAA      ---------LWGGRFSEPTAAEMRRFNDSFHFDVRLAEVDIAGSIAWAGALLQAGLINETEHADLVRGLE
ARLY_ROSCS      ---------MWGGRFDEGIDARMARFNNSFPFDQRMWREDIRGSMAWARQLAQAGVISTEERDTLLTGLE
ARLY_ARCFU      ------------SRMKKGMDPKALKLSSSIEHDKNIFLYDILVDVAHVLTLKKGGYLSEEEAKEIILALK
ARLY_THEFY      ---DSQTVRLWGGRFSGGPSEALARLSQSTHFDWRLARYDIAGSRAHARVLHAAGLLDDAELAQMLRGLD
ARLY_CORDI      -----NEGALWGGRFSGGPSEAMFALSVSTHFDWVLAPYDVLASKAHARVLNKAKLLSDSDLETMLGGLD
ARLY_METPE      ---------------------------SSRNADHWIAEADVLVDIAHLLMLYRQGIIEPEPAAAVMDVLL
ARLY_CLAM3      --------ALWGGRFAGGPSPELVALSRSTHFDWQLAPYDIAGSRAHARALASAGYLSDAERQAMLQALD
ARLY_CORGB      -----NEGALWGGRFSGGPSEAMFALSVSTHFDWVLAPYDVLASKAHAKVLHQAELLSDEDLATMLAGLD
ARLY_RHOFA      ---------LWGGRFSTDITDDVLRYTETASVDSRMLEHDLWQNIAHVLMLGRAGINTEPDTKALLAGLL
ARLY_CORGL      -----NEGALWGGRFSGGPSEAMFALSVSTHFDWVLAPYDVLASKAHAKVLHQADLLSDEDLATMLAGLD
ARLY_RENSM      MTSATNGGSLWGXXXXXXXXXXXXXLSKSTHFDWRLARYDLAGSRAHARVLQRAGLLTDVELDGMLTALD
ARLY_METTP      -------MLLRGSRLGDISGEVLDFI-SSRDVDLWIAEADVLVDMAHLLMLYERGLIPREDCARILTAL-
ARLY_MYCMM      -----NQGSLWGGRFAGGPSDALAALSKSTHFDWALAPYDVTASRAHAVVLFRAGLLTEEQRDGLLAGLD
ARLY_MYCUA      -----NQGSLWGGRFAGGPSDALAALSKSTHFDWALAPYDVTASRAHAVVLFRAGLLTEEQRDGLLAGLD
ARLY_METHJ      ------------ARLSGERTEDIESLLSSMEADRNIASSDVLVDMAHLVMLTRQQIVHEDHAKTLMKELL
ARLY_STRCL      MSSNNGDVRLWGGRFADGPADALARLSASVHFDWRLAPYDIAGSRAHARVLNRAGLLTEDELTRMLAGLD
ARLY_CLAMS      --------ALWGGRFAGGPSPELVALSRSTHFDWQLAPYDIXXXXXXXXXXXXXXXXXXXERQAMLQALD
ARLY_METBU      ---------------------------SSMNADKWIFKADILVDLAHTIMLKERKIIKAEDCKKILEGLL
ARLY1_PSEPF     ---------LWGARFKSGPSAALAALSRCPERYFRLTPYDLAGSKAHAGELQRAGLLDEQETRTMIEALD
ARLY_ACIC5      ----------------------------------------------------------------------
ARLY_RHOOB      -----NEGALWGGRFESGPAAAMAALSKSTHFDWVLAPYDVRASQAHARVLHKAGLLGDEDLATMLDGLG
ARLY_KINRD      ---------LWGARFASGPATAMAALSKSTHFDFRLARYDLAGSRAHARVLHXXXXXXXXXXXXXXXXXX
ARLY_LEIXX      --------------------------------------------------------------------LD
ARLY_CHLAD      ---------LWGGRFSEPTAAEMXXXXXXXXXXXXLADVDITGSIAWAGALAQAGLIDEDEYAALVRGLE
ARLY_PROAC      -------MALWGGRFSGGPSEALAALSVSTQFDWRLARHDIXXXXXXXXXXXXXXXXXXXQYEGMMKALN
ARLY_MYCPA      --------SLWGGRFADGPSDALAALSKSTHFDWVLAPYDIVASRAHTVILYRAGLLSEEQRDGLLAGLD
ARLY_MYCA1      --------SLWGGRFADGPSDALAALSKSTHFDWVLAPYDIVASRAHTVILYRAGLLSEEQRDGLLAGLD
ARLY_MYCLE      -----NQGSLWGGRFAAGPSEALVALSKSTHFDWVLAPYDITASRAHTKMLFRAGLLNEEQRDGLLAGLD
ARLY_MYCLB      -----NQGSLWGGRFAAGPSEALVALSKSTHFDWVLAPYDITASRAHTKMLFRAGLLNEEQRDGLLAGLD
ARLY_TREPR      ---------MWSGRFSSPVCAPVQSFTASVGFDRAMCHCDAAVLAAHCRSLYLRRVMSIADLADVERGLS
ARLY_RHOSR      -----NEGALWGGRFESGPAAAMAALSKSTHFDWVLAPYDVRASQAHARVLHKAGLLGDEDLASMLDGLG
ARLY_MYCS2      -----NEGSLWGGRFADGPSDALAALSKSTHFDWALAPYDIKASKAHARVLHRAGLLTDEQRXXXXXXXX
ARLY_MYCTU      -----NEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLD
ARLY_MYCTA      -----NEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLD
ARLY_MYCBT      -----NEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLD
ARLY_MYCBP      -----NEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLD
ARLY_MYCBO      -----NEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLD
ARLY1_BACSK     ----------------------------------------------------------------------
ARLY_ACIC1      ---------LWGGRFTAGPAESVAALSRSIDVDWRLARYDLRASKAHARVXXXXXXXXXXXXXXXXXXXX
ARLY_MYCA9      -----NEGSLWGGRFXXXXXXXXXXXSKSTHFDWALAPYDIQASVAHARVLRKAGLLTDEQLGALVEGLE
ARLY_NOCSJ      -----NTGKLWGGRFAGGPSPELDALSRSTHFDWRLTPYDLAGSRAHANALHRAGLLTDADLAELRRGLD
ARLY_MYCSJ      -----NEGSLWGGRFADGPADALAALSKSTHFDWVLAPYDIAASKAHARVLFSAGLLTEDQRDGLLAGLD
ARLY_MYCSS      -----NEGSLWGGRFADGPADALAALSKSTHFDWVLAPYDIAASKAHARVLFSAGLLTEDQRDGLLAGLD
ARLY_MYCSK      -----NEGSLWGGRFADGPADALAALSKSTHFDWVLAPYDIAASKAHARVLFSAGLLTEDQRDGLLAGLD
ARLY_MYCGI      -----NEGSLWGGRFADGPADALAALSKSTHFDWVLAPYDVVASKAHARVLFRAGLLTEEQRXXXXXXXX
ARLY_SULAC      ---------------------------SSNESDKEIVEEVKLTLKAHVIELYLSNYISKDTA-------K
ARLY_SULSO      ----------WGS--EKDEVVNYT---SSVDSDREIIEEVKLTMKAHVISLYLTGYLGKETARKILVALN
ARLY_BACFN      ---------LWEKSVEVNKDIERFTVGRDREMDLYLAKHDVLGSMAHITMLESIGLLTKEELAQLLTELK
ARLY_BACFR      ---------LWEKSVEVNKDIERFTVGRDREMDLYLAKHDVLGSMAHITMLESIGLLTKEELAQLLTELK
ARLY_NATPD      ---------------------------SSLAADERIFEADLAVDRAHVVMLDEQXXXXXXXXXXXXXXXX
ARLY_BACV8      ---------LWEKNVRVNEEIDRFTVGRDREMDLYLAKHDVLGSMAHITMLESIGLLTAGELEMLLAELK
ARLY_MYCVP      -----NEGSLWGGRFADGPADALAALSKSTHFDWVLAPYDVVASKAHARVLFRAGLLTEEQRXXXXXXXX
ARLY_BACTN      ---------LWEKSVQVNKDIERFTVGRDREMDLYLAKHDVLGSMAHITMLESIGXXXXXXXXXXXXXXX
ARLY_HALMA      ----------------------------------------------------------------------
ARLY_PARD8      ---------LWEKNVQVDHEVDIFTVGKDREMDLYLAKYDVLGSMAHITMLESIGLLTKEELNVLLAELR
ARLY_PYRFU      ----------------------------------------------------------------------
ARLY_NOCFA      -----NTGALWGGRFASGPXXXXXXLSKSTHFDWALAPYDIRASKAHARVLHKAGLLSXXXXXXXXXXXX
ARLY_SULTO      ----------------------------------------------------------------------
ARLY_THENN      -------------------------VGDDYIVDMRIIKYDIKASIVHSKMLQRTGLLTQEEQKKIEEALN
ARLY2_AGRT5     ---------------------------------------------AHLVMLRETGILDAETAAKIAGALE
ARLY_METKA      -----------GGRVSGGRDPDFAELSSSLEQDREIFHCDVWNSVVHAVSLWEAGRIDRSTAAGIVEGLV
ARLY_XANOP      --------------------------GDDVILDREFFLHDIAASKAHAQGLQHIGILSPQELDGLSEQLD
ARLY_XANOM      --------------------------GDDVILDREFFLHDIAASKAHAQGLQHIGILSPQELDGLSEQLD
ARLY_XYLFT      -----------------DASIQTFLAADDVLLDREFFLYDITASTAHAQALQRIGLLTPDELDNILRELQ
ARLY_XYLFA      -------------------SLLWHKPGVAIDLDREFFLYDITASTAHAQALQRIGLLTPDELDNILRELQ
ARLY_XANAC      --------------------------GDDVILDREFFLYDIAASKAHAQGLQHIGILSLQELGGLSEQLD
ARLY_XANC5      --------------------------GDDVILDREFFLYDIAASKAHAQGLQHIGILSLQELGGLSEQLD
ARLY_STRMK      --------------------------GDDVILDREFFLHDIAASAAHAQGLQHIGILSADELAGLLRELE
ARLY_STRM5      --------------------------GDDVILDREFFLHDIAASAAHAQGLQHIGILSADELAGLLRELD
ARLY2_RHILO     ----------------------------------------------------------------------
ARLY_XANCP      --------------------------GDDVILDREFFLYDIAASKAHAQGLQHXXXXXXXXXXXXXXXXX
ARLY_XANC8      --------------------------GDDVILDREFFLYDIAASKAHAQGLQHXXXXXXXXXXXXXXXXX
ARLY_PYRIL      ---------------------LIKRYTSSIKDDVEIAEEVIKVMEAHVKHLAEVGIMPKEAADAILKTLK
ARLY_XANCB      --------------------------GDDVILDREFFLYDIAASKAHAQGLQHXXXXXXXXXXXXXXXXX
ARLY_HALSA      ---------------------------SSMDGDGRIFEADLAVDRAHVVMLAEQDVXXXXXXXXXXXXXX
ARLY_HALS3      ---------------------------SSMDGDGRIFEADLAVDRAHVVMLAEQDVXXXXXXXXXXXXXX
ARLY_PYRAE      ---------------------LVKKYTSSIKDDVELAEEVVRVMKGHVAHLVEIGSIPKEAGERIIKALE
ARLY_PYRCJ      ----------------------------------------------------------------------
ARLY_PYRAR      ---------------------LVQRYTSSIRDDAEIAEEVVKVMKAHVTHLAEIGALRKEVADKIVAALE
ARLY_SORC5      ------SVRLWDKGGATDAQMLRYTSRDDWQLDQRLLAYDLRATIAHVRGLARIGVLSEAERDALVRELE
ARLY_THENV      ----------------------------------------------------------------------
PUR8_PYRHO      ----------------------------------------------------------------------
PUR8_AQUAE      ----------------------------------------------------------------------
PUR8_BACSU      ----------------------------------------------------------------------
PUR8_PYRAB      ----------------------------------------------------------------------
ASPA_BACSU      ----------------------------------------------------------------------
PUR8_SYNY3      ----------------------------------------------------------------------
FUMC_CHLPN      ----------------------------------------------------------------------
PUR8_STRMU      ----------------------------------------------------------------------
FUMC_RICCN      --------------------------------------------------------------------ID
FUMC_RICFE      --------------------------------------------------------------------ID
FUMC_SULSO      ----------------------------------------------------------------------
PUR8_THEMA      ----------------------------------------------------------------------
PUR8_HELPY      ----------------------------------------------------------------------
FUMC_RICTY      ----------------------------------------------------------------------
FUMC_STRAW      ----------------------------------------------------------------------
FUMC_RICPR      ----------------------------------------------------------------------
FUMH_YEAST      ----------------------------------------------------------------------
FUMC_COREF      ----------------------------------------------------------------------
FUMC_RICBR      ----------------------------------------------------------------------
FUMC_XYLFT      ----------------------------------------------------------------------
FUMC_XYLFA      ----------------------------------------------------------------------
FUMC_HELPJ      ----------------------------------------------------------------------
FUMC_HELPY      ----------------------------------------------------------------------
PUR8_STAAW      ----------------------------------------------------------------------
PUR8_STAAS      ----------------------------------------------------------------------
PUR8_STAAR      ----------------------------------------------------------------------
PUR8_STAAN      ----------------------------------------------------------------------
PUR8_STAAM      ----------------------------------------------------------------------
PUR8_STAAC      ----------------------------------------------------------------------
PUR8_STAAB      ----------------------------------------------------------------------
PUR8_STAA8      ----------------------------------------------------------------------
PUR8_STAA3      ----------------------------------------------------------------------
PUR8_METTH      ----------------------------------------------------------------------
FUMC_BRUSU      ----------------------------------------------------------------------
FUMC_BRUME      ----------------------------------------------------------------------
FUMC_CHLTR      ----------------------------------------------------------------------
PUR8_STAHJ      ----------------------------------------------------------------------
PUR8_STAES      ----------------------------------------------------------------------
PUR8_STAEQ      ----------------------------------------------------------------------
FUMC_STRCO      ----------------------------------------------------------------------
FUMC_CHLMU      ----------------------------------------------------------------------
ASPA_CORGL      ----------------------------------------------------------------------
FUMH_RHIOR      ----------------------------------------------------------------------
FUMC_PROMP      ----------------------------------------------------------------------
PUR8_STAS1      ----------------------------------------------------------------------
FUM1_ARATH      ----------------------------------------------------------------------
FUMC_CORGL      ----------------------------------------------------------------------
FUMC2_PSEAE     ----------------------------------------------------------------------
FUMC_CHLCV      ----------------------------------------------------------------------
FUMC_CAMJE      ----------------------------------------------------------------------
FUMC_MYCTU      ----------------------------------------------------------------------
FUMC_MYCBO      ----------------------------------------------------------------------
ASPA_HELPY      ----------------------------------------------------------------------
PUR8_DEIRA      ----------------------------------------------------------------------
PUR8_BUCBP      ----------------------------------------------------------------------
FUM2_ARATH      ----------------------------------------------------------------------
ASPA_PSEAE      ----------------------------------------------------------------------
ASPA_HELPJ      ----------------------------------------------------------------------
ASPA_PSEFL      ----------------------------------------------------------------------
FUMH_DICDI      ----------------------------------------------------------------------
FUMC_OCEIH      ----------------------------------------------------------------------
FUMH_SCHPO      ----------------------------------------------------------------------
FUMC_PROMA      ----------------------------------------------------------------------
FUMC_WIGBR      ----------------------------------------------------------------------
FUMC_LISIN      ----------------------------------------------------------------------
YBN5_SCHPO      ----------------------------------------------------------------------
Y8827_DICDI     ----------------------------------------------------------------------
SYP_MACCJ       ----------------------------------------------------------------------
FUMC_LISMF      ----------------------------------------------------------------------
FUMC_PSEPK      ----------------------------------------------------------------------
FUMC_DEIRA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
ARLY_PELUB      KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
ARLY1_AGRT5     TILSEIEAGTFEFSRKLEDIHMNIEARLATLIGTAAGRLHTARSRNDQVALDFRLWVKEELQKTEGMLTA
ARLY_EHRCJ      VIQNQISSGTFEFSTDLEDIHMNIEHNLKKMVGNIAGKLHTARSRNDQVATDFKLWIRKSIVKIEHYLHE
ARLY_BRUSU      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUSI      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUME      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUMB      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUC2      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUAB      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUA2      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_BRUA1      TIRKEIEEGKFTFSRKLEDIHMNIEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_MESSB      TILSEIEAGKFEFSTRLEDIHMNVEARLAELIGPAAGRLHTARSRNDQVAVDFRLWVKEELLRIDVALGG
ARLY_EHRCR      VIQNQISSGTFEFSTDLEDIHMNIEHHLKKMIGNIAGKLHTARSRNDQVATDFKLWIRKSIVKLETLLHE
ARLY_OCHA4      TILKEIEDGKFTFSRKLEDIHMNIEARLADLIGPSAGRLHTARSRNDQVAVDFRLWVKQELEKTAAALKN
ARLY_EHRRW      VIQKQIESGNFEFSTDLEDIHMNIEYSLKKMIGNIAGKLHTARSRNDQIATDLKLWIRKSIKKLEQQLHK
ARLY_EHRRG      VIQKQIESGNFEFSTDLEDIHMNIEYSLKKMIGNIAGKLHTARSRNDQIATDLKLWIRKSIKKLEQQLHK
ARLY1_RHILO     TILKEIEAGSFEFSTRLEDIHMNVEARLADLIGSAAGRLHTARSRNDQVAVDLRLWVKDECFRVAEALKG
ARLY_RHIL3      TILSEIESGNFEFSRQLEDIHMNVEARLATLIGPAAGRLHTARSRNDQVALDFRLWVKEELQKTEQMLTG
ARLY_RHIE6      TILSEIESGNFEFSRRLEDIHMNIEARLATLIGPAAGRLHTARSRNDQVALDFRLWVXXXXXXXXXXXXG
ARLY1_RHIME     TILSEIDSGAFEFSRRLEDIHMNIEARLAALIGPAAGRLHTARSRNDQVALDFRLWVKEELQKTEKALTG
ARLY_AGRVS      TILSEIEAGQFTFSRKLEDIHMNIEARLADLIGPAAGRLHTARSRNDQVALDFRLWVKEELQKAESLLTD
ARLY_RHISN      TILSEIESGAFDFSRRLEDIHMNIEARLASLIGPAAGRLHTARSRNDQVALDFRLWVKEELQRTEKALTG
ARLY_NITSB      TVKEKIENGQFEWNIEDEDIHMAIEKALTNLIGDAGKKLHTARSRNDQVALDFRLYVQQSNKDLIRLLAN
ARLY_BARBK      LIRQEIETGSFTFSRKLEDIHMNIEARLSELIGPVAGRLHTARSRNDQVAVDFRLWVREAAQKIAQALKD
ARLY_CAMHC      QILNEIESGNFEFKISDEDIHMAIEKRLAEIIGKNAGRLHTARSRNDQVATDFRHFCMRENLAIAELLRT
ARLY_RHIEC      TILSEIESGNFEFSRQLEDIHMNVEARLATLIGPAAGRLHTARSRNDQVALDFRLWVKEELQKTEQMLTG
ARLY_CALS8      EILNDFKEGKIEFDMSDEDVHMLIEKELIKRIGQVGKKVHTARSRNDQVVLDERLFCREKNLYLQELIKN
ARLY_ZYMMO      KIAAEYAEKGVPEDWSLEDIHMVTEKRLADLIGSAAGRLHTARSRNDQVATDFKLWVRDAIDMVDKGLTA
ARLY_PARDP      TVLSEIEKGDFPFSTALEDIHMNVESRLKEIIGEPAGRLHTARSRNDQVATDFRLWVRDQCDAAIAGLDA
ARLY_BART1      IILQEIEEGDFVFSRNLEDIHMNIEARLSALIGPVAGRLHTARSRNDQVAVDFRLWVRETXXXXXXXXXX
ARLY_RHOS1      TVLSEIEAGGFPFRVELEDIHMNVEARLKELIGEPAGRLHTARSRNDQVAVDFRLWVRDQCDAAISGIEA
ARLY_METPB      SVEAEIERGEFVFRRELEDIHMAVESRLTEIVGPAAGRLHTARSRNDQVATDMRLWVRDTLDALDAQVAD
ARLY_WOLSU      KVLGEIERGEFVFKIADEDIHMAIEARLTELIGASGKKLHTARSRNDQVAVDFRMFVLRKNEEIRAQILE
ARLY_RHOS4      TVLSEIEAGGFPFRVELEDIHMNVEARLKELIGEPAGRLHTARSRNDQVAVDFRLWVRDQCDAAISGIEA
ARLY_RHOPT      TILSEITAGKFTFKRALEDIHMNVESRLAELIGPAAGRLHTARSRNDQVATDFRLYVRDVXXXXXXXXXX
ARLY_RHOPA      TILSEITAGKFTFKRALEDIHMNVESRLAELIGPAAGRLHTARSRNDQVATDFRLYVRDVXXXXXXXXXX
ARLY_METEP      SVEAEIARGEFVFRRELEDIHMAVESRLTEIVGPAAGRLHTARSRNDQVATDMRLWVRDTLDALDAQVAD
ARLY_ANATD      QILEDFKLGKIVFGISDEDVHMLIEKELIKRIGEVGKKVHTARSRNDQVALDERLFCREKNLYLQEXXXX
ARLY_RHOPS      TILSEIGAGKFTFKRALEDIHMNVESRLAELIGPAAGRLHTARSRNDQVATDFRLYVRDVLDETDAALAS
ARLY_BRAJA      TILSEIGKGGFTFKRALEDIHMNVESRLSELIGPAAGRLHTARSRNDQVATDFRLYVRDVIDETDXXXXX
ARLY_METC4      SVEAEIARGEFVFRRELEDIHMAVESRLTEIVGPAAGRLHTARSRNDQVATDMRLWVRDTLDALDAQVAD
ARLY_LACLA      KVEEKLLNGQIEFKMENEDIHMNMESYLHQEIGPLAGKLHTARSRNDQVVTDMHLYLKSILEAVLEALKV
ARLY_GEOSF      EILDQIEAGKFDFSISLEDIHMNIESRLSAKIGEAGKRLHTGRSRNDQVALDIRLYLRDELVEISAYLDL
ARLY_CAUSK      AIEGEIVAGAFPFRDEYEDIHMNIEARLRELIGPTAGRLHTARSRNDQVAVDFRLWVREACDRSAAQLEA
ARLY_ARCB4      QVKSEIESGEFKFSLAYEDIHMAVETRLTEIIGEPGKKLHTARSRNDQVCTDFTLYVQDKTLSIKEQLKE
ARLY_LISMC      ILQEKLALGELEFSTVNEDIHLNIEKLLHEEIGPVAGKLHTARSRNDQVATDMHLYLKQAVAEIIQSLKH
ARLY_JANSC      TVLSEIEGGTFQYSTALEDIHMNVEARLTEIIGTPAGRLHTARSRNDQVATDFKLWVRDQMDAAISGIEA
ARLY_METRJ      SVRDEIEAGTFAFKRELEDIHMSVESRLTEIVGPAAGRLHTARSRNDQVATDMKLWVRXXXXXXXXXXXX
ARLY_GEOLS      DILAQIEAGQFDFSVGLEDIHMNIEARLSQKIGEAGKRLHTGRSRNDQVALDIRLYLRDEIVEVVAYLDM
ARLY_LISMF      ILQEKLALGELEFSTVNEDIHLNIEKLLHEEIGPVAGKLHTARSRNDQVATDMHLYLKQAVAEIIQSLKH
ARLY_ROSDO      TVLSEIEAGNFPFSTALEDIHMNVEARLKEIIGEPAGRLHTGRSRNDQVATDFKLWVRDQLDACEAGLLA
ARLY_MAGSA      KVLAEIEAGNFPFSHALEDIHMNVESRLAELIGEAAGRLHTARSRNDQVATDFRLWVRDAVDGMESALKE
ARLY_LISIN      ILQEKLALGELEFSTVNEDIHLNIEKLLHEEIGPVAGKLHTARSRNDQVATDMHLYLKEAVAEIIQSLKH
ARLY_LISMH      ILQEKLALGELEFSTVNEDIHLNIEKLLHEEIGPVAGKLHTARSRNDQVATDMHLYLKQAVAEIIQSLKH
ARLY_LISMO      ILQEKLAFGELEFSTVNEDIHLNIEKLLHEEIGSVAGKLHTARSRNDQVATDMHLYLKQAVAEIIQSLKH
ARLY_CAUCR      RVEDELLSGTFPFRDEYEDIHMNIEARLRELIGPTAGRLHTARSRNDQVAVDFRLWVRDACDRTVGQLEA
ARLY_STRA5      ILQDKYRAGQLTFSISNEDIHMNIESLLTAEIGEVAGKLHTARSRNDQVATDMHLYLKDKLQEMMKKLLH
ARLY_RHOP2      TILSEIGAGKFTFKRALEDIHMNVESRLAELIGPAAGRLHTARSRNDQVATDFRLYVRDVLDETDXXXXX
ARLY_STRA1      ILQDKYRAGQLTFSISNEDIHMNIESLLTAEIGEVAGKLHTARSRNDQVATDMHLYLKDKLQEMMKKLLH
ARLY_RHOS5      TVLSEIEAGGFPFRVGLEDIHMNVEARLKELIGEPAGRLHTARSRNDQVAVDFRLWVRDQCDAAITGIEA
ARLY_BACCN      YLLEEAKENKLHFSVEAEDVHLNIEKMLIEQIGEVGGKLHTGRSRNDQVATDMHLYLKEKVQDIINAIKQ
ARLY_STRA3      ILQDKYRAGQLTFSISNEDIHMNIESLLTAEIGEVAGKLHTARSRNDQVATDMHLYLKDKLQEMMKKLLH
ARLY_STRTD      ELLEEYKAGKLEFDVSNEDIHMNIESLLTAKIGPVAGKLHTARSRNDQVATDMHLYLKAKLVEVIEKIDN
ARLY_STRT2      ELLEEYKAGKLEFDVSNEDIHMNIESLLTAKIGPVAGKLHTARSRNDQVATDMHLYLKAKLVEVIEKIDN
ARLY_STRT1      ELLEEYKAGKLEFDVSNEDIHMNIESLLTAKIGPVAGKLHTARSRNDQVATDMHLYLKAKLVEVIEKIDN
ARLY_LACS1      ILQDKLANGELTFSTELEDIHMNIESLLTQEIGDVAGKLHTARSRNDQVATDLHLYLKNRLEIVIDEIKN
ARLY_SULNB      DILADIESGLFKLEGDDEDIHMAIEGELTRRIGDAGKRLHTARSRNDQVALDFRLYVQRNTKTIAELLLK
ARLY_STRGC      KLLARYESGELEFDVRNEDIHMNMEALLTEKIGPVAGKLHTARSRNDQVATDMHLYLKDQLGQIADKLLN
ARLY_LISW6      IMQEKLALGELEFSTANEDIHLNIETLLYTEIGPIAGKLHTARSRNDQVATDMHLYLKQAVADIIHSLKH
ARLY_GEOMG      EILRQIQGGQFKFSVALEDIHMNIEARLSEKIGEAGKRLHTGRSRNDQVALDIRLYLRDEIVEVSAYLDL
ARLY_SULDN      QVKEEIESGVFEWKISDEDLHMGIEKRLTAIIGDAGKKLHTARSRNDQVAVDFRRYVLRKNLEIVDALKL
ARLY_DINSH      TVLSEIETGQFAFSAALEDIHMNVEARLKELIGEPAGRLHTGRSRNDQVATDFKLWVXXXXXXXXXXXXX
ARLY_SYNAS      EIQRDIETGSFEFSPGDEDIHMAIEKDLIRRIGDAGAKLHTGRSRNDQVALDVRLYLRAEIKEILEFMKV
ARLY_BACCZ      YLLEEAKQNKLNFSVEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIMKATKQ
ARLY_PARL1      VVLAEIENGTFHFKRELEDIHMNVESRLADLIGAAAGRLHTARSRNDQVATDFKLYIRDTIDHLDEQLAD
ARLY_SYMTH      EIEAEIEAGQFPFRQEYEDIHLNIEKRLIEKIGPAGGRLHTARSRNDQVVTDVHLWVKDEIAAVQRLVSD
ARLY_STRU0      DIHRDILEEEIVFDSQDEDIHMTIERQLLAKIGPLAGKLHTARSRNDQVATDMHLYXXXXXXXXXXXXXX
ARLY_RHORT      RILAEIEAGDFPFSVALEDIHMNIESRLKDLIGEAAGRLHTARSRNDQVATDFRLWVRDAIDGVEGALAR
ARLY_LACPL      TLAERQKQGELEFSTVNEDIHMNIESLLTEEIGPVAGKLHTARSRNDQVATDFHLYLKHQLPLILDRLHE
ARLY_GEOUR      EILAQIEAGTFDFSISLEDIHMNIESRLSAKIGEAGKRLHTGRSRNDQVALDIRLYLRDELVEISAYLEL
ARLY_BACAH      YLLEEAKQNKLHFSVEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVERIIKATKQ
ARLY_GEOSL      EVLARIEAGKFDFSVALEDIHMNIEARLTEKIGEAGKRLHTGRSRNDQVALDIRLYLRDEIVEISAYLDM
ARLY_MARMM      QVRSEIHAGDFPWSKALEDVHMNVEARLKEIIGEPAGRLHTARSRNDQVATDFRLWLRDACDRIDAMLAA
ARLY_CAMC1      EVLAEIRAGKFAFKIEDEDIHMAVEKRLSQIIGAEGGRLHTARSRNDQVALDFKFYVLKKNLEISSLIKE
ARLY_PELPD      QILLQIEEGSFDFSISLEDIHMNIESRLSARIGEAGKRLHTGRSRNDQVALDIRLYLRDEIVEITSYIDL
ARLY_CLOTE      SILKDIEDDKLKIQGEYEDIHSFIESNLIQRIGDVGKKLHTARSRNDQVAVDFKLYAKNISLKIIESIET
ARLY_LACRJ      KLRERLTSEGLPFSIDNEDIHMNIEALLTEEIGPVAGKLHTGRSRNDQVATDLHLYVKKRLPIIINELKK
ARLY_LACRD      KLRERLTSEGLPFSIDNEDIHMNIEALLTEEIGPVAGKLHTGRSRNDQVATDLHLYVKKRLPIIINELKK
ARLY_GLUOX      DIAQEIGEGRFEFSPALEDIHMNIEARLSERIGEAGKRLHTARSRNDQVATDFRLWVRDAIDGLQEQTAS
ARLY_STRSY      XXXXXXXAGKLVFDIRNEDIHMNIESLLTEKIGSVAGKLHTARSRNDQVATDMHLYLKDTLFQVVDKLTN
ARLY_STRS2      XXXXXXXAGKLVFDIRNEDIHMNIESLLTEKIGSVAGKLHTARSRNDQVATDMHLYLKDTLFQVVDKLTN
ARLY_STRMU      DLLEEYKAGQLKFDVSNEDIHMNMESLLTAKIGPVAGKLHTARSRNDQVATDMHLYLKAKLDEVIEKLAN
ARLY_ANOFW      KLLEKAKRGELSFSVTYEDIHLNIEKMLIDEIGPVGGKLHTGRSRNDQVATDMHLYLRKRVIEIIELIRQ
ARLY_BRASO      TILSEITKGSFEFKRALEDIHMNVESRLSELIGPAAGRLHTARSRNDQVATDFRLFVRDEIDDIDXXXXX
ARLY_SILPO      TVLSEIEAGEFTFSTALEDIHMNVEARLKEIIGEPAGRLHTARSRNDQVATDFKLWVRDQFDXXXXXXXX
ARLY_EXISA      QLKQKALADELKFEVYHEDIHMNLEALLHEAIGPVAGKMHTARSRNDQVATDMHLYLKERVKEVIQLIES
ARLY_CLOAB      SLYKDIRSGKLKIEGDYEDIHSFVEVNLIDRIGAVGKKLHTARSRNDQVAVDMKMYVKKSSYIIIECINK
ARLY_CLOK5      SILKDIEEGKLEVEGDYEDIHSFVEINLIERIGQVAKKLHTARSRNDQVALDFRLYAKRKALEVVENIEY
ARLY_CLOK1      SILKDIEEGKLEVEGDYEDIHSFVEINLIERIGQVAKKLHTARSRNDQVALDFRLYAKRKALEVVENIEY
ARLY_BRASB      TILSEITKGAFEFKRALEDIHMNVESRLGELIGPAAGRLHTARSRNDQVATDFRLYVRXXXXXXXXXXXX
ARLY_CARHZ      EILEEIKAGKVDFSPEAEDIHLNIETLLIKKIGDVGKKVHTGRSRNDQVALDTRLYVKKEGTAIIALIKE
ARLY_STRSV      KLLVRYQAGELEFDVRNEDIHMNMEALLTEEIGPVAGKLHTARSRNDQVATDMHLYLKDQIGQIADKXXX
ARLY_METNO      TVQAEIESGAFTFARSLEDIHMNVESRLREIVGPAAGRLHTARSRNDQVATDMRLWVRXXXXXXXXXXXX
ARLY_BACCR      YLLKEAKENKLQFSVEAEDIHLNIEKMLIEQIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKATKQ
ARLY_GLUDA      EIGAEIEAGRFDFSTALEDIHMNIEARLSDRIGEAGKRLHTARSRNDQVATDFRLWVRDAIDGLDAQAAS
ARLY_BACC2      YLLEEAKQNKLHFSIEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKATKQ
ARLY_OCEIH      IVLSKIEAGEAELSNEHEDIHMNVEKLLIDEVGPVGGRLHTGRSRNDQVALDMRLYLRDVIAELSDLLKA
ARLY_NOVAD      QVAAEYEANGVPENWDLEDIHMTTESRLAELIGPAAGRLHTARSRNDQVATDFRLWVRDAMDQAELGLKQ
ARLY_BACWK      YLLEEAKQNKLNFSVEAEDIHLNIEKMLIERIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEDIIKATKQ
ARLY_STRZJ      XXXXXXXAGQLDFDIANEDIHMNMEVLLTEKIGPLAGKLHTARSRNDQVATDMHLYLKEQLGYVLDKLAH
ARLY_STRP7      XXXXXXXAGQLDFDIANEDIHMNMEVLLTEKIGPLAGKLHTARSRNDQVATDMHLYLKEQLGYVLDKLAH
ARLY_GEOSM      AILEQIEAGKFDFSVSLEDIHMNIEARLSEKIGDAGKRLHTGRSRNDQVALDIRLYLRDELVEVSAYIDL
ARLY_BACC4      YLLKEAKENKLQFSVEAEDIHLNIEKMLIEQIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKATKQ
ARLY_XANP2      TILSEIEAGNFTFKRELEDIHMNVESRLAELIGASAGRLHTARSRNDQVATDFRLYVXXXXXXXXXXXXX
ARLY_GEOBB      TILEQIEAGEFDFSVSLEDIHMNIEARLSEKIGDAGKRLHTGRSRNDQVALDIRLYLRDELVEVSAYIDL
ARLY_BACAN      YLLEEAKQNKLHFSVEAEDIHLNIEKMLMEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKAIKQ
ARLY_BACAC      YLLEEAKQNKLHFSVEAEDIHLNIEKMLMEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKAIKQ
ARLY_BACAA      YLLEEAKQNKLHFSVEAEDIHLNIEKMLMEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKAIKQ
ARLY_STRR6      XXXXXXXAGQLDFDIANEDIHMNMEVLLTEKIGPLAGKLHTARSRNDQVATDMHLYLKEQLGYVLDKLAH
ARLY_STRPI      XXXXXXXAGQLDFDIANEDIHMNMEVLLTEKIGPLAGKLHTARSRNDQVATDMHLYLKEQLGYVLDKLAH
ARLY_STRP2      XXXXXXXAGQLDFDIANEDIHMNMEVLLTEKIGPLAGKLHTARSRNDQVATDMHLYLKEQLGYVLDKLAH
ARLY_RUTMC      RILSEVKTGEFKWSITLEDIHMNIEARLVKMIGDTGKKLHTGRSRNDQIVTDIRLYLRDQVDDITNEIKR
ARLY_LACLM      KVEEKLMKGQIEFKIENEDIHMNMETYLHDEIGPLAGKLHTARSRNDQVATDMHLYLKSVLSDLLKALRT
ARLY_BACC7      YLLEEAKQNKLHFSVEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLNEKVEHIIKATKQ
ARLY_BACC1      YLLEEAKQNKLHFSVEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKATKQ
ARLY_LAWIP      SIQKEIETDTFPWKIELEDVHMNIESRLTDLIGTVGEKLHTGRSRNDQVALDFRLFVSDNISLWKRQLLE
ARLY_LACLS      KVEEKLMKGQIEFKIENEDIHMNMETYLHDEIGPLAGKLHTARSRNDQVATDMHLYLKSVLSDLLKALRT
ARLY_BACHK      YLLEEAKQNKLHFSVEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIMKATKQ
ARLY_VARPS      QIRAEIESGAFEWKLDLEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQVATDVRLWLRGEIDLIAELLVA
ARLY_SULSY      DIEQEIKENKFVWKKELEDVHMNIEKALTDKIGKAGGKLHTGRSRNDQVITAFRLYLKENTQDIINLLED
ARLY_PROM9      KIKVEYLEDKFSPSLPSEDIHYCIEEKLISLIGETGKKLHTGRSRNDQVGTDLRLWLRKEIDNLEILITD
ARLY_HELHP      IIAQRISRGEFVFNASDEDIHMAIESALTALIGDVGKKLHTARSRNDQVALDFRLYVLKSNKEIVNLLLE
ARLY_CAMC5      AVLAQIEEGKFEFKTADEDIHMAVEKRLSELIGSEGGRLHTARSRNDQVALDFRLYVLRQNEQIARQIRE
ARLY_BACP2      KLMKKAEADELEFSVDYEDIHLNLEKMLIDEIGPLGGKLHTARSRNDQVATDMHLYLNNQVEHIIELISS
ARLY_BACC0      YLLEEAKQNKLHFSVEAEDIHLNIEKMLIEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIMKATKQ
ARLY_ACIAC      TITQEIESGAFEWKLDLEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQVATDVRLWLRGEIDMIADLLKE
ARLY_GEOSW      TLLEKAKQGKLEFSVAYEDIHLNIEKMLIDEIGPVGGKLHTGRSRNDQVATDMHLYLRKRVTEIIALIQE
ARLY_BACHD      ILLEKAKKGELNYSVANEDIHLNIEKLLIDEIGPVGGKLHTGRSRNDQVATDMHLYLRKQTKEILQLVKN
ARLY_RHOPB      TILSEIVAGSFDFKRALEDIHMNVESRLSELIGPAAGRLHTARSRNDQVATDFRLFVRDTIDGIDAALAS
ARLY2_BACSK     TLQKKAAAGELVFSAAQEDIHLNLEKLLIDEIGPVGGKLHTGRSRNDQVATDMHLYLRTQTEEIMEAIRT
ARLY_PELCD      SILADIEKGDFEFSVALEDIHMNIEARLIERIGSVGGKLHTARSRNDQVALDIRLYLRDEVKEVRSFLEK
ARLY_HYPNA      AVIEEMRAGTFPFRRELEDIHMNVEARLKELIGEPAGRLHTARSRNDQVITDFRLWTRRALDETGQLVAG
ARLY_NITWN      TILSEIRDDSFDFKRALEDIHMNVESRLGELIGPSAGRLHTARSRNDQVATDFRLYVRDIIDETDNALAT
ARLY_LACF3      KLQDQLEAGELTFTVENEDIHMNLEALLTEEIGPVAGKLHTARSRNDQVATDLHLYVKHRLPHVIQAIKD
ARLY_RHOFD      TISAEIESGAFDWKLELEDVHLNIEARLTQLIGLAGKRLHTGRSRNDQVATDVRLWLRGEIDLIGALLTD
ARLY_PROM0      SIKVEYLEGKFSPSLPSEDIHYCIEHKLISLIGETGKKLHTGRSRNDQVGTDIRLWLRKEIDNIEILIAD
ARLY_PSEPG      TIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITR
ARLY_DEIRA      GVLADIRAGNFEWRLDREDVHMNVEAALRDRIGPVAGKLHTARSRNDQVAVDFRLFTKEAALDLAEQTRA
ARLY_PROMP      TIKEKFIEGKFCPGAPSEDIHYCIEEKLINLIGETGKKLHTGRSRNDQVGTDIRLWLRKKIDNIDILLYE
ARLY_DESAA      QVKGEIEAGNFKYDDSLEDIHMHIESRLTEILGPTAAKLHTGRSRNDQIALDNRLYLRDETRRIIAMLHE
ARLY_STACT      EIQQDYHDGKIEFTEALEDIHLNIEHELIERIGAVGGKLHTGRSRNDQVATDLHLYTKKAVKEIIHLIHT
ARLY_PSEE4      TIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDIILGEITR
ARLY_METSB      AIKAEIESGAFTFSRALEDIHMNVESRLAALIGPAAGRLHTARSRNDQVALDFRLWVRDTIDALDGQLRG
ARLY_PROMS      SIKVDYLEGKFSPGPPSEDIHYCIEEKLISLIGETGKKLHTGRSRNDQVGTDLRLWLR---KEIDNNITD
ARLY_NITEC      QIWEEIKNGQFEWQLEQEDVHLNIERRLTALTGDAGKRLHTARSRNDQVATDIRLYLRAAIDEIIDLIYG
ARLY_DESHY      GILTDIREGKIQFEIGAEDIHMNVEKLLTERVGTVGKKVHTGRSRNDQVALDLRLFLREEIDHTQELLIA
ARLY_DESHD      GILTDIREGKIQFEIGAEDIHMNVEKLLTERVGTVGKKVHTGRSRNDQVALDLRLFLREEIDHTQELLIA
ARLY_AZOVD      QIQSEIEAGQFDWRVDLEDVHMNIEARLTERIGITGKKLHTGRSRNDQVATDIRLWLRDEIDTILGEITR
ARLY_METPP      QVVAEIESGAFEWKLDLEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQVATDVRLWLRGEIDAIGALLSA
ARLY_PSEPW      TIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITR
ARLY_PSEPK      TIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILGEITR
ARLY_PSE14      TIQAEIEAGNFEWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITR
ARLY_ALHEH      RIREEIEHGQFQWSPKLEDVHMNIEKRLTDLIGEAGKKLHTGRSRNDQVATDIRLWLREAIDGILDELLR
ARLY_ACICJ      XXXXXXXXGSFTFDPALEDIHTNIEAWLVARIGEAGRRLHTARSRNDQVATDFRLWVRNAIDSLDGQVRE
ARLY_STAHJ      EIQQDFHNGKLAFKKSLEDIHLNIEHELIQRVGDAGGKLHTGRSRNDQVATDLHLYVKKEVLEIQDLIRS
ARLY_PROM2      LIKVEYLEGKFSPGLPSEDIHYSIEEKLISLIGETGKKLHTGRSRNDQVGTDIRLWLRKEIDKIEILITD
ARLY_NEIG1      EILEEIRSGKIEWPLDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATDIRLWLRDQITVIQNLIQN
ARLY_PSESM      TIQAEIEAGNFEWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITR
ARLY_SACD2      AIRSDIVEGKFDWSISLEDVHMNIEAELTKRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDNIAKELTR
ARLY_PSEU2      TIQAEIEAGQFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITR
ARLY_NITEU      QIREEISKGEFEWQLEQEDVHLNIERRLTALTGDAGKKLHTARSRNDQVATDIRLYLRTAIDEIIDLIHT
ARLY_GEOTN      RLLEKAKRGELEFSVAYEDIHLNIEKMLIDDIGSVGGKLHTGRSRNDQVATDMHLYLRKRVKEILSLIRG
ARLY_STAES      NIQSDFEEGKLKFKASLEDIHLNIEHELIQRIGEAGGKLHTGRSRNDQVATDMHLYTKEQVQYIIELIAS
ARLY_STAEQ      NIQSDFEEGKLKFKASLEDIHLNIEHELIQRIGEAGGKLHTGRSRNDQVATDMHLYTKEQVQYIIELIAS
ARLY_PSEFS      TIRGEIEAGTFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDLILGEITR
ARLY_MACCJ      GIIEDYEAGNVTFKKELEDIHLNIEKLLIEKIGPVGGKMHTARSRNDQVATDMHLYAKEMTEAIITSIKA
ARLY_AZOSE      QIRGEIERGEFAWNLDDEDVHLNIEKRLTALVGNPGKRLHTGRSRNDQVATDIRLWLRDAIDRILALIGE
ARLY_PSEA7      QIQAEIEAGSFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDTILAEITR
ARLY_CLOTH      EILKDIEEGKVQFEIDAEDIHMNVEKILISRIGDVGKKLHTGRSRNDQVALDIRMYLRDEVVEIRKLLVN
ARLY2_PSEPF     TIQGEIEAGQFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDLILSEITR
ARLY_SPHWW      AVAAEYAEQGVPVDLALEDIHMATEGRLAELIGAPAGRLHTARSRNDQVATDFRLWVRDAIDSVEAGLVA
ARLY_PSEMY      QIQGEIEAGQFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDVILAEITR
ARLY_PSEF5      TIQGEIEAGSFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRDEIDLILGEITR
ARLY_NEIMF      EILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATDIRLWLRDQITVIRSLIQS
ARLY_NEIMB      EILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATDIRLWLRDQITVIQSLIQS
ARLY_NEIM0      EILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATDIRLWLRDQITVIQSLIQS
ARLY_EUBE2      GILADIESGKLEITDEYEDIHTFMEATLIERIGDAGKRLHTGRSRNDQVALDMRLFTRQEVLNTDAELKE
ARLY_PROM5      NIKQDFIKGEFSPGAPSEDIHYSIEEKLIDLIGDTGKKLHTGRSRNDQVGTDIRLWLRKKIDTIDNLLAE
ARLY_NITHX      TILSEIRNGTFDFKRALEDIHMNVEGRLGEMIGAAAGRLHTARSRNDQVATDFRLYVRDVIDETDAALAA
ARLY_EXIS2      QLQTTL--EQHVYTTVDEDIHMNLERLLTEQIGPVAGKLHTARSRNDQVATDLHLWMEQHVLELLSSLRN
ARLY_NEIMA      EILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATDIRLWLRDQITVIQSLIQS
ARLY_CLOCE      NILNDIEAGKIDFEIDAEDIHMNVEKILISRIGDTGKKLHTGRSRNDQVALDIRMYLRDEIISIKEMVAV
ARLY_POLNA      QITREIEAGEFEWKLDLEDVHLNIEARLTQLVGDPGKRLHTGRSRNDQVATDVRLWLRGEIDLIGGLLTD
ARLY_METFK      EIMDEIRNGEFAWLLDLEDVHLNIEKRLTDKIGDAGKRLHTGRSRNDQVATDIRLWLRSMVDDALSRLRK
ARLY_CAMJR      QVRSEIEQGKFVFDIKDEDIHMAIEKRLSEIIGSEGGRLHTARSRNDQVATDFKLFVKKSHXXXXXXXXX
ARLY_STAS1      AILKDYEQDNLELDTSLEDIHLNIEHELIKRIGDAGGRLHTGRSRNDQVATDMHLYTKAEVNALIELITQ
ARLY_CAMJD      QVRSEIEQGKFIFDIKDEDIHMAIEKRLSEIIGSEGGRLHTARSRNDQVATDFKLFVKKSHXXXXXXXXX
ARLY_ALCBS      EIQLEIENGEFQWSVALEDVHMNIEARLTDKIGITGKKLHTGRSRNDQVATDIRLWLRDELLILEEQFLH
ARLY_LEUMM      IINEELIAGKIEFDVKNEDIHMNIESLLTEKIGPVAGKLHTARSRNDQVATDFHLWVKHRLPHVXXXXXX
ARLY_PSEA8      QIQAEIEAGSFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDTILAEITR
ARLY_NITMU      QIRQEIQGGGFVWQLALEDVHLNIEKRLTALIGDAGKRLHTARSRNDQVATDIRLYLRASIDRITALIHA
ARLY_DESRM      QILEEIEAGKVEFDVAAEDIHMNVEQLLTAKIGAVGKKLHTARSRNDQVAVDIRMYLKDEIIEIRAXXXX
ARLY_CAMJE      QVRSEIEQGKFIFDIKDEDIHMAVEKRLSEIIGSEGGRLHTARSRNDQVATDFKLFVKKSHXXXXXXXXX
ARLY_PSEU5      DIQSEIEAGTFDWRVDLEDVHMNIEARLTDRIGIVGKKLHTGRSRNDQVATDIRLWLRDEIDVILGEITR
ARLY_PSEAE      QIQAEIEAGSFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDTILAEITR
ARLY_LEPCP      QITQEIESGAFEWKLELEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQVATDVRLWLRGEIDATAVLLAD
ARLY_HELMO      KIMADIEAGRVEFDVAAEDIHMNIEKILTERIGDVGKKLHTGRSRNDQVALDVRLYLRDEITETGRLLRE
ARLY_BACLD      SLLHKAEKNELDFSVDCEDIHLNLEKMLIDEIGPLGGKLHTARSRNDQVATDMHLYLKGHTEHIIELITA
ARLY_CHRSD      EIEQEIDAGTFEWSVDLEDVHMNLEARLTEKIGITGKKLHTGRSRNDQIATDIRLYLRDAIDVVDAELAR
ARLY_CAMJJ      QVKSEIEQGKFVFDIKDEDIHMAIEKRLSEIIGSEGGRLHTARSRNDQVATDFKLFVKKSHXXXXXXXXX
ARLY_ALKMQ      SILADIEAGKVEFQLELEDIHMNIETLLIDSIGEVGKKLHTARSRNDQVAVDIRXXXXXXXXXXXXXXXX
ARLY_CLOD6      GILEDVENGKLVLDGEYEDIHSFTEINLIQRIGDVGKKLHTARSRNDQVAVDMRLYAKEKANDLVGLISE
ARLY_CAMJ8      QVKSEIEQGKFVFDIKDEDIHMAIEKRLSEIIGSEGGRLHTARSRNDQVATDFKLFVKKSHXXXXXXXXX
ARLY_BORPE      QILSEIDAGSFQWLLDLEDVHLNIEKRLVELVGDAGKRLHTGRSRNDQVATDIRLWLRDEIDTLVDLLRQ
ARLY_BORPA      QILSEIDAGSFQWLLDLEDVHLNIEKRLVELVGDAGKRLHTGRSRNDQVATDIRLWLRDEIDTLVDLLRQ
ARLY_BORBR      QILSEIDAGSFQWLLDLEDVHLNIEKRLVELVGDAGKRLHTGRSRNDQVATDIRLWLRDEIDTLVDLLRQ
ARLY_PSEAB      QIQAEIEAGSFDWRVDLEDVHMNIEARLTDRIGVTGKKLHTGRSRNDQVATDIRLWLRDEIDTILAEITR
ARLY_BURPP      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLTE
ARLY_BURP8      QIQGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGDLLKG
ARLY_AZOSB      QIKGEIERGEFNWNLDDEDVHLNIEKRLTALVGDAGKRLHTGRSRNDQVATDIRLWLRDAIDQILALIGD
ARLY_MOOTA      EIRADIEAGRVTFDVGAEDIHMNIEKLLTERIGEAGKKLHTARSRNDQVALDLRLYLKEEIPAVKKLLAG
ARLY_DEHSB      AILTEIETGSFVFKPEMEDIHMAIEGRLFELIGEAAGRLHTARSRNDQVATDVHLFVKNACDKTINKIRT
ARLY_BACA2      TLLQKAEEGTLEFSVDYEDIHLNIEKMLIEEIGPLGGKLHTGRSRNDQVATDMHLYLKDHVSHIIVLIEQ
ARLY_PSYA2      QVLREIEAGEFNWSIALEDVHMNVESRLTDIVGAVGKKLHTGRSRNDQVATDIRLWLREETDNIIALLVR
ARLY_DEIDV      AVLADIRAGTFEWRLDREDVHMNVEAALRDRIGPVAGKLHTARSRNDQVAVDFRLFTKEAALDLADKTRA
ARLY_DEHSC      TILTEIETGSFVFKPETEDIHMAIEGRLFELIGEAAGRLHTARSRNDQVATDVHLFVKNACDETINKIRT
ARLY_BURXL      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLTE
ARLY_RALME      QIRGEIESGAFEWKLDLEDVHLNIEARLTALVGDAGKRLHTGRSRNDQVATDIRLWLRSEIDSIVXXXXX
ARLY_CLOB8      EILKRMDNGVIEIDETSEDIHSFVEGTLTYYIGEYGKMLHTGRSRNDQVTLDLRLYLKKAITSLKQDIIA
ARLY_BACSU      TLLQKAEEGALEFSVDYEDIHLNIEKMLIDEIGPLGGKLHTGRSRNDQVATDMHLYLKNHVGHIIELIEA
ARLY_PSYCK      QVLREIEAGEFNWSIALEDVHMNVESRLTDIVGAVGKKLHTGRSRNDQVATDIRLWLREETDNIIALLVR
ARLY_DESPS      SIEADIEAGVFEFKTEYEDVHMNIEQALVDRIGAAGSRLHAARSRNDQIALDFKMYLRDQCDHLVELLDG
ARLY_DESAD      QVLEEIESGKFEWKKEMEDLHMNIESRLTEIVGPVGGKLHTGRSRNDQVATDFRLHVLRSLEAWKTALEK
ARLY_CLOPE      EILDKLNQGVLKIDNSSEDIHSFIESTLTDYIGEEGKKLHTGRSRNDQVTLDTKLYLKGYIKILICEILN
ARLY_BURM1      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_GEOKA      RLLEKAKQGELKFSIAYEDIHLNIEKMLIDDIGPVGGKLHTGRSRNDQVATDMHLYLRKRVEEILGLIRG
ARLY_DEHE1      DILTEIETGSFVFKPEMEDIHMAIEGRLFELIGEAAGRLHTARSRNDQVATDVHLFVNTCTSTINK-IRT
ARLY_ANAVT      QIREEYRQGKFQPGIDAEDVHFAVERRLTEIVGDVGKKLHTARSRNDQVGTDTRLYLRDQISQIKTQLRE
ARLY_ACIBS      TIRAEIEAGTFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDIXXXXXX
ARLY_ACIBC      TIRAEIEAGTFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDIXXXXXX
ARLY_METCA      AIGAEIEAGQFPWEVSLEDVHMNIEARLTQRIGEAGKKLHTGRSRNDQVATDVRLYLRTEIDRICGMILR
ARLY_CLOP1      EILNKLNQGVLKIDNSSEDIHSFIESTLTDYIGEEGKKLHTGRSRNDQVTLDTKLYLKGYIKILICEILN
ARLY_ACIBY      TIRAEIEAGTFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDIXXXXXX
ARLY_ACIB5      TIRAEIEAGTFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDIXXXXXX
ARLY_ACIB3      TIRAEIEAGTFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDIXXXXXX
ARLY_SPHAL      QIAEEFAENGVPVDLSLEDIHMTVEARLKELIGEPAGRLHTARSRNDQVATDFRLWTRTACERIDXXXXX
ARLY_MAGSM      QVRGEIDRGEMHYSNALEDIHMHVESRLTEIIGPVAGKLHTARSRNDQVATDFRLYLRDELDAIVQAIRT
ARLY_ANASP      QIREEYRQGKFQPGIDAEDVHFAVERRLTEIVGDVGKKLHTARSRNDQVGTDTRLYLRDQILQIKTQLRE
ARLY_BURTA      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_AQUAE      XXXXXXXXGKFQWKKELEDVHMNIEAELINRLGDVGRKLHTARSRNDQVATDEKLYLKKEIKEVLQLLKE
ARLY_STAAW      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAAS      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAAR      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAAN      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAAM      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAAE      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAAC      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAA9      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAA8      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAA2      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAA1      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_BURMS      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_BURMA      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_BURM9      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_BURM7      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_BURCH      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_BURCA      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_ACIAD      AIKSEIEAGQFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDXXXXXXX
ARLY_PELTS      EVLADIEAGRAGFSVEAEDIHMNVEQLLTAKVGEVGKKLHTARSRNDQVALDIRMYLKDEIDQITGXXXX
ARLY_BURCC      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_DIAST      QITQEIASGAFEWKLDLEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQVATDVRLWLRGEIDXXXXXXXX
ARLY_BURCJ      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIGGLLND
ARLY_ACISJ      QITQEIASGAFEWKLDLEDVHLNIEARLTQLVGDAGKRLHTGRSRNDQVATDVRLWLRGEIDXXXXXXXX
ARLY_THICR      KVQSDIEAGKMNWSIKQEDIHMNIEAKLTELIGITGKKLHTGRSRNDQVATDIRLYLRDEIDAILPEMAR
ARLY_STAAT      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_STAA3      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_BORA1      QILSEIDAGSFQWLLDLEDVHLNIEKRLVELVGDAGKRLHTGRSRNDQVATXXXXXXXXXXXXXXXXXXX
ARLY_THETN      XXXXXXXXXXXPQD---EDVHSYVERLLVEKIGDVGRKLHTGRSRNDQVATDERLYLRXXXXXXXXXXXX
ARLY_METS4      TVQAEIESGAFTFQRALEDIHMNVESRLTELVGPAAGRLHTARSRNDQVATDMRLWVRDTXXXXXXXXXX
ARLY_HAHCH      XXXXXXXXGAFEWSVKLEDVHMNIEARLTQKIGITGKKLHTGRSRNDQVATDIRLYLRDEVDVXXXXXXX
ARLY_STAAB      SIQHDYHQDQIQFSASLEDIHLNIEHELIKRIGDAGGKLHTGRSRNDQVATDMHLYTKKQVQDIIALIKS
ARLY_CLOPH      GIRDDIESGSLVIDSTYEDIHSFVEAHLISRIEEIGKKLHTGRSRNDQVALDMKLYTRDEITVXXXXXXX
ARLY_NOSP7      QIRQEHRQGKFHPGVDAEDVHFAVEKRLTEIVGDVGKKLHTARSRNDQVGTDTRLYLRDQIQQIKSELRE
ARLY_THEPX      EILDETNVGEIPND---EDVHSYVERLLTEKIGDVGRKLHTGRSRNDQVATDERLYLRXXXXXXXXXXXX
ARLY_THEP3      EILDETNVGEIPND---EDVHSYVERLLTEKIGDVGRKLHTGRSRNDQVATDERLYLRXXXXXXXXXXXX
ARLY_PELPB      EIEVELTDGTLLPHWEDEDIHTVIENRLKEKVGAVAGKLHSGRSRNDQVATDTRLYMRRQITELQEALGG
ARLY_DEIGD      GILADIRAGRFDWRLDREDVHMNVEAALRDRIGPVAGKLHTARSRNDQVAVDFRLFTKXXXXXXXXXXXX
ARLY_CLOBM      XXXXXXXXXXXXXEGDYEDIHSFVEINLINKIGDVGKKLHTGRSRNDQVALDMKLYAKKSTEEVIECLKG
ARLY_DESAP      AVLDDFNAGRVAFSPEDEDIHSLVERLLIARVGEVGKKLHTARSRNDQVALDVRMYLKDEIDAVRELLAE
ARLY_PELLD      EIEKEIETGTLVPQWEDEDIHTVIENRLKEKIGAAAGKLHSGRSRNDQVATDTRLYMRERIEELQEALND
ARLY_LACC3      HLQKELAAGKLHFTVENEDIHLNMEALLTAEIGPVAGKLHTARSRNDQVATDLHLWLKHRLPTIKEALTN
ARLY_SCHPO      QIQREWNSGQFVLEPSDEDVHTANERRLTEIIGDVAGKLHTGRSRNDQVTTDLRLWLCRKIKEVEVYVIN
ARLY_RALEH      QIKAEIEAGGFEWKLDLEDVHLNIEARLTALVGDAGKRLHTGRSRNDQVATDIRLWLRSEIDNIMVXXXX
ARLY_CLONN      XXXXXXENGVLKIEGDYEDIHSFIEINLINRVGDVGKKLHTGRSRNDQVAVDMRMYAKSITFEIIEYINE
ARLY_CLOBB      EILKRMDNNVINVDLTSEDIHSFVESTLTYYIGEYGKMLHTARSRNDQVTXXXXXXXXXXXXXXXXDILY
ARLY_BURVG      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIXXXXXX
ARLY_BURS3      QIKGEIERGEFEWQLDLEDVHLNIEARLTALIGDAGKRLHTGRSRNDQVATDIRLWLRGEIDRIXXXXXX
ARLY_CLOBA      EILKRMDNDVINIDLTSEDIHSFVESTLTYYIGEYGKMLHTARSRNDQVTXXXXXXXXXXXXXXXXDILY
ARLY_RALEJ      QIKGEIEAGGFEWKLDLEDVHLNIEARLTALVGDAGKRLHTGRSRNDQVATDIRLWLRSEIDNIIXXXXX
ARLY_THEEB      QIRQEYRAGQFTPGIEAEDVHFAVERRLTELVGEVGKKLHTARSRNDQVGTDVRLYLRSEIDHIXXXXXX
ARLY_PROMH      ELSEEVTANPHSIQSDAEDIHSWVESKLIAKVGDLGKKLHTGRSRNDQVATDLKLWCKEEVAHLRQAIIE
ARLY_PETMO      ---RXXXXXXXXXXXXXXDVHTLVEQMLVEKIGDVGKKIHTARSRNDQIATDERMYLRNEIFKIIDXXXX
ARLY_SHEHH      ELLAETIDNQLIIASGAEDIHSFVEQSLIAKVGDLGKKLHTGRSRNDQVATDLKLWCKKEGEQXXXXXXX
ARLY_DECAR      IVTEEIESGKFEWSLDLEDVHLNIEKRLTALVGDAGKRLHTGRSRNDQVATDIRLYLRDSIDDILVLIKA
ARLY_CLOBJ      XXXXXXXXXXXXXXXXYEDIHSFVEINLINKIGNVGKKLHTGRSRNDQVALDMKLYAKKSTEEVIECLKE
ARLY_CLOB6      XXXXXXXXXXXXXXXXYEDIHSFVEINLINKIGNVGKKLHTGRSRNDQVALDMKLYAKKSTEEVIECLKE
ARLZ_SCHPO      AVRDEWKTNKFTLQPSDEDIHTANERRLGEIIGTGAGKLHTGRSRNDQVTTDMRLWLRDELDIIQKSLVG
ARLY_RALPJ      QIRQEIEAGTFEWKLDLEDVHLNIEARLTAMAGDAGKRLHTGRSRNDQVATDIRLWLRSEIDNIVGXXXX
ARLY_LEPIN      QIKTELEEGKFEFKSELEDIHMHIEFRLTELIGETGKKLHTARSRNDQVTQDVRLYILNQGKEILKSIIN
ARLY_LEPIC      QIKTELEEGKFEFKSELEDIHMHIEFRLTELIGETGKKLHTARSRNDQVTQDVRLYILNQGKEILKSIIN
ARLY_CYAP8      QIRQEYRQGEFKPGIDQEDVHFAVERRLTEIVGDVGKKLHTARSRNDQVGTDIRLYLRDQISQIRAQLRE
ARLY_JANMA      QIQEEIASGKFEWLLDLEDVHLNIEKRLTELVGDAGKRLHTGRSRNDQVATDIRLYVRSEIDNIVGXXXX
ARLY_CLOBH      XXXXXXXXXXXXXXXXYEDIHSFVEINLINKIGNVGKKLHTGRSRNDQVALDMKLYAKKSTEEVIECLKE
ARLY_CLOB1      XXXXXXXXXXXXXXXXYEDIHSFVEINLINKIGNVGKKLHTGRSRNDQVALDMKLYAKKSTEEVIECLKE
ARLY_SHEDO      XXXXXVGDDQVIISTGAEDIHSFVEQKLIAKVGDLGKKLHTGRSRNDQVATDLKLWCKREGAALLARLNT
ARLY_MICAN      QIRQEYRTGNFNPGIDQEDVHFAVERRLTEIVGDV