[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21245.1

[Show Plain Result]


## Summary of Sequence Search
    1::299
    2::145     3e-11  27%  153 aa  YDEB_BACSU RecName: Full=Uncharacterized protein ydeB;
   40::274     2e-06  25% 1051 aa  APSB_EMENI RecName: Full=Anucleate primary sterigmata protein B;
  904::1050    1e-04  36% 1855 aa  MYO5A_HUMAN RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
  493::612     2e-04  27% 1168 aa  MFD_STAAR RecName: Full=Transcription-repair-coupling factor;      
  494::613     4e-04  23% 1169 aa  MFD_STAES RecName: Full=Transcription-repair-coupling factor;      
  494::613     4e-04  23% 1169 aa  MFD_STAEQ RecName: Full=Transcription-repair-coupling factor;      
  499::640     5e-04  27% 1177 aa  MFD_BACSU RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAAW RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAAS RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAAN RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAAM RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAAC RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAAB RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAA8 RecName: Full=Transcription-repair-coupling factor;      
  493::612     8e-04  26% 1168 aa  MFD_STAA3 RecName: Full=Transcription-repair-coupling factor;      
    1::299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxK
YDEB_BACSU      ----------------------------------------------------------------------
APSB_EMENI      ---------------------------------------------------------------------K
MYO5A_HUMAN     ----------------------------------------------------------------------
MFD_STAAR       ----------------------------------------------------------------------
MFD_STAES       ----------------------------------------------------------------------
MFD_STAEQ       ----------------------------------------------------------------------
MFD_BACSU       ----------------------------------------------------------------------
MFD_STAAW       ----------------------------------------------------------------------
MFD_STAAS       ----------------------------------------------------------------------
MFD_STAAN       ----------------------------------------------------------------------
MFD_STAAM       ----------------------------------------------------------------------
MFD_STAAC       ----------------------------------------------------------------------
MFD_STAAB       ----------------------------------------------------------------------
MFD_STAA8       ----------------------------------------------------------------------
MFD_STAA3       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVET
YDEB_BACSU      --------------------------------------FQIGDNIVYPMHXXXXXXXXXXXXXXXXKQQY
APSB_EMENI      EMISENVELKSDKLKLQKDNQLKRKIRDLEKQLKDQQSDKESMLNHDPEGGSDEHAQDEELLFLRERVET
MYO5A_HUMAN     --------------------------------------------------------ELKKLKIEARSVER
MFD_STAAR       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQIHRDY
MFD_STAES       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGDTHRDY
MFD_STAEQ       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGDTHRDY
MFD_BACSU       -------------------------------------ELQIGDYVVHINHGIGKYLGIETLEINGI----
MFD_STAAW       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAAS       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAAN       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAAM       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAAC       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAAB       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAA8       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY
MFD_STAA3       ------------------------------------QDLNVGDYIVHVHHGVGRYLGVETLEVGQTHRDY


                         +         .         .         .         .         *         .:210
query           YVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAE
YDEB_BACSU      YVIRMSISNMTVMIPTSKSSNIRPVTDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGAE
APSB_EMENI      YELEIERLRSESIARESEKRRLEMLKSLNDGRPTGS--DSGAREERDMWNKRLREELMRVRSEATYAIAP
MYO5A_HUMAN     Y-----KKLHIGME--NKIMQLRKVDEQNKDYKCLGIYNSETEKLRSDLERQLSEEEAKVATGRVLSLQE
MFD_STAAR       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAES       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKSPRLNK-LGGTEWKKTKAKVQQ-SVEDIAD
MFD_STAEQ       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKSPRLNK-LGGTEWKKTKAKVQQ-SVEDIAD
MFD_BACSU       -----HKDYLNIHYQGSDKLYV-PVEQIDQVQKYVGSEGKEPKLYKSEWKRVKKKVETSVQ--------D
MFD_STAAW       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAAS       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAAN       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAAM       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAAC       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAAB       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAA8       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE
MFD_STAA3       IKLQY-KGTDQLFVPVDQ---------MDQVQKYVASEDKTPKLNKSEWKKT----KAKVQQ-SVEDIAE


                         .         .         .         +         .         .         .:280
query           VVRDLNKGDDLMVDQSYSERQLFEKAYERILSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAPTKI
YDEB_BACSU      VVRDLMRMKKEKA-LNASEKKMLDNAYEFLISELEVIKGIT-----------------------------
APSB_EMENI      AAGHRNRGDSLVSHSAVSDRELYRNTAAGSSSSSTLVMEFEL---LKQENAELRREVSAQTSMLTSRNRE
MYO5A_HUMAN     EIAKLRKD----LEQTRSEKKCIEEHADRYKQETQLVSNLKEENTLLKQEKALNHRIVQQAK--------
MFD_STAAR       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAES       ELIDLYKEREMSVGYQYGQDTAEQSAFE------------------------------------------
MFD_STAEQ       ELIDLYKEREMSVGYQYGQDTAEQSAFE------------------------------------------
MFD_BACSU       IADDLIK---LYAEREASKGYAFSPDHE-MQREFESAFPYQETEDQLRSIHEIKKDME------------
MFD_STAAW       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAAS       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAAN       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAAM       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAAC       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAAB       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAA8       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------
MFD_STAA3       ELIDLYKEREMAEGYQYGEDTAEQTTFE------------------------------------------


                         .         *         .         .         .         .         +:350
query           KExxxxxxxxxxxxxxxxx
YDEB_BACSU      -------------------
APSB_EMENI      KE-----------------
MYO5A_HUMAN     -------------------
MFD_STAAR       -------------------
MFD_STAES       -------------------
MFD_STAEQ       -------------------
MFD_BACSU       -------------------
MFD_STAAW       -------------------
MFD_STAAS       -------------------
MFD_STAAN       -------------------
MFD_STAAM       -------------------
MFD_STAAC       -------------------
MFD_STAAB       -------------------
MFD_STAA8       -------------------
MFD_STAA3       -------------------