[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21331.1

[Show Plain Result]


## Summary of Sequence Search
    1::203
   18::203     4e-97 100%  203 aa  RECR_PELUB RecName: Full=Recombination protein recR;
   19::199     3e-41  45%  199 aa  RECR_JANSC RecName: Full=Recombination protein recR;
   21::201     1e-40  43%  201 aa  RECR_MARMM RecName: Full=Recombination protein recR;
   20::199     4e-40  44%  199 aa  RECR_SILST RecName: Full=Recombination protein recR;
   19::195     1e-39  44%  198 aa  RECR_SILPO RecName: Full=Recombination protein recR;
   17::194     1e-39  43%  198 aa  RECR_NOVAD RecName: Full=Recombination protein recR;
   21::199     2e-39  45%  201 aa  RECR_BEII9 RecName: Full=Recombination protein recR;
   19::196     3e-39  42%  199 aa  RECR_RHOS5 RecName: Full=Recombination protein recR;
   18::194     4e-39  45%  197 aa  RECR_ROSDO RecName: Full=Recombination protein recR;
   21::199     6e-39  43%  201 aa  RECR_METRJ RecName: Full=Recombination protein recR;
   19::196     7e-39  42%  199 aa  RECR_RHOSK RecName: Full=Recombination protein recR;
   19::196     7e-39  42%  199 aa  RECR_RHOS4 RecName: Full=Recombination protein recR;
   19::196     7e-39  42%  199 aa  RECR_RHOS1 RecName: Full=Recombination protein recR;
   17::194     1e-38  44%  198 aa  RECR_ZYMMO RecName: Full=Recombination protein recR;
   19::196     2e-38  44%  199 aa  RECR_PARDP RecName: Full=Recombination protein recR;
   16::196     5e-38  43%  196 aa  RECR_NEOSM RecName: Full=Recombination protein recR;
   17::194     1e-37  42%  198 aa  RECR_SPHWW RecName: Full=Recombination protein recR;
   19::197     1e-37  40%  203 aa  RECR_ORITI RecName: Full=Recombination protein recR;
   21::199     1e-37  40%  201 aa  RECR_METEP RecName: Full=Recombination protein recR;
   21::199     1e-37  40%  201 aa  RECR_METC4 RecName: Full=Recombination protein recR;
   17::198     2e-37  40%  198 aa  RECR_ERYLH RecName: Full=Recombination protein recR;
   17::194     2e-37  40%  198 aa  RECR_SPHAL RecName: Full=Recombination protein recR;
   19::196     2e-37  39%  200 aa  RECR_RICBR RecName: Full=Recombination protein recR;
   19::196     2e-37  39%  200 aa  RECR_RICB8 RecName: Full=Recombination protein recR;
   21::199     2e-37  42%  201 aa  RECR_METSB RecName: Full=Recombination protein recR;
   20::197     4e-37  40%  201 aa  RECR_RICAH RecName: Full=Recombination protein recR;
   21::201     5e-37  41%  201 aa  RECR_RHIME RecName: Full=Recombination protein recR;
   19::197     5e-37  40%  203 aa  RECR_ORITB RecName: Full=Recombination protein recR;
   21::199     5e-37  40%  201 aa  RECR_METPB RecName: Full=Recombination protein recR;
   19::196     5e-37  41%  199 aa  RECR_DINSH RecName: Full=Recombination protein recR;
   20::197     1e-36  39%  201 aa  RECR_RICFE RecName: Full=Recombination protein recR;
   21::201     2e-36  41%  201 aa  RECR_RHIL3 RecName: Full=Recombination protein recR;
   21::199     2e-36  40%  201 aa  RECR_AGRVS RecName: Full=Recombination protein recR;
   21::199     6e-36  40%  201 aa  RECR_METNO RecName: Full=Recombination protein recR;
   21::199     6e-36  40%  201 aa  RECR_MESSB RecName: Full=Recombination protein recR;
   21::199     7e-36  40%  201 aa  RECR_METS4 RecName: Full=Recombination protein recR;
   20::197     1e-35  37%  201 aa  RECR_RICM5 RecName: Full=Recombination protein recR;
   21::201     2e-35  41%  201 aa  RECR_RHIEC RecName: Full=Recombination protein recR;
   21::199     3e-35  40%  201 aa  RECR_XANP2 RecName: Full=Recombination protein recR;
   20::197     3e-35  37%  201 aa  RECR_RICRS RecName: Full=Recombination protein recR;
   20::197     3e-35  37%  201 aa  RECR_RICRO RecName: Full=Recombination protein recR;
   20::197     3e-35  37%  201 aa  RECR_RICPU RecName: Full=Recombination protein recR;
   20::197     3e-35  37%  201 aa  RECR_RICAE RecName: Full=Recombination protein recR;
   21::199     3e-35  40%  201 aa  RECR_RHILO RecName: Full=Recombination protein recR;
   19::196     4e-35  40%  199 aa  RECR_PARL1 RecName: Full=Recombination protein recR;
   21::199     5e-35  40%  201 aa  RECR_BARBK RecName: Full=Recombination protein recR;
   20::197     1e-34  37%  201 aa  RECR_RICCN RecName: Full=Recombination protein recR;
   21::199     1e-34  39%  201 aa  RECR_OLICO RecName: Full=Recombination protein recR;
   21::201     1e-34  41%  201 aa  RECR_BARQU RecName: Full=Recombination protein recR;
   20::197     1e-34  41%  200 aa  RECR_CAUCR RecName: Full=Recombination protein recR;
   20::197     1e-34  41%  200 aa  RECR_CAUCN RecName: Full=Recombination protein recR;
   21::201     1e-34  41%  201 aa  RECR_BART1 RecName: Full=Recombination protein recR;
   21::189     2e-34  40%  201 aa  RECR_SINMW RecName: Full=Recombination protein recR;
   18::195     2e-34  39%  199 aa  RECR_RICPR RecName: Full=Recombination protein recR;
   21::201     3e-34  40%  201 aa  RECR_HYPNA RecName: Full=Recombination protein recR;
   21::201     4e-34  41%  201 aa  RECR_BARHE RecName: Full=Recombination protein recR;
   18::195     5e-34  38%  199 aa  RECR_RICTY RecName: Full=Recombination protein recR;
   14::191     7e-34  36%  195 aa  RECR_EHRCR RecName: Full=Recombination protein recR;
   21::189     9e-34  40%  201 aa  RECR_AGRT5 RecName: Full=Recombination protein recR;
   21::189     9e-34  40%  201 aa  RECR_AGRRK RecName: Full=Recombination protein recR;
   17::194     1e-33  41%  197 aa  RECR_MAGSA RecName: Full=Recombination protein recR;
   17::184     1e-33  45%  196 aa  RECR_ACICJ RecName: Full=Recombination protein recR;
   14::191     6e-33  36%  195 aa  RECR_EHRCJ RecName: Full=Recombination protein recR;
   21::189     8e-33  41%  201 aa  RECR_OCHA4 RecName: Full=Recombination protein recR;
   20::197     8e-33  38%  200 aa  RECR_CAUSK RecName: Full=Recombination protein recR;
   19::197     1e-32  39%  199 aa  RECR_BRASO RecName: Full=Recombination protein recR;
   19::197     1e-32  38%  199 aa  RECR_BRASB RecName: Full=Recombination protein recR;
   17::197     2e-32  38%  197 aa  RECR_SACD2 RecName: Full=Recombination protein recR;
   20::198     3e-32  38%  200 aa  RECR_RHOPT RecName: Full=Recombination protein recR;
   20::198     3e-32  38%  200 aa  RECR_RHOPA RecName: Full=Recombination protein recR;
   21::199     4e-32  37%  201 aa  RECR_NITWN RecName: Full=Recombination protein recR;
   21::189     4e-32  40%  201 aa  RECR_BRUME RecName: Full=Recombination protein recR;
   21::189     4e-32  40%  201 aa  RECR_BRUMB RecName: Full=Recombination protein recR;
   21::189     5e-32  40%  201 aa  RECR_BRUSU RecName: Full=Recombination protein recR;
   21::189     5e-32  40%  201 aa  RECR_BRUSI RecName: Full=Recombination protein recR;
   21::189     5e-32  40%  201 aa  RECR_BRUO2 RecName: Full=Recombination protein recR;
   21::189     5e-32  40%  201 aa  RECR_BRUC2 RecName: Full=Recombination protein recR;
   21::189     5e-32  40%  201 aa  RECR_BRUAB RecName: Full=Recombination protein recR;
   21::189     5e-32  40%  201 aa  RECR_BRUA2 RecName: Full=Recombination protein recR;
   27::199     7e-32  37%  201 aa  RECR_WOLPM RecName: Full=Recombination protein recR;
   21::199     1e-31  38%  201 aa  RECR_RHOPS RecName: Full=Recombination protein recR;
   20::198     1e-31  37%  200 aa  RECR_NITHX RecName: Full=Recombination protein recR;
   24::201     1e-31  37%  204 aa  RECR_DEHE1 RecName: Full=Recombination protein recR;
   21::201     2e-31  38%  201 aa  RECR_RHIE6 RecName: Full=Recombination protein recR;
   17::195     2e-31  39%  197 aa  RECR_PSYCK RecName: Full=Recombination protein recR;
   24::201     2e-31  37%  204 aa  RECR_DEHSC RecName: Full=Recombination protein recR;
   24::201     2e-31  37%  204 aa  RECR_DEHSB RecName: Full=Recombination protein recR;
   17::195     3e-31  39%  197 aa  RECR_PSYA2 RecName: Full=Recombination protein recR;
   21::199     4e-31  37%  201 aa  RECR_RHOP5 RecName: Full=Recombination protein recR;
   21::199     4e-31  37%  201 aa  RECR_RHOP2 RecName: Full=Recombination protein recR;
   21::189     4e-31  38%  201 aa  RECR_RHISN RecName: Full=Recombination protein recR;
   27::199     6e-31  37%  201 aa  RECR_WOLTR RecName: Full=Recombination protein recR;
   18::195     6e-31  36%  199 aa  RECR_RICCK RecName: Full=Recombination protein recR;
   25::202     7e-31  37%  205 aa  RECR_ROSCS RecName: Full=Recombination protein recR;
   21::199     7e-31  37%  201 aa  RECR_RHOPB RecName: Full=Recombination protein recR;
   17::198     7e-31  39%  198 aa  RECR_ACIAD RecName: Full=Recombination protein recR;
   17::195     1e-30  39%  195 aa  RECR_PSYWF RecName: Full=Recombination protein recR;
   19::196     1e-30  37%  200 aa  RECR_DESRM RecName: Full=Recombination protein recR;
   19::205     2e-30  38%  205 aa  RECR_CYTH3 RecName: Full=Recombination protein recR;
   36::194     4e-30  42%  197 aa  RECR_RHORT RecName: Full=Recombination protein recR;
   21::200     5e-30  37%  201 aa  RECR_PROM2 RecName: Full=Recombination protein recR;
   19::196     5e-30  39%  200 aa  RECR_AMOA5 RecName: Full=Recombination protein recR;
   19::196     8e-30  37%  199 aa  RECR_PROMS RecName: Full=Recombination protein recR;
   19::198     8e-30  36%  199 aa  RECR_PROM5 RecName: Full=Recombination protein recR;
   19::198     1e-29  37%  199 aa  RECR_PROMP RecName: Full=Recombination protein recR;
   19::196     1e-29  37%  199 aa  RECR_PROM0 RecName: Full=Recombination protein recR;
   18::195     1e-29  38%  203 aa  RECR_CHRSD RecName: Full=Recombination protein recR;
   18::195     1e-29  37%  198 aa  RECR_ANOFW RecName: Full=Recombination protein recR;
   19::199     2e-29  38%  199 aa  RECR_SYNPW RecName: Full=Recombination protein recR;
   33::201     2e-29  38%  201 aa  RECR_AZOC5 RecName: Full=Recombination protein recR;
   19::196     3e-29  37%  199 aa  RECR_PROM9 RecName: Full=Recombination protein recR;
   17::197     4e-29  39%  199 aa  RECR_LEGPH RecName: Full=Recombination protein recR;
   17::197     4e-29  36%  197 aa  RECR_FUSNN RecName: Full=Recombination protein recR;
   21::199     4e-29  39%  205 aa  RECR_BACTN RecName: Full=Recombination protein recR;
   21::201     5e-29  37%  201 aa  RECR_RHILW RecName: Full=Recombination protein recR;
   15::195     5e-29  39%  197 aa  RECR_LEGPL RecName: Full=Recombination protein recR;
   15::195     5e-29  39%  197 aa  RECR_LEGPC RecName: Full=Recombination protein recR;
   15::195     5e-29  39%  197 aa  RECR_LEGPA RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAW RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAT RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAS RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAR RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAE RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAC RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAAB RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAA8 RecName: Full=Recombination protein recR;
   18::196     7e-29  37%  198 aa  RECR_STAA3 RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAES RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAEQ RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAAN RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAAM RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAA9 RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAA2 RecName: Full=Recombination protein recR;
   18::196     9e-29  37%  198 aa  RECR_STAA1 RecName: Full=Recombination protein recR;
   19::196     9e-29  37%  199 aa  RECR_NITOC RecName: Full=Recombination protein recR;
   19::199     9e-29  34%  200 aa  RECR_MAGSM RecName: Full=Recombination protein recR;
   18::198     9e-29  37%  198 aa  RECR_MACCJ RecName: Full=Recombination protein recR;
   17::197     1e-28  36%  197 aa  RECR_THICR RecName: Full=Recombination protein recR;
   19::196     1e-28  36%  205 aa  RECR_GRAFK RecName: Full=Recombination protein recR;
   17::199     1e-28  38%  199 aa  RECR_CYAP7 RecName: Full=Recombination protein recR;
   17::194     2e-28  37%  199 aa  RECR_STRAW RecName: Full=Recombination protein recR;
   18::196     2e-28  37%  198 aa  RECR_STAHJ RecName: Full=Recombination protein recR;
   20::200     2e-28  36%  200 aa  RECR_BIFAA RecName: Full=Recombination protein recR;
   17::194     3e-28  36%  201 aa  RECR_PROAC RecName: Full=Recombination protein recR;
    9::189     3e-28  37%  189 aa  RECR_PROMM RecName: Full=Recombination protein recR;
   18::197     3e-28  36%  201 aa  RECR_BRAHW RecName: Full=Recombination protein recR;
   14::191     3e-28  34%  195 aa  RECR_ANAMM RecName: Full=Recombination protein recR;
   18::196     4e-28  37%  198 aa  RECR_STACT RecName: Full=Recombination protein recR;
   17::194     4e-28  44%  198 aa  RECR_LEIXX RecName: Full=Recombination protein recR;
   18::195     4e-28  36%  198 aa  RECR_BACHD RecName: Full=Recombination protein recR;
   12::188     6e-28  38%  192 aa  RECR_SYNS9 RecName: Full=Recombination protein recR;
   35::211     6e-28  38%  215 aa  RECR_SYNR3 RecName: Full=Recombination protein recR;
   18::196     6e-28  36%  198 aa  RECR_STAS1 RecName: Full=Recombination protein recR;
   17::194     7e-28  37%  199 aa  RECR_STRCO RecName: Full=Recombination protein recR;
   21::200     7e-28  37%  200 aa  RECR_FRATM RecName: Full=Recombination protein recR;
   19::196     7e-28  35%  206 aa  RECR_FLAPJ RecName: Full=Recombination protein recR;
   19::199     7e-28  35%  199 aa  RECR_CLOTH RecName: Full=Recombination protein recR;
   20::198     7e-28  36%  200 aa  RECR_BRAJA RecName: Full=Recombination protein recR;
    9::189     1e-27  37%  189 aa  RECR_SYNS3 RecName: Full=Recombination protein recR;
   21::199     1e-27  37%  207 aa  RECR_PORGI RecName: Full=Recombination protein recR;
   21::199     1e-27  37%  207 aa  RECR_PORG3 RecName: Full=Recombination protein recR;
   21::200     1e-27  36%  200 aa  RECR_FRATN RecName: Full=Recombination protein recR;
   17::193     1e-27  38%  197 aa  RECR_CYAP8 RecName: Full=Recombination protein recR;
   18::195     1e-27  36%  198 aa  RECR_METCA RecName: Full=Recombination protein recR;
   17::201     1e-27  36%  201 aa  RECR_COXBU RecName: Full=Recombination protein recR;
   18::195     1e-27  35%  198 aa  RECR_BACP2 RecName: Full=Recombination protein recR;
   18::195     1e-27  35%  198 aa  RECR_BACLD RecName: Full=Recombination protein recR;
   17::197     2e-27  37%  199 aa  RECR_THEFY RecName: Full=Recombination protein recR;
   18::195     2e-27  36%  198 aa  RECR_GEOSW RecName: Full=Recombination protein recR;
   21::200     2e-27  36%  200 aa  RECR_FRATO RecName: Full=Recombination protein recR;
   21::200     2e-27  36%  200 aa  RECR_FRATH RecName: Full=Recombination protein recR;
   21::200     2e-27  36%  200 aa  RECR_FRATF RecName: Full=Recombination protein recR;
   18::195     2e-27  35%  198 aa  RECR_BACSU RecName: Full=Recombination protein recR;
    9::189     2e-27  37%  189 aa  RECR_PROM3 RecName: Full=Recombination protein recR;
   19::196     2e-27  34%  199 aa  RECR_NATTJ RecName: Full=Recombination protein recR;
   17::199     2e-27  36%  202 aa  RECR_GRABC RecName: Full=Recombination protein recR;
   21::200     2e-27  36%  200 aa  RECR_FRATT RecName: Full=Recombination protein recR;
   21::200     2e-27  36%  200 aa  RECR_FRAT1 RecName: Full=Recombination protein recR;
   21::199     2e-27  37%  205 aa  RECR_BACFR RecName: Full=Recombination protein recR;
   21::199     2e-27  37%  205 aa  RECR_BACFN RecName: Full=Recombination protein recR;
   17::194     2e-27  35%  199 aa  RECR_ARTS2 RecName: Full=Recombination protein recR;
   21::200     3e-27  36%  200 aa  RECR_FRATW RecName: Full=Recombination protein recR;
   19::198     3e-27  37%  198 aa  RECR_CLOTE RecName: Full=Recombination protein recR;
   18::195     3e-27  35%  198 aa  RECR_BACA2 RecName: Full=Recombination protein recR;
   19::199     3e-27  34%  199 aa  RECR_ALKOO RecName: Full=Recombination protein recR;
   19::196     4e-27  36%  199 aa  RECR_THEP3 RecName: Full=Recombination protein recR;
   19::196     4e-27  42%  206 aa  RECR_FLAJ1 RecName: Full=Recombination protein recR;
   19::195     4e-27  36%  198 aa  RECR_CLONN RecName: Full=Recombination protein recR;
   17::194     4e-27  36%  199 aa  RECR_CLAM3 RecName: Full=Recombination protein recR;
   19::199     4e-27  34%  199 aa  RECR_CALS8 RecName: Full=Recombination protein recR;
   17::197     5e-27  35%  198 aa  RECR_XYLFT RecName: Full=Recombination protein recR;
   19::196     5e-27  36%  199 aa  RECR_THEPX RecName: Full=Recombination protein recR;
   12::188     5e-27  38%  191 aa  RECR_SYNSC RecName: Full=Recombination protein recR;
   12::188     5e-27  37%  192 aa  RECR_SYNPX RecName: Full=Recombination protein recR;
   18::195     5e-27  36%  198 aa  RECR_LISW6 RecName: Full=Recombination protein recR;
   17::194     5e-27  37%  199 aa  RECR_FRASC RecName: Full=Recombination protein recR;
   18::195     5e-27  34%  198 aa  RECR_BACCN RecName: Full=Recombination protein recR;
   18::195     6e-27  36%  198 aa  RECR_LISMO RecName: Full=Recombination protein recR;
   18::195     6e-27  36%  198 aa  RECR_LISMH RecName: Full=Recombination protein recR;
   18::195     6e-27  36%  198 aa  RECR_LISMF RecName: Full=Recombination protein recR;
   18::195     6e-27  36%  198 aa  RECR_LISMC RecName: Full=Recombination protein recR;
   18::195     6e-27  35%  198 aa  RECR_GEOKA RecName: Full=Recombination protein recR;
   19::204     6e-27  34%  204 aa  RECR_CHLTE RecName: Full=Recombination protein recR;
   18::195     8e-27  37%  200 aa  RECR_MARAV RecName: Full=Recombination protein recR;
   18::195     8e-27  36%  198 aa  RECR_LISIN RecName: Full=Recombination protein recR;
   18::195     8e-27  35%  198 aa  RECR_GEOTN RecName: Full=Recombination protein recR;
   53::229     1e-26  38%  232 aa  RECR_SYNY3 RecName: Full=Recombination protein recR;
   19::195     1e-26  39%  199 aa  RECR_SYNP6 RecName: Full=Recombination protein recR;
   19::195     1e-26  39%  199 aa  RECR_SYNE7 RecName: Full=Recombination protein recR;
   18::198     1e-26  34%  198 aa  RECR_OCEIH RecName: Full=Recombination protein recR;
   18::199     1e-26  34%  199 aa  RECR_NITMU RecName: Full=Recombination protein recR;
   18::195     1e-26  34%  199 aa  RECR_MOOTA RecName: Full=Recombination protein recR;
   19::205     1e-26  36%  205 aa  RECR_CHLPD RecName: Full=Recombination protein recR;
   19::198     1e-26  36%  198 aa  RECR_CLOPS RecName: Full=Recombination protein recR;
   19::198     1e-26  36%  198 aa  RECR_CLOPE RecName: Full=Recombination protein recR;
   19::198     1e-26  36%  198 aa  RECR_CLOP1 RecName: Full=Recombination protein recR;
   19::198     1e-26  36%  198 aa  RECR_CLOK5 RecName: Full=Recombination protein recR;
   19::198     1e-26  36%  198 aa  RECR_CLOK1 RecName: Full=Recombination protein recR;
   24::201     2e-26  36%  204 aa  RECR_HERA2 RecName: Full=Recombination protein recR;
   18::195     2e-26  34%  198 aa  RECR_BREBN RecName: Full=Recombination protein recR;
   17::194     2e-26  37%  198 aa  RECR_TROWT RecName: Full=Recombination protein recR;
   17::194     2e-26  37%  198 aa  RECR_TROW8 RecName: Full=Recombination protein recR;
   17::194     2e-26  37%  199 aa  RECR_FRAAA RecName: Full=Recombination protein recR;
   24::201     2e-26  36%  204 aa  RECR_CHLSY RecName: Full=Recombination protein recR;
   25::202     2e-26  36%  205 aa  RECR_CHLAD RecName: Full=Recombination protein recR;
   24::201     2e-26  36%  204 aa  RECR_CHLAA RecName: Full=Recombination protein recR;
   18::198     2e-26  34%  198 aa  RECR_BACWK RecName: Full=Recombination protein recR;
   17::197     3e-26  34%  198 aa  RECR_XYLFA RecName: Full=Recombination protein recR;
   19::203     3e-26  35%  205 aa  RECR_CHLT3 RecName: Full=Recombination protein recR;
   19::199     3e-26  34%  199 aa  RECR_ALKMQ RecName: Full=Recombination protein recR;
   19::196     4e-26  37%  199 aa  RECR_RUBXD RecName: Full=Recombination protein recR;
   21::196     4e-26  33%  201 aa  RECR_HALHL RecName: Full=Recombination protein recR;
   19::199     4e-26  32%  199 aa  RECR_CLOD6 RecName: Full=Recombination protein recR;
   18::197     5e-26  37%  199 aa  RECR_PSYIN RecName: Full=Recombination protein recR;
   17::194     5e-26  33%  197 aa  RECR_MYXXD RecName: Full=Recombination protein recR;
   18::195     5e-26  34%  198 aa  RECR_BACAN RecName: Full=Recombination protein recR;
   18::195     5e-26  34%  198 aa  RECR_BACAC RecName: Full=Recombination protein recR;
   18::195     5e-26  34%  198 aa  RECR_BACAA RecName: Full=Recombination protein recR;
   18::199     7e-26  35%  201 aa  RECR_LEUCK RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACHK RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACCZ RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACCR RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACCQ RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACC7 RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACC4 RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACC3 RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACC2 RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACC1 RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACC0 RecName: Full=Recombination protein recR;
   18::195     7e-26  34%  198 aa  RECR_BACAH RecName: Full=Recombination protein recR;
   19::196     9e-26  33%  199 aa  RECR_DESOH RecName: Full=Recombination protein recR;
   14::191     9e-26  32%  194 aa  RECR_ANAPZ RecName: Full=Recombination protein recR;
   18::195     9e-26  33%  199 aa  RECR_ALHEH RecName: Full=Recombination protein recR;
   17::194     9e-26  34%  199 aa  RECR_ACIC1 RecName: Full=Recombination protein recR;
   21::205     1e-25  34%  208 aa  RECR_PARD8 RecName: Full=Recombination protein recR;
   18::195     1e-25  33%  198 aa  RECR_HERAR RecName: Full=Recombination protein recR;
   19::195     1e-25  36%  197 aa  RECR_GEOLS RecName: Full=Recombination protein recR;
   19::196     2e-25  34%  199 aa  RECR_THETN RecName: Full=Recombination protein recR;
   18::196     2e-25  37%  199 aa  RECR_SHEPA RecName: Full=Recombination protein recR;
   18::199     2e-25  37%  199 aa  RECR_SHEHH RecName: Full=Recombination protein recR;
   19::198     2e-25  35%  198 aa  RECR_CLOBA RecName: Full=Recombination protein recR;
   18::196     2e-25  34%  199 aa  RECR_BACSK RecName: Full=Recombination protein recR;
   18::195     2e-25  33%  198 aa  RECR_JANMA RecName: Full=Recombination protein recR;
   18::196     2e-25  36%  201 aa  RECR_EDWI9 RecName: Full=Recombination protein recR;
   19::204     2e-25  35%  204 aa  RECR_CHLP8 RecName: Full=Recombination protein recR;
   20::197     2e-25  33%  200 aa  RECR_BIFLI RecName: Full=Recombination protein recR;
   18::196     3e-25  35%  198 aa  RECR_STRTR RecName: Full=Recombination protein recR;
   18::196     3e-25  35%  198 aa  RECR_STRTD RecName: Full=Recombination protein recR;
   18::196     3e-25  35%  198 aa  RECR_STRT2 RecName: Full=Recombination protein recR;
   18::196     3e-25  35%  198 aa  RECR_STRT1 RecName: Full=Recombination protein recR;
   18::196     3e-25  34%  198 aa  RECR_STRSY RecName: Full=Recombination protein recR;
   18::196     3e-25  35%  198 aa  RECR_STRPG RecName: Full=Recombination protein recR;
   17::194     3e-25  36%  199 aa  RECR_NOCSJ RecName: Full=Recombination protein recR;
   19::198     3e-25  33%  199 aa  RECR_DESAH RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOBM RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOBL RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOBK RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOBJ RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOBH RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOB6 RecName: Full=Recombination protein recR;
   19::195     3e-25  35%  198 aa  RECR_CLOB1 RecName: Full=Recombination protein recR;
   18::196     3e-25  37%  200 aa  RECR_VIBCM RecName: Full=Recombination protein recR;
   18::196     3e-25  37%  200 aa  RECR_VIBCH RecName: Full=Recombination protein recR;
   18::196     3e-25  37%  200 aa  RECR_VIBC3 RecName: Full=Recombination protein recR;
   18::196     3e-25  37%  198 aa  RECR_STRE4 RecName: Full=Recombination protein recR;
   18::199     3e-25  36%  202 aa  RECR_PSEHT RecName: Full=Recombination protein recR;
   19::205     3e-25  33%  205 aa  RECR_CHLL2 RecName: Full=Recombination protein recR;
   59::197     5e-25  38%  200 aa  RECR_PHEZH RecName: Full=Recombination protein recR;
   18::199     5e-25  33%  199 aa  RECR_METFK RecName: Full=Recombination protein recR;
   18::199     5e-25  36%  199 aa  RECR_LACS1 RecName: Full=Recombination protein recR;
   18::196     5e-25  34%  199 aa  RECR_EXISA RecName: Full=Recombination protein recR;
   19::196     5e-25  32%  199 aa  RECR_DESAA RecName: Full=Recombination protein recR;
   19::233     6e-25  37%  237 aa  RECR_SALRD RecName: Full=Recombination protein recR;
   25::202     6e-25  33%  205 aa  RECR_ROSS1 RecName: Full=Recombination protein recR;
   18::198     6e-25  36%  200 aa  RECR_PSEU2 RecName: Full=Recombination protein recR;
   18::200     6e-25  36%  201 aa  RECR_ECOL5 RecName: Full=Recombination protein recR;
   13::191     8e-25  37%  194 aa  RECR_VIBHB RecName: Full=Recombination protein recR;
   18::198     8e-25  32%  198 aa  RECR_SYMTH RecName: Full=Recombination protein recR;
   18::196     8e-25  35%  198 aa  RECR_STRU0 RecName: Full=Recombination protein recR;
   18::200     8e-25  35%  201 aa  RECR_SERP5 RecName: Full=Recombination protein recR;
   19::195     8e-25  34%  198 aa  RECR_HALOH RecName: Full=Recombination protein recR;
   19::195     8e-25  35%  198 aa  RECR_CLOPH RecName: Full=Recombination protein recR;
   19::199     8e-25  34%  199 aa  RECR_CLOCE RecName: Full=Recombination protein recR;
   19::202     8e-25  33%  204 aa  RECR_CHLPB RecName: Full=Recombination protein recR;
   20::197     8e-25  33%  200 aa  RECR_BIFA0 RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  200 aa  RECR_TOLAT RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRPZ RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRPM RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRPF RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRPD RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRPC RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRPB RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRP8 RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRP6 RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRP3 RecName: Full=Recombination protein recR;
   18::196     1e-24  35%  198 aa  RECR_STRP1 RecName: Full=Recombination protein recR;
   17::198     1e-24  33%  198 aa  RECR_SACEN RecName: Full=Recombination protein recR;
   22::203     1e-24  33%  204 aa  RECR_POLNS RecName: Full=Recombination protein recR;
   19::196     1e-24  33%  199 aa  RECR_HELMI RecName: Full=Recombination protein recR;
   20::196     1e-24  36%  200 aa  RECR_ACAM1 RecName: Full=Recombination protein recR;
   18::196     1e-24  37%  199 aa  RECR_VIBPA RecName: Full=Recombination protein recR;
   18::198     1e-24  36%  200 aa  RECR_PSEE4 RecName: Full=Recombination protein recR;
   18::198     1e-24  36%  200 aa  RECR_PSE14 RecName: Full=Recombination protein recR;
   18::199     1e-24  37%  201 aa  RECR_PROMH RecName: Full=Recombination protein recR;
   22::203     1e-24  34%  204 aa  RECR_POLSQ RecName: Full=Recombination protein recR;
   18::199     1e-24  34%  201 aa  RECR_LEUMM RecName: Full=Recombination protein recR;
   20::197     1e-24  33%  200 aa  RECR_BIFLO RecName: Full=Recombination protein recR;
   20::197     1e-24  33%  200 aa  RECR_BIFLD RecName: Full=Recombination protein recR;
   18::196     2e-24  37%  199 aa  RECR_VIBSL RecName: Full=Recombination protein recR;
   18::196     2e-24  36%  198 aa  RECR_STRS7 RecName: Full=Recombination protein recR;
   18::196     2e-24  36%  198 aa  RECR_STREM RecName: Full=Recombination protein recR;
   18::193     2e-24  37%  198 aa  RECR_DEIDV RecName: Full=Recombination protein recR;
   19::198     2e-24  34%  198 aa  RECR_CLOBB RecName: Full=Recombination protein recR;
   18::195     2e-24  33%  198 aa  RECR_BURVG RecName: Full=Recombination protein recR;
   18::196     2e-24  34%  198 aa  RECR_STRSV RecName: Full=Recombination protein recR;
   18::199     2e-24  37%  199 aa  RECR_SHEDO RecName: Full=Recombination protein recR;
   18::198     2e-24  36%  200 aa  RECR_PSEPK RecName: Full=Recombination protein recR;
   18::198     2e-24  36%  200 aa  RECR_PSEP1 RecName: Full=Recombination protein recR;
   21::198     2e-24  34%  201 aa  RECR_LEPIN RecName: Full=Recombination protein recR;
   21::198     2e-24  34%  201 aa  RECR_LEPIC RecName: Full=Recombination protein recR;
   18::196     2e-24  35%  201 aa  RECR_IDILO RecName: Full=Recombination protein recR;
   18::195     2e-24  33%  198 aa  RECR_BURS3 RecName: Full=Recombination protein recR;
   18::195     2e-24  33%  198 aa  RECR_BURCJ RecName: Full=Recombination protein recR;
   18::195     2e-24  33%  198 aa  RECR_BURCH RecName: Full=Recombination protein recR;
   18::195     2e-24  33%  198 aa  RECR_BURCC RecName: Full=Recombination protein recR;
   18::195     2e-24  33%  198 aa  RECR_BURCA RecName: Full=Recombination protein recR;
   18::201     2e-24  39%  204 aa  RECR_BDEBA RecName: Full=Recombination protein recR;
   18::197     2e-24  36%  199 aa  RECR_AZOVD RecName: Full=Recombination protein recR;
   18::196     3e-24  34%  198 aa  RECR_STRGC RecName: Full=Recombination protein recR;
   18::199     3e-24  36%  199 aa  RECR_SHEPW RecName: Full=Recombination protein recR;
    5::181     3e-24  36%  185 aa  RECR_ANAVT RecName: Full=Recombination protein recR;
   17::193     3e-24  36%  197 aa  RECR_ANASP RecName: Full=Recombination protein recR;
   18::199     4e-24  36%  201 aa  RECR_PHOLL RecName: Full=Recombination protein recR;
   20::197     4e-24  33%  200 aa  RECR_BURP1 RecName: Full=Recombination protein recR;
   20::197     4e-24  33%  200 aa  RECR_BURMS RecName: Full=Recombination protein recR;
   20::197     4e-24  33%  200 aa  RECR_BURMA RecName: Full=Recombination protein recR;
   20::197     4e-24  33%  200 aa  RECR_BURM9 RecName: Full=Recombination protein recR;
   20::197     4e-24  33%  200 aa  RECR_BURM7 RecName: Full=Recombination protein recR;
   18::195     4e-24  33%  198 aa  RECR_BURCM RecName: Full=Recombination protein recR;
   18::195     4e-24  33%  198 aa  RECR_BURA4 RecName: Full=Recombination protein recR;
   16::196     5e-24  33%  197 aa  RECR_XANCP RecName: Full=Recombination protein recR;
   16::196     5e-24  33%  197 aa  RECR_XANC8 RecName: Full=Recombination protein recR;
   18::197     5e-24  36%  199 aa  RECR_STRMU RecName: Full=Recombination protein recR;
   18::196     5e-24  36%  199 aa  RECR_SHEFN RecName: Full=Recombination protein recR;
   18::198     5e-24  36%  200 aa  RECR_PSESM RecName: Full=Recombination protein recR;
   19::200     5e-24  34%  200 aa  RECR_PELTS RecName: Full=Recombination protein recR;
   21::202     5e-24  32%  206 aa  RECR_NEIMF RecName: Full=Recombination protein recR;
   21::202     5e-24  32%  206 aa  RECR_NEIMB RecName: Full=Recombination protein recR;
   17::194     5e-24  35%  197 aa  RECR_LEPBL RecName: Full=Recombination protein recR;
   17::194     5e-24  35%  197 aa  RECR_LEPBJ RecName: Full=Recombination protein recR;
   18::196     5e-24  36%  201 aa  RECR_KLEP7 RecName: Full=Recombination protein recR;
   18::196     5e-24  33%  199 aa  RECR_EXIS2 RecName: Full=Recombination protein recR;
   20::197     5e-24  33%  200 aa  RECR_BURPS RecName: Full=Recombination protein recR;
   20::197     5e-24  33%  200 aa  RECR_BURP6 RecName: Full=Recombination protein recR;
   20::197     5e-24  33%  200 aa  RECR_BURP0 RecName: Full=Recombination protein recR;
   17::194     5e-24  32%  197 aa  RECR_AZOSE RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_SHISS RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_SHIFL RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_SHIF8 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_SHIB3 RecName: Full=Recombination protein recR;
   18::196     7e-24  36%  199 aa  RECR_SHELP RecName: Full=Recombination protein recR;
   18::198     7e-24  35%  200 aa  RECR_PSEF5 RecName: Full=Recombination protein recR;
   19::204     7e-24  33%  204 aa  RECR_PELLD RecName: Full=Recombination protein recR;
   18::197     7e-24  35%  199 aa  RECR_PEDPA RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ESCF3 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOUT RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOSM RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOSE RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOLU RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOLI RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOLC RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOL6 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOK1 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOHS RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECODH RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECOBW RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO8A RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO81 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO7I RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO5E RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO57 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO55 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO45 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO27 RecName: Full=Recombination protein recR;
   18::200     7e-24  35%  201 aa  RECR_ECO24 RecName: Full=Recombination protein recR;
   17::194     7e-24  33%  199 aa  RECR_DECAR RecName: Full=Recombination protein recR;
   19::202     7e-24  32%  204 aa  RECR_CHLCH RecName: Full=Recombination protein recR;
   18::198     7e-24  32%  198 aa  RECR_BURP8 RecName: Full=Recombination protein recR;
   18::195     7e-24  33%  198 aa  RECR_BURM1 RecName: Full=Recombination protein recR;
   16::196     9e-24  33%  197 aa  RECR_XANAC RecName: Full=Recombination protein recR;
   16::193     9e-24  33%  201 aa  RECR_TREPA RecName: Full=Recombination protein recR;
   18::196     9e-24  35%  198 aa  RECR_STRA5 RecName: Full=Recombination protein recR;
   18::196     9e-24  35%  198 aa  RECR_STRA3 RecName: Full=Recombination protein recR;
   18::196     9e-24  35%  198 aa  RECR_STRA1 RecName: Full=Recombination protein recR;
   18::200     9e-24  36%  201 aa  RECR_SODGM RecName: Full=Recombination protein recR;
   18::198     9e-24  35%  200 aa  RECR_PSEPG RecName: Full=Recombination protein recR;
   18::198     9e-24  36%  200 aa  RECR_PSEFS RecName: Full=Recombination protein recR;
   20::201     9e-24  32%  205 aa  RECR_NEIMA RecName: Full=Recombination protein recR;
   20::201     9e-24  32%  205 aa  RECR_NEIM0 RecName: Full=Recombination protein recR;
   20::204     9e-24  33%  204 aa  RECR_CUPTR RecName: Full=Recombination protein recR;
   20::197     9e-24  33%  200 aa  RECR_BURTA RecName: Full=Recombination protein recR;
   21::199     9e-24  35%  205 aa  RECR_BACV8 RecName: Full=Recombination protein recR;
   18::196     1e-23  34%  198 aa  RECR_STRPI RecName: Full=Recombination protein recR;
   18::200     1e-23  34%  201 aa  RECR_CITK8 RecName: Full=Recombination protein recR;
   18::195     1e-23  33%  198 aa  RECR_BURPP RecName: Full=Recombination protein recR;
   18::196     1e-23  35%  200 aa  RECR_VIBVY RecName: Full=Recombination protein recR;
   18::196     1e-23  35%  200 aa  RECR_VIBVU RecName: Full=Recombination protein recR;
   19::204     1e-23  32%  204 aa  RECR_PROA2 RecName: Full=Recombination protein recR;
   18::196     1e-23  36%  201 aa  RECR_KLEP3 RecName: Full=Recombination protein recR;
   18::195     1e-23  32%  198 aa  RECR_BURXL RecName: Full=Recombination protein recR;
   22::199     1e-23  32%  202 aa  RECR_BORPE RecName: Full=Recombination protein recR;
   22::199     1e-23  33%  202 aa  RECR_BORPD RecName: Full=Recombination protein recR;
   16::196     2e-23  32%  197 aa  RECR_XANOR RecName: Full=Recombination protein recR;
   16::196     2e-23  32%  197 aa  RECR_XANOM RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  200 aa  RECR_VIBFM RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  200 aa  RECR_VIBF1 RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  202 aa  RECR_PHOPR RecName: Full=Recombination protein recR;
   18::198     2e-23  34%  198 aa  RECR_LACLM RecName: Full=Recombination protein recR;
   18::197     2e-23  33%  199 aa  RECR_LACF3 RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  198 aa  RECR_STRZJ RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  198 aa  RECR_STRPJ RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  198 aa  RECR_STRP7 RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALTY RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALTI RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALSV RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALPK RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALPC RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALPB RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALPA RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALNS RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALHS RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALG2 RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALEP RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALDC RecName: Full=Recombination protein recR;
   18::196     2e-23  34%  201 aa  RECR_SALA4 RecName: Full=Recombination protein recR;
   18::198     2e-23  34%  200 aa  RECR_PSEPW RecName: Full=Recombination protein recR;
   18::206     2e-23  40%  206 aa  RECR_PHYMT RecName: Full=Recombination protein recR;
   18::196     2e-23  33%  200 aa  RECR_PASMU RecName: Full=Recombination protein recR;
   18::195     2e-23  33%  196 aa  RECR_METPP RecName: Full=Recombination protein recR;
   18::200     2e-23  32%  203 aa  RECR_LARHH RecName: Full=Recombination protein recR;
   18::198     2e-23  33%  198 aa  RECR_LACSS RecName: Full=Recombination protein recR;
   19::198     2e-23  31%  200 aa  RECR_LACRJ RecName: Full=Recombination protein recR;
   19::198     2e-23  31%  200 aa  RECR_LACRD RecName: Full=Recombination protein recR;
   18::198     2e-23  34%  198 aa  RECR_LACLS RecName: Full=Recombination protein recR;
   21::198     2e-23  33%  198 aa  RECR_DESHY RecName: Full=Recombination protein recR;
   18::193     2e-23  35%  222 aa  RECR_DEIGD RecName: Full=Recombination protein recR;
   22::199     2e-23  32%  202 aa  RECR_BORA1 RecName: Full=Recombination protein recR;
   15::192     3e-23  34%  195 aa  RECR_TREDE RecName: Full=Recombination protein recR;
   20::200     3e-23  35%  202 aa  RECR_THEEB RecName: Full=Recombination protein recR;
   18::196     3e-23  34%  201 aa  RECR_SALCH RecName: Full=Recombination protein recR;
   17::199     3e-23  34%  202 aa  RECR_RHOSR RecName: Full=Recombination protein recR;
   18::198     3e-23  34%  200 aa  RECR_PSEPF RecName: Full=Recombination protein recR;
   19::196     3e-23  32%  199 aa  RECR_ACIBL RecName: Full=Recombination protein recR;
   19::200     4e-23  31%  203 aa  RECR_SYNAS RecName: Full=Recombination protein recR;
   19::200     4e-23  34%  201 aa  RECR_SHIDS RecName: Full=Recombination protein recR;
   19::200     4e-23  34%  201 aa  RECR_SHIBS RecName: Full=Recombination protein recR;
   18::201     4e-23  34%  201 aa  RECR_OENOB RecName: Full=Recombination protein recR;
   18::198     4e-23  33%  198 aa  RECR_LACLA RecName: Full=Recombination protein recR;
   18::200     4e-23  34%  201 aa  RECR_ERWT9 RecName: Full=Recombination protein recR;
   18::191     6e-23  35%  194 aa  RECR_THET8 RecName: Full=Recombination protein recR;
   18::196     6e-23  34%  201 aa  RECR_ENT38 RecName: Full=Recombination protein recR;
   18::193     6e-23  35%  220 aa  RECR_DEIRA RecName: Full=Recombination protein recR;
   20::201     6e-23  36%  205 aa  RECR_CYAP4 RecName: Full=Recombination protein recR;
   22::199     6e-23  32%  202 aa  RECR_BORPA RecName: Full=Recombination protein recR;
   22::199     6e-23  32%  202 aa  RECR_BORBR RecName: Full=Recombination protein recR;
   18::197     7e-23  35%  198 aa  RECR_PSEAE RecName: Full=Recombination protein recR;
   18::197     7e-23  35%  198 aa  RECR_PSEA8 RecName: Full=Recombination protein recR;
   18::199     7e-23  33%  200 aa  RECR_PSEA6 RecName: Full=Recombination protein recR;
   18::196     7e-23  32%  198 aa  RECR_PARUW RecName: Full=Recombination protein recR;
   18::202     7e-23  34%  202 aa  RECR_HAMD5 RecName: Full=Recombination protein recR;
   18::195     7e-23  33%  199 aa  RECR_CARHZ RecName: Full=Recombination protein recR;
   18::195     7e-23  31%  198 aa  RECR_ANADE RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRZT RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRZP RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRR6 RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRPS RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRPN RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRP4 RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  198 aa  RECR_STRP2 RecName: Full=Recombination protein recR;
   18::196     9e-23  34%  201 aa  RECR_SALAR RecName: Full=Recombination protein recR;
   20::201     9e-23  33%  204 aa  RECR_RALME RecName: Full=Recombination protein recR;
   20::204     9e-23  32%  204 aa  RECR_RALEJ RecName: Full=Recombination protein recR;
   18::197     9e-23  35%  198 aa  RECR_PSEAB RecName: Full=Recombination protein recR;
   18::197     9e-23  35%  198 aa  RECR_PSEA7 RecName: Full=Recombination protein recR;
   18::196     9e-23  35%  201 aa  RECR_PECCP RecName: Full=Recombination protein recR;
   18::197     9e-23  34%  199 aa  RECR_LACCB RecName: Full=Recombination protein recR;
   18::197     9e-23  34%  199 aa  RECR_LACC3 RecName: Full=Recombination protein recR;
   18::197     9e-23  34%  199 aa  RECR_LACBA RecName: Full=Recombination protein recR;
   21::198     9e-23  32%  198 aa  RECR_DESHD RecName: Full=Recombination protein recR;
   18::196     9e-23  33%  200 aa  RECR_ACTSZ RecName: Full=Recombination protein recR;
   18::196     1e-22  35%  199 aa  RECR_SHEAM RecName: Full=Recombination protein recR;
   19::196     1e-22  32%  199 aa  RECR_RHOBA RecName: Full=Recombination protein recR;
   17::199     1e-22  34%  203 aa  RECR_MYCLE RecName: Full=Recombination protein recR;
   18::199     1e-22  34%  200 aa  RECR_HAEIN RecName: Full=Recombination protein recR;
   18::199     1e-22  34%  200 aa  RECR_HAEIG RecName: Full=Recombination protein recR;
   18::199     1e-22  34%  200 aa  RECR_HAEIE RecName: Full=Recombination protein recR;
   18::199     1e-22  34%  200 aa  RECR_HAEI8 RecName: Full=Recombination protein recR;
   19::198     1e-22  32%  198 aa  RECR_CLOAB RecName: Full=Recombination protein recR;
   17::194     1e-22  32%  199 aa  RECR_ARTAT RecName: Full=Recombination protein recR;
   18::194     1e-22  35%  199 aa  RECR_ACIF5 RecName: Full=Recombination protein recR;
   18::194     1e-22  35%  199 aa  RECR_ACIF2 RecName: Full=Recombination protein recR;
   19::194     2e-22  33%  197 aa  RECR_PELPD RecName: Full=Recombination protein recR;
   17::202     2e-22  33%  202 aa  RECR_NOCFA RecName: Full=Recombination protein recR;
   17::199     2e-22  33%  203 aa  RECR_MYCTU RecName: Full=Recombination protein recR;
   17::199     2e-22  33%  203 aa  RECR_MYCTA RecName: Full=Recombination protein recR;
   17::199     2e-22  33%  203 aa  RECR_MYCS2 RecName: Full=Recombination protein recR;
   17::199     2e-22  33%  203 aa  RECR_MYCBP RecName: Full=Recombination protein recR;
   17::199     2e-22  33%  203 aa  RECR_MYCBO RecName: Full=Recombination protein recR;
   18::199     2e-22  33%  201 aa  RECR_HAEPS RecName: Full=Recombination protein recR;
   18::200     2e-22  35%  201 aa  RECR_YERE8 RecName: Full=Recombination protein recR;
   17::190     2e-22  32%  191 aa  RECR_MYCPU RecName: Full=Recombination protein recR;
   18::196     2e-22  33%  199 aa  RECR_LACPL RecName: Full=Recombination protein recR;
   19::202     2e-22  33%  202 aa  RECR_FINM2 RecName: Full=Recombination protein recR;
   18::196     3e-22  36%  199 aa  RECR_SHESR RecName: Full=Recombination protein recR;
   18::196     3e-22  36%  199 aa  RECR_SHESM RecName: Full=Recombination protein recR;
   18::196     3e-22  36%  199 aa  RECR_SHESA RecName: Full=Recombination protein recR;
   18::197     3e-22  33%  199 aa  RECR_PSEU5 RecName: Full=Recombination protein recR;
   18::197     3e-22  33%  199 aa  RECR_PSEMY RecName: Full=Recombination protein recR;
   18::207     3e-22  36%  208 aa  RECR_POLSJ RecName: Full=Recombination protein recR;
   17::199     3e-22  34%  203 aa  RECR_MYCPA RecName: Full=Recombination protein recR;
   17::199     3e-22  34%  203 aa  RECR_MYCA1 RecName: Full=Recombination protein recR;
   19::195     3e-22  32%  197 aa  RECR_GEOBB RecName: Full=Recombination protein recR;
   18::196     3e-22  34%  201 aa  RECR_ENTS8 RecName: Full=Recombination protein recR;
   18::199     3e-22  32%  201 aa  RECR_ACTP2 RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERPS RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERPP RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERPN RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERPG RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERPE RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERPA RecName: Full=Recombination protein recR;
   18::200     4e-22  35%  201 aa  RECR_YERP3 RecName: Full=Recombination protein recR;
   18::191     4e-22  34%  194 aa  RECR_THET2 RecName: Full=Recombination protein recR;
   18::196     5e-22  36%  199 aa  RECR_SHESW RecName: Full=Recombination protein recR;
   18::196     5e-22  36%  199 aa  RECR_SHEPC RecName: Full=Recombination protein recR;
   18::195     5e-22  32%  196 aa  RECR_RHOFD RecName: Full=Recombination protein recR;
   18::207     5e-22  35%  208 aa  RECR_POLNA RecName: Full=Recombination protein recR;
   18::197     5e-22  33%  199 aa  RECR_LACAC RecName: Full=Recombination protein recR;
   18::196     6e-22  35%  199 aa  RECR_SHEWM RecName: Full=Recombination protein recR;
   18::199     6e-22  32%  199 aa  RECR_LACH4 RecName: Full=Recombination protein recR;
   17::197     6e-22  32%  197 aa  RECR_GLOVI RecName: Full=Recombination protein recR;
   19::195     6e-22  32%  197 aa  RECR_GEOSM RecName: Full=Recombination protein recR;
   18::196     6e-22  34%  201 aa  RECR_ERWCT RecName: Full=Recombination protein recR;
   19::197     6e-22  32%  200 aa  RECR_CHLPN RecName: Full=Recombination protein recR;
   18::196     8e-22  35%  199 aa  RECR_SHEON RecName: Full=Recombination protein recR;
   18::196     8e-22  36%  199 aa  RECR_SHEB9 RecName: Full=Recombination protein recR;
   18::196     8e-22  36%  199 aa  RECR_SHEB8 RecName: Full=Recombination protein recR;
   18::196     8e-22  36%  199 aa  RECR_SHEB5 RecName: Full=Recombination protein recR;
   18::196     8e-22  36%  199 aa  RECR_SHEB2 RecName: Full=Recombination protein recR;
   19::202     8e-22  32%  204 aa  RECR_PELPB RecName: Full=Recombination protein recR;
   19::195     8e-22  33%  197 aa  RECR_GEOSF RecName: Full=Recombination protein recR;
   18::196     8e-22  34%  200 aa  RECR_AERS4 RecName: Full=Recombination protein recR;
   19::196     8e-22  31%  199 aa  RECR_ACIC5 RecName: Full=Recombination protein recR;
   19::202     1e-21  31%  204 aa  RECR_PROVI RecName: Full=Recombination protein recR;
   17::199     1e-21  35%  203 aa  RECR_MYCUA RecName: Full=Recombination protein recR;
   18::195     1e-21  32%  196 aa  RECR_ACISJ RecName: Full=Recombination protein recR;
   21::198     1e-21  31%  199 aa  RECR_ACIAC RecName: Full=Recombination protein recR;
   19::196     1e-21  29%  199 aa  RECR_SOLUE RecName: Full=Recombination protein recR;
   18::199     1e-21  32%  199 aa  RECR_LACJO RecName: Full=Recombination protein recR;
   18::198     1e-21  29%  198 aa  RECR_CHRVO RecName: Full=Recombination protein recR;
   19::196     2e-21  30%  199 aa  RECR_PELCD RecName: Full=Recombination protein recR;
   20::197     2e-21  32%  201 aa  RECR_HAHCH RecName: Full=Recombination protein recR;
   18::200     2e-21  33%  201 aa  RECR_HAES2 RecName: Full=Recombination protein recR;
   18::199     2e-21  34%  199 aa  RECR_SHESH RecName: Full=Recombination protein recR;
   18::200     2e-21  32%  201 aa  RECR_HAES1 RecName: Full=Recombination protein recR;
   19::195     2e-21  34%  201 aa  RECR_DICNV RecName: Full=Recombination protein recR;
   18::195     3e-21  31%  196 aa  RECR_VEREI RecName: Full=Recombination protein recR;
   18::199     3e-21  32%  199 aa  RECR_LACGA RecName: Full=Recombination protein recR;
   17::191     4e-21  33%  203 aa  RECR_MYCSS RecName: Full=Recombination protein recR;
   17::191     4e-21  33%  203 aa  RECR_MYCSK RecName: Full=Recombination protein recR;
   17::191     4e-21  33%  203 aa  RECR_MYCSJ RecName: Full=Recombination protein recR;
   21::201     4e-21  31%  201 aa  RECR_FRAP2 RecName: Full=Recombination protein recR;
   18::195     4e-21  30%  198 aa  RECR_DESAP RecName: Full=Recombination protein recR;
   17::196     5e-21  34%  199 aa  RECR_SYNJA RecName: Full=Recombination protein recR;
   17::191     5e-21  33%  203 aa  RECR_MYCVP RecName: Full=Recombination protein recR;
   18::195     7e-21  31%  198 aa  RECR_UNCTG RecName: Full=Recombination protein recR;
   19::195     7e-21  32%  197 aa  RECR_GEOUR RecName: Full=Recombination protein recR;
   19::197     7e-21  29%  200 aa  RECR_CHLFF RecName: Full=Recombination protein recR;
   19::197     7e-21  30%  200 aa  RECR_CHLCV RecName: Full=Recombination protein recR;
   18::196     9e-21  32%  201 aa  RECR_COLP3 RecName: Full=Recombination protein recR;
   18::199     1e-20  32%  200 aa  RECR_MANSM RecName: Full=Recombination protein recR;
   17::196     2e-20  33%  199 aa  RECR_SYNJB RecName: Full=Recombination protein recR;
   19::195     2e-20  30%  197 aa  RECR_GEOSL RecName: Full=Recombination protein recR;
   16::196     3e-20  31%  197 aa  RECR_XANC5 RecName: Full=Recombination protein recR;
   23::204     3e-20  32%  207 aa  RECR_RALSO RecName: Full=Recombination protein recR;
   19::197     3e-20  29%  200 aa  RECR_CHLAB RecName: Full=Recombination protein recR;
   19::195     3e-20  30%  197 aa  RECR_GEOMG RecName: Full=Recombination protein recR;
   18::197     4e-20  34%  199 aa  RECR_LACDB RecName: Full=Recombination protein recR;
   18::197     4e-20  34%  199 aa  RECR_LACDA RecName: Full=Recombination protein recR;
   17::215     4e-20  34%  218 aa  RECR_COREF RecName: Full=Recombination protein recR;
   19::197     4e-20  31%  200 aa  RECR_CHLTR RecName: Full=Recombination protein recR;
   19::197     4e-20  31%  200 aa  RECR_CHLTA RecName: Full=Recombination protein recR;
   19::196     6e-20  31%  199 aa  RECR_AZOSB RecName: Full=Recombination protein recR;
   18::196     6e-20  33%  200 aa  RECR_AERHH RecName: Full=Recombination protein recR;
   19::197     1e-19  31%  200 aa  RECR_CHLTB RecName: Full=Recombination protein recR;
   19::197     1e-19  31%  200 aa  RECR_CHLT2 RecName: Full=Recombination protein recR;
   18::196     2e-19  31%  200 aa  RECR_ALISL RecName: Full=Recombination protein recR;
   17::197     2e-19  30%  197 aa  RECR_THIDA RecName: Full=Recombination protein recR;
   17::215     4e-19  33%  218 aa  RECR_CORDI RecName: Full=Recombination protein recR;
   19::197     8e-19  31%  200 aa  RECR_CHLMU RecName: Full=Recombination protein recR;
   18::200     1e-18  30%  201 aa  RECR_UREU1 RecName: Full=Recombination protein recR;
   17::218     1e-18  33%  218 aa  RECR_CORGL RecName: Full=Recombination protein recR;
   18::198     2e-18  29%  198 aa  RECR_ENTFA RecName: Full=Recombination protein recR;
   17::218     2e-18  33%  218 aa  RECR_CORGB RecName: Full=Recombination protein recR;
   18::200     3e-18  30%  201 aa  RECR_UREPA RecName: Full=Recombination protein recR;
   18::200     3e-18  30%  201 aa  RECR_UREP2 RecName: Full=Recombination protein recR;
   19::198     3e-18  29%  201 aa  RECR_DESVM RecName: Full=Recombination protein recR;
   18::195     5e-18  28%  198 aa  RECR_ANADF RecName: Full=Recombination protein recR;
   18::195     5e-18  28%  200 aa  RECR_ALCBS RecName: Full=Recombination protein recR;
   21::198     9e-18  29%  201 aa  RECR_SYNFM RecName: Full=Recombination protein recR;
   18::194     1e-17  28%  197 aa  RECR_SYNWW RecName: Full=Recombination protein recR;
   70::210     3e-17  36%  211 aa  RECR_AQUAE RecName: Full=Recombination protein recR;
   17::169     6e-17  30%  174 aa  RECR_HAEDU RecName: Full=Recombination protein recR;
   20::201     1e-16  27%  205 aa  RECR_NEIG1 RecName: Full=Recombination protein recR;
   19::190     1e-16  26%  190 aa  RECR_NITSB RecName: Full=Recombination protein recR;
   21::202     2e-16  27%  206 aa  RECR_NEIG2 RecName: Full=Recombination protein recR;
   22::190     2e-16  28%  193 aa  RECR_HELPH RecName: Full=Recombination protein recR;
   17::250     2e-16  34%  250 aa  RECR_CORJK RecName: Full=Recombination protein recR;
   22::190     3e-16  28%  193 aa  RECR_HELPY RecName: Full=Recombination protein recR;
   22::190     3e-16  28%  193 aa  RECR_HELPG RecName: Full=Recombination protein recR;
   22::190     3e-16  28%  193 aa  RECR_HELP2 RecName: Full=Recombination protein recR;
   19::198     7e-16  27%  201 aa  RECR_DESAD RecName: Full=Recombination protein recR;
   22::190     3e-15  28%  193 aa  RECR_HELPJ RecName: Full=Recombination protein recR;
   42::158     3e-15  32%  198 aa  RECR_GLUOX RecName: Full=Recombination protein recR;
   19::190     3e-14  29%  190 aa  RECR_CAMJD RecName: Full=Recombination protein recR;
   22::190     8e-14  27%  193 aa  RECR_HELPS RecName: Full=Recombination protein recR;
   19::190     1e-13  28%  190 aa  RECR_CAMJJ RecName: Full=Recombination protein recR;
   19::190     1e-13  28%  190 aa  RECR_CAMJE RecName: Full=Recombination protein recR;
   19::190     2e-13  28%  190 aa  RECR_CAMJR RecName: Full=Recombination protein recR;
   19::190     4e-13  28%  190 aa  RECR_CAMJ8 RecName: Full=Recombination protein recR;
   22::190     4e-08  23%  193 aa  RECR_HELAH RecName: Full=Recombination protein recR;
    1::203

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGC
RECR_PELUB      -----------------PGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGC
RECR_JANSC      -----------------PGLGPRSARRAVLTLIKKRGALMRPLAETMARVAESARECVNCGNIGTGDL-C
RECR_MARMM      -----------------PGLGPRSARRAALNLLGKKDALMRPLAEALADAADKIRACSECGNMDVSD-PC
RECR_SILST      -----------------PGLGPRSARRAVLHLIRKRALVLTPLADAMSRVAETARECLNCGNVGTSDI-C
RECR_SILPO      -----------------PGLGPRSARRAVLHLIRKRALLLTPLADLMGQVAATARECLNCGNVGTSDI-C
RECR_NOVAD      -----------------PGLGPRSARRAVLWLIKRRETALPQLLNALTQVQELLVECGVCGNVDTSN-PC
RECR_BEII9      -----------------PGLGPRSARRAALHLIRKRTELLGPLAEALQQAYNHLIPCQICGNIDTRD-PC
RECR_RHOS5      -----------------PGLGPRSARRAVLVMLKKRGAVMAPLAQAMAEVAATARDCARCGNITSADL-C
RECR_ROSDO      -----------------PGLGPRSARRTVLHLIRKRSLLLIPLADTLQTVAETARECLNCGNVGTTDV-C
RECR_METRJ      -----------------PGLGPRSARRAALQLIKKRDTLLGPLADAMRVAADRIVVCTSCGNVDTSD-PC
RECR_RHOSK      -----------------PGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVRCGNITNADL-C
RECR_RHOS4      -----------------PGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVRCGNITNADL-C
RECR_RHOS1      -----------------PGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVRCGNITNADL-C
RECR_ZYMMO      -----------------PGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECGNIDSCN-PC
RECR_PARDP      -----------------PGLGPRSARRIVLHLIRRRTGQMAQLAGLMANVAEHARECLVCGNVTGSDI-C
RECR_NEOSM      -----------------PGLGPKSARRIVLHLLKSRETTLIRFIDTMQLLYETIKHCELCGNLESES-PC
RECR_SPHWW      -----------------PGLGPRSARRAVLHLLKKREAALGPLLRALEAVNDKLTSCHVCGNVDTGD-PC
RECR_ORITI      -----------------PGLGNRSARRIVLYLMQDKEVRIKNLNNQLTSVLNNIMECDYCGNLDIVSI-C
RECR_METEP      -----------------PGLGPRSARRAALQLIKKRETLLAPLADAMRVAAERIVVCRSCGNVDTSD-PC
RECR_METC4      -----------------PGLGPRSARRAALQLIKKRETLLAPLADAMRVAAERIVVCRSCGNVDTSD-PC
RECR_ERYLH      -----------------PGLGPRSARRAVLWLVKKRDTALPALLEALEGVQDRLVECDTCGNVDTQN-PC
RECR_SPHAL      -----------------PGLGPRSARRAVLHLMKKRESAFAPLLAALQTVSERLVTCTTCGNIDTHD-PC
RECR_RICBR      -----------------PGLGSRSARRIVLYLLQDKDVRLKTLINNLTEIDKKIVKCQVCGNMDTENI-C
RECR_RICB8      -----------------PGLGSRSARRIVLYLLQDKDVRLKTLINNLTEIDKKIVKCQVCGNMDTENI-C
RECR_METSB      -----------------PGLGPRSARRAALHLIRKREELFGPLAEAMRVARDTIVSCSVCGNVDSCD-PC
RECR_RICAH      -----------------PGLGSRSARRIVLYLLQDKDVRLKSLINNLVEIDKKIVKCKICGNMDTESI-C
RECR_RHIME      -----------------PGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKICSCCGNVDTID-PC
RECR_ORITB      -----------------PGLGNRSARRIVLYLMQDKEVRIKNLNNQLTSVLNNIMECDYCGNLDVVSI-C
RECR_METPB      -----------------PGLGPRSARRAALQLIKKRETLLAPLADAMRIAADRIVVCHACGNVDTSD-PC
RECR_DINSH      -----------------PGLGPRSARRAVLFLLGKNRRLLAPLGEAMTAVAQTARDCLNCGNIGTSDI-C
RECR_RICFE      -----------------PGLGSRSARRIVLYLLQDKDVRLKSLINNLVEIDKKIVKCEICGNMDTENICC
RECR_RHIL3      -----------------PGLGPRSARRAALHLIKKKDQLLGPLSHAMGEAYDKVKICSRCGNVDTVD-PC
RECR_AGRVS      -----------------PGLGPRSARRAALHLIKKREQLMGPLALAMGEAHAKVKICSCCGNVDTID-PC
RECR_METNO      -----------------PGLGPRSARRAALQLIKKREALLAPLAEAMRVACERIVVCHECGNVDTSD-PC
RECR_MESSB      -----------------PGLGPRSARRAALHLIKKKEQLFSPLTTAMAEALAKVRVCSVCGNVDTSD-PC
RECR_METS4      -----------------PGLGPRSARRAALQLIKKRDTLLGPLAEAMRVASERIVTCRECGNVDTCD-PC
RECR_RICM5      -----------------PGLGSRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCKICGNIDTENI-C
RECR_RHIEC      -----------------PGLGPRSARRAALHLIKKKDQLLGPLSNAMGEAYDKVKICSRCGNXXXXXXXX
RECR_XANP2      -----------------PGLGPRSARRVALHLIKKREALMAPLAAAMTDALGKIVECRRCGNVDVCD-PC
RECR_RICRS      -----------------PGLGIRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCEICGNMDTENI-C
RECR_RICRO      -----------------PGLGIRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCEICGNMDTENI-C
RECR_RICPU      -----------------PGLGIRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCEICGNMDTENI-C
RECR_RICAE      -----------------PGLGIRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCEICGNMDTENM-C
RECR_RHILO      -----------------PGLGPRSARRAALHLIKKKEQLLSPLAAAMSEAADKVRICSTCGNVDTAD-PC
RECR_PARL1      -----------------PGLGPRSARRAVLQLIKKKETLLGPLXXXXXXXXXXXRICSACGNVDTQD-PC
RECR_BARBK      -----------------PGLGPRSARRAALHLIKKKEALLEPLGTAIRDAVDKVRICSVCGNIDTTD-PC
RECR_RICCN      -----------------PGLGIRSARRIALYLLQDKDIRLKSLINNLVEIDKKIVKCEICGNMDTENM-C
RECR_OLICO      -----------------PGLGPRSARRAALHLIKKREALMAPLASALQVAIERIQVCHTCGNIDTQN-PC
RECR_BARQU      -----------------PGFGPRSARRAALYLIKKKETLLEPLGAAIQAAVDKVCICSVCGNVDTTD-PC
RECR_CAUCR      -----------------PGLGPRSGRRAALALLKKRDTLLAPLATAMAEAQAKVRTCGTCGSLDVTD-PC
RECR_CAUCN      -----------------PGLGPRSGRRAALALLKKRDTLLAPLATAMAEAQAKVRTCGTCGSLDVTD-PC
RECR_BART1      -----------------PGLGPRSARRAALHLIKKKETLLEPLGAAVQAAIEKVGICSVCGNVDTID-PC
RECR_SINMW      -----------------PGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKICSCCGNVDTID-PC
RECR_RICPR      -----------------PGLGIRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEICGNLDTKSI-C
RECR_HYPNA      -----------------PGLGPRSARRVALHLLKRNDTXXXXXXXXXXXXXXXIQKCATCGNFDTVQ-PC
RECR_BARHE      -----------------PGLGPRSARRAALHLIKKKETLLEPLGAAIQAAVQKVCICSVCGNVDTID-PC
RECR_RICTY      -----------------PGLGIRSARRIVLYLLQDKDVRLKSLINHLIELDKKIVKCEICGNMDTKNI-C
RECR_EHRCR      -----------------PSFGPSSSRRIVLHLLRNKEEIMLPLASGIQDLAFQAKECPVCFNIDVKS-PC
RECR_AGRT5      -----------------PGLGPRSARRAALHLIKKKEQLLGPLGHAMGEAYDKVKICSCCGNVDTID-PC
RECR_AGRRK      -----------------PGLGPRSARRAALHLIKKKDQLLGPLSHAMGEAYDKVKICSRCGNVDTVD-PC
RECR_MAGSA      -----------------PGLGPRSARRAALRLVEKRESLLVPLXXXXXXXXXRVRTCSVCGNFDTID-PC
RECR_ACICJ      -----------------PGLGPRSARRIVLRLMAEREQRLLPLIAALDAACQRVAVCPVCGGLDSQQ-PC
RECR_EHRCJ      -----------------PNFGPSSSRRIVLHLLRNKEEVMLPLASGIQDLAFQTKECSVCFNIDVKS-PC
RECR_OCHA4      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_CAUSK      -----------------PGLGPRSGRRAALALLKKRDTLLAPLTAALVDAQAKVRTCSVCGSLDTSD-PC
RECR_BRASO      -----------------PGLGPRSARRAALHLIKKREALMVPLASALQVAIDRIQVCKTCGNIDTQS-PC
RECR_BRASB      -----------------PGLGPRSARRAALHLIKKREALMVPLASAMQVAIERIQVCKTCGNIDTQS-PC
RECR_SACD2      -----------------PGVGPKSAQRMALHLLERDREGAQNLSEVLAKAVEHVHRCQQCRTLTEQAL-C
RECR_RHOPT      -----------------PGLGPRSARRAALHLIKKRDALMAPLASALQVAIDKIEVCSTCGNIDSQN-PC
RECR_RHOPA      -----------------PGLGPRSARRAALHLIKKRDALMAPLASALQVAIDKIEVCSTCGNIDSQN-PC
RECR_NITWN      -----------------PGLGPRSARRAALHLIKKREALMAPLASALQVAIDRIRVCETCGNIDTRS-PC
RECR_BRUME      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUMB      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUSU      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUSI      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUO2      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUC2      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUAB      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_BRUA2      -----------------PGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSD-PC
RECR_WOLPM      ----------------------------VIHLLQNKEKVMLPLASLIKELADLIIECEVCGNLDTKS-PC
RECR_RHOPS      -----------------PGLGPRSARRAALHLIKKRDALMTPLASALQVAIDKIEVCKSCGNIDTRN-PC
RECR_NITHX      -----------------PGLGPRSARRAALHLIKKREALMTPLASALQVAIDRIQICEICGNIDTRS-PC
RECR_DEHE1      -----------------PGIGPKSAQRLAFYLMRAPEEQVLTLSDTIRSIKNQISQCRICFNVADSEL-C
RECR_RHIE6      -----------------PGLGPRSARRAALHLIKKKDQLLGPLSNAMGEAYDKVKICSRCGNVDTVD-PC
RECR_PSYCK      -----------------PGVGQKSAQRMALHLLTKKRPQGMALAQALDEAMRDIVECQRCHSFSDEAV-C
RECR_DEHSC      -----------------PGIGPKSAQRLAFYLMRAPEDQVISLSDTIRNIKNQISQCRICCNVADSEL-C
RECR_DEHSB      -----------------PGIGPKSAQRLAFYLMRAPEDQVISLSDTIRNIKNQISQCRICCNVADSEL-C
RECR_PSYA2      -----------------PGVGQKSAQRMALHLLTKKRPQGMALAQALDEAMRDIVECQRCHSFSDDAV-C
RECR_RHOP5      -----------------PGLGPRSARRAALHLIKKREALMAPLASALQVAIERIQVCKTCGNIDTQN-PC
RECR_RHOP2      -----------------PGLGPRSARRAALHLIKKRDALMTPLASALQVAIDKIEVCKTCGNIDTQN-PC
RECR_RHISN      -----------------PGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKICSCCGNVDTID-PC
RECR_WOLTR      ----------------------------VIHLLQNKEKVMLPLASSIKELADLIIECKVCGNLDTQS-PC
RECR_RICCK      -----------------PGLGSRSARRIVLYLLQDKDVRXXXXXXXXXXXXXXXVKCEICGNMDTENI-C
RECR_ROSCS      -----------------PGVGPKTASRLTFFLLRAPDELPRALANALIGLKQQVQLCSRCYFITQNDL-C
RECR_RHOPB      -----------------PGLGPRSARRAALHLIKKREALMAPLASALQVAIERIQVCKVCGNIDTQN-PC
RECR_ACIAD      -----------------PSVGPKSAQRMALHLLMKNREGAFGLAHALHEASSHIHECKICHSLTENEI-C
RECR_PSYWF      -----------------PGVGQKTAQRMALHLLNGRRGQGSALAQALDIAMHEIIECRQCHSFSDDDI-C
RECR_DESRM      -----------------PGIGPKTAQRLAFHVLNSPPELAQGLAKALVEVRQSIKRCSLCCNLTDED-PC
RECR_CYTH3      -----------------PGIGKKTALRLVLHXXXXXXXXXXXXANALLNARENIRYCKKCHTISDHEL-C
RECR_RHORT      ------------------------------------ESLMDPLMEALGAVAASVRLCPVCGTLDTRA-PC
RECR_PROM2      -----------------PGIGPRTAQRLALFILKQPESTIRDFSEALLEAHSNVGRCKKCFNLTSED-EC
RECR_AMOA5      -----------------PGIGKKTALRLVLFLLKSNPEQTERLATSLHKLRSQIQYCQKCHNISDTTL-C
RECR_PROMS      -----------------PGIGPRTAQRLALFILKQPESTIRDFSKALLEAHNNVGRCKKCFNLTSED-EC
RECR_PROM5      -----------------PGIGPRTAQRLALFILKQSESSIRDFSKALLEAHSNVGHCKKCFNLTSEE-EC
RECR_PROMP      -----------------PGIGPRTAQRLALFILKQPESSIRDFSKALLEAHSNVGHCKKCFNLTSEE-EC
RECR_PROM0      -----------------PGIGPRTAQRLALFILKQPESTIREFSKALLEAHSNVGRCKKCFNLTSED-EC
RECR_CHRSD      -----------------PGVGPKTAQRMALHLLEXXXXXXXXLVAALGEALEHVGYCQRCRTLAETPL-C
RECR_ANOFW      -----------------PGIGPKTAVRLAFFVLNMKEDVVLDFAKALVNAKRNLTYCSSCGHITDKD-PC
RECR_SYNPW      -----------------PGIGPRTAQRLALHLLRQPEEQIRSFADALLAARTEVGHCQTCHHLSAEPT-C
RECR_AZOC5      -----------------------------LHLIKKRETLMAPLGLALQDVLGKIVECQVCGNVDVRD-PC
RECR_PROM9      -----------------PGIGPRTAQRLALFVLKQPESTIRDFSKALLEAHSNVGRCKKCFNFTSED-EC
RECR_LEGPH      -----------------PGVGPKSAQRMVFXXXXXXXXXXXXXASCLEQAMKHISHCQQCNNYTEQTL-C
RECR_FUSNN      -----------------PGVGQKSATRYAFHILNQSEEDVKNFAEALLAVKENVKKCHVCGNYCESDT-C
RECR_BACTN      -----------------PGIGRKTAMRLVLHLLRQDTATVEAFGNSIITLKREVKYCKVCHNI-SDTETC
RECR_RHILW      -----------------PGLGPRSARRAALHLIKKKDQLLGPLSNAMGEAYDKVKICSRCGNXXXXXXXX
RECR_LEGPL      -----------------PGVGPKSAQRMVFXXXXXXXXXXXXXASCLEQAMKHISHCQQCNNYTEQTL-C
RECR_LEGPC      -----------------PGVGPKSAQRMVFXXXXXXXXXXXXXASCLEQAMKHISHCQQCNNYTEQTL-C
RECR_LEGPA      -----------------PGVGPKSAQRMVFXXXXXXXXXXXXXASCLEQAMKHISHCQQCNNYTEQTL-C
RECR_STAAW      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAT      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAS      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAR      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAE      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAC      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAB      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAA8      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAA3      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAES      -----------------PGIGPKTAQRLAFHTLDMKEDDVVKFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAEQ      -----------------PGIGPKTAQRLAFHTLDMKEDDVVKFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAN      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAAM      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAA9      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAA2      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_STAA1      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_NITOC      -----------------PGVGPKSAQRMAFHLLESDREGGRHLAQALLEALDKMTHCQTCRILSETDL-C
RECR_MAGSM      -----------------PGVGRKSAQRMVYHLLKEGGREATLLGQGLLALSERIHFCEVCHNLAEEGL-C
RECR_MACCJ      -----------------PGIGPKTASRLAFHVLDMKEDDVVGFAKALVDVKRELTYCSVCGHITDTD-PC
RECR_THICR      -----------------PTIGPKSAQRLAYFLLQNHQQDGHRLASAIESALEKVGYCQQCRNLSETEI-C
RECR_GRAFK      -----------------PGIGKRTALRLVLHLLKQPEEQTTQLSKALLELRQNIKLCNNCYNISDTEL-C
RECR_CYAP7      -----------------PGVGPKTAQRLALHILKRPEEEVNTLAKAIVEAKKQVGLCQVCFHLSAEST-C
RECR_STRAW      -----------------PGVGPKSAQRIAFHILQAEPTDVRRLAQCLMEVKAKVRFCATCGNVAQEEL-C
RECR_STAHJ      -----------------PGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEND-PC
RECR_BIFAA      -----------------PGIGPKGAQRIAFYLLNAPDEESQALIDAITEVKEKVRFCDICGNVCETS-PC
RECR_PROAC      -----------------PGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICFNVSSDEV-C
RECR_PROMM      -----------------PGIGPRTAQRLALHLLRQPEDQIRAFADALLAARSQVGQCQTCFHLSAEPL-C
RECR_BRAHW      -----------------PGIGTRTAMRLALYLFDCDDEYLKEFSDVLSSLHENIKLCQVCYSLSDNDI-C
RECR_ANAMM      -----------------PSLGPASSRRIVLHLLRHRQDVMVPLAAGIRELEMHTKECTICHNLDTIS-PC
RECR_STACT      -----------------PGIGPKTAQRLAFHVLDMKEDDVVQFAKALVDVKRELTYCSVCGHITEED-PC
RECR_LEIXX      -----------------PGIGPKSAQRIAFHILQTEAFDVTRLAEVLLEVRDKVRFCEICGNV-SEQATC
RECR_BACHD      -----------------PGIGPKTASRLAFFVLEMKEDDVLDFAKALVNVKRKLTYCSVCHNITDTD-PC
RECR_SYNS9      -----------------PGIGPRTAQRLALHLLNQPEDQVQQFADALLAARSQVGQCQSCFHLSADPL-C
RECR_SYNR3      -----------------PGIGPRTAQRLALHLLRQPEEQSRAFADALLAARQQVGQCQRCGHLSADPI-C
RECR_STAS1      -----------------PGIGPKTAQRLAFHVLDMKEDDVVQFAKALVDVKRELTYCSECGHITEQD-PC
RECR_STRCO      -----------------PGVGPKSAQRIAFHILQAEPVDVRRLAQALMEVKAKVRFCATCGNVAQEEQ-C
RECR_FRATM      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_FLAPJ      -----------------PGIGKRTALRLVLYLLKQPKDRTDFLAQSLLTMREGIIFCENCHNISDVAV-C
RECR_CLOTH      -----------------PGIGHKTAQRLAFYVLDMPQEKVDRLANAITEAKQKTKFCSVCGNLTDTDV-C
RECR_BRAJA      -----------------PGLGPRSARRAALHLIKKREALMMPLSSALQVALDKVQVCKTCGNIDTQN-PC
RECR_SYNS3      -----------------PGIGPRTAQRLALHLLRQPEEQIHSFADALLAARSQVGQCQTCFHLSAEPT-C
RECR_PORGI      -----------------PGVGRKTALRLALYLLRQPVENTRQFAAALVDLREHISYCRHCHNISDSDV-C
RECR_PORG3      -----------------PGVGRKTALRLALYLLRQPVENTRQFAAALVDLREHISYCRRCHNISDSGV-C
RECR_FRATN      -----------------PTIGKKSSQRLALYLLDKSPETARAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_CYAP8      -----------------PGVGPKTAQRLALHILKRPENEIQALASALIEAKKKVGLCNVCFHFSADPI-C
RECR_METCA      -----------------PGVGPKTAQRMTLHLLQRDRDAAGRLSEALRQALEKVGLCAQCRTLTEHSL-C
RECR_COXBU      -----------------PGIGPKSAQRMAFHLLAKSGQAKGALSDALQSAIRQVGECKLCQIYTEQPL-C
RECR_BACP2      -----------------PGIGPKTAVRLAFFVLSMQEDVVLDFAKALVNAKRNLTYCSVCGHITDQD-PC
RECR_BACLD      -----------------PGIGPKTAVRLAFFVLSMKEDVVLDFAKALVNAKRNLTYCSVCGHITDQD-PC
RECR_THEFY      -----------------PGVGPKSAQRIAFHLLAAETADVHRLVNALVAVKERVRFCAVCGNIAEETQ-C
RECR_GEOSW      -----------------PGIGPKTAIRLAFFVLTMKEDTVLEFAKSLVDVKRNIRYCTVCGHITDTD-PC
RECR_FRATO      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_FRATH      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_FRATF      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_BACSU      -----------------PGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVCGHITDQD-PC
RECR_PROM3      -----------------PGIGPRTAQRLALHLLRQPEDQIRAFAEALLAARSQVGQCQTCFHLSAEPL-C
RECR_NATTJ      -----------------PGIGPKTAERLAFHIVSMDETKVNHLITALQDSRDKVFECSTCNNLTDKD-PC
RECR_GRABC      -----------------PGLGPRSXXXXXXXXXQQPETRLLPLAAAMQNAARAVKTCRVCGNLDSAD-PC
RECR_FRATT      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_FRAT1      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_BACFR      -----------------PGIGRKTAMRLVLHLLRQDTSVVEAFGSSIITLKHEVKYCKVCHNI-SDTETC
RECR_BACFN      -----------------PGIGRKTAMRLVLHLLRQDTSVVEAFGSSIITLKHEVKYCKVCHNI-SDTETC
RECR_ARTS2      -----------------PGVGPKSAQRLAFHILEADPQDMKRLVEAITTVKERVKFCTVCGNVTEQEL-C
RECR_FRATW      -----------------PTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDV-C
RECR_CLOTE      -----------------PGIGKKTAQRLTLYVLNLPREEVEEFANALIKARGTIKYCSVCGNFTDKD-PC
RECR_BACA2      -----------------PGIGPKTAVRLAFFVLGMKEDTVLDFAKALVNAKRNLTYCSICGHITDQD-PC
RECR_ALKOO      -----------------PGIGRKTAQRLAFHVINMPIQDAHNLADAIVKAKENIKYCKVCTNLTDQEV-C
RECR_THEP3      -----------------PGIGPKTAQRLAFFIINMPLEEVKSLSQAIIDAKEKIKYCRICYNITDTEV-C
RECR_FLAJ1      -----------------PGIGKRTALRLVLHLLKQPKEQTGFLSQALLNMREDIKFCENCHNISDTKV-C
RECR_CLONN      -----------------PGIGYKTAQRLTLHVLNLPSDEVREFANALVKARGTIKYCSICGNY-TDSDPC
RECR_CLAM3      -----------------PGIGPKSAQRIAFHILQTETFDVSRLAEVLTVVRDKVRFCAICGNVSEKET-C
RECR_CALS8      -----------------PGIGQKTAQRLAFYIINMKNEDVKALAEAILSAKNSTKLCKICCNFTEGDI-C
RECR_XYLFT      -----------------PGVGQKTAQRMAYHMLEREREGGQRLADVLSRAIEKIGHCTECRDFSETKI-C
RECR_THEPX      -----------------PGVGPKTAQRLAFFIINMPLEEVKSLSQAIIDAKEKIKYCRICYNITDTEV-C
RECR_SYNSC      -----------------PGIGPRTAQRLALHLLNQPQEQIHQFADALLAARTQVGQCQTCFHLSADP-EC
RECR_SYNPX      -----------------PGIGPRTAQRLALHLLNQPEEQIRQFADALLAARTQVGQCQTCFHLSADP-EC
RECR_LISW6      -----------------PGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD-PC
RECR_FRASC      -----------------PGIGPKSAQRIAFHLLAADPVDVRRLATALTEVKEKVQFCRSCFNVAQSEL-C
RECR_BACCN      -----------------PGIGPKTAVRLAFFVLDMKEDDVLDFAKSLVNAKRNLTYCSVCGHITDRD-PC
RECR_LISMO      -----------------PGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD-PC
RECR_LISMH      -----------------PGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD-PC
RECR_LISMF      -----------------PGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD-PC
RECR_LISMC      -----------------PGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD-PC
RECR_GEOKA      -----------------PGIGPKTAARLAFHVLAMKEDTVLEFAKALVDVKRHIHYCTICGHITDTD-PC
RECR_CHLTE      -----------------PGIGRKTAQRLTMHVLHERRSEVEKLASALIDVKEKVIRCSVCQNITDLGVDC
RECR_MARAV      -----------------PGVGQKTAQRMAFHLLERGRSGGTRLAAALNHAMDGVRRCDSCQNFSDTEI-C
RECR_LISIN      -----------------PGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVCGHITDKD-PC
RECR_GEOTN      -----------------PGIGPKTAARLAFHVLAMKEDTVLEFAKALVDVKRHIHYCTICGHITDTD-PC
RECR_SYNY3      -----------------PSVGPKTAQRLALHLLKRPDAEVENLAQALLDAKKRVGQCQVCFHLSAEPV-C
RECR_SYNP6      -----------------PGVGPKTAQRLALHLIQRPXXXXXXXXXXXXXXKQQVGHCQRCFHLSSEDL-C
RECR_SYNE7      -----------------PGVGPKTAQRLALHLIQRPXXXXXXXXXXXXXXKQQVGHCQRCFHLSSEDL-C
RECR_OCEIH      -----------------PGIGPKTAARLAFFVLNMKEDDVLNFANALVSAKRELSHCSVCGHITDQD-PC
RECR_NITMU      -----------------PGVGPRSAQRMAYHLLQRDQEGARRLADSLDYALEHVRHCEKCNNF-TEEVVC
RECR_MOOTA      -----------------PGIGPKTAQRLAFHLLKVPASEARDLAAAILEARQKTIYCSICGNFTDRD-PC
RECR_CHLPD      -----------------PGIGRKTAQRLCMHMLNEPRTAAEKLAKALLDVKDRVIRCSECQNVTDDSDPC
RECR_CLOPS      -----------------PSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSVCGNFTDTD-PC
RECR_CLOPE      -----------------PSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSVCGNFTDTD-PC
RECR_CLOP1      -----------------PSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSVCGNFTDTD-PC
RECR_CLOK5      -----------------PGIGRKTAQRLTLHVLNLPADEVREFAKALVKARGTIKYCSICGNF-TDSDPC
RECR_CLOK1      -----------------PGIGRKTAQRLTLHVLNLPADEVREFAKALVKARGTIKYCSICGNF-TDSDPC
RECR_HERA2      -----------------PGIGPKSASRLVFYLLRAKREQSERLANAIMAMKDSTIFCNRCFNITVED-PC
RECR_BREBN      -----------------PGIGPKTAGRLAFFVLNMKEDDVLDLAKALVNAKRQLHYCSVCNNITDLD-PC
RECR_TROWT      -----------------PGIGPKSAQRITFFILQNPSFDIDRLSETLQSVRKQVQFCKVCGNFSEED-EC
RECR_TROW8      -----------------PGIGPKSAQRIAFFILQNPSFDIDRLSETLQSVRKQVQFCKVCGNFSEED-EC
RECR_FRAAA      -----------------PGIGPKSAQRIAFHLLAADPVDVRRLATALTEVKDKVRFCRSCFNVAQSEL-C
RECR_CHLSY      -----------------PGIGPKTASRLTFYLLRAEPKQALALAQAILDVKEQVGYCRRCFNITVGEL-C
RECR_CHLAD      -----------------PGIGPKTASRLTFYLLRAEPKQAQALAQAILDVKAQVGYCRRCFNITVDEL-C
RECR_CHLAA      -----------------PGIGPKTASRLTFYLLRAEPKQALALAQAILDVKEQVGYCRRCFNITVGEL-C
RECR_BACWK      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_XYLFA      -----------------PGVGQKTAQRMAYHVLEREREGGQRLADVLSRAIEKIGHCTECRDFSETKI-C
RECR_CHLT3      -----------------PGIGRKTAQRLTMFILHEEKEKVESLAQALLDLKNKVSYCSLCQNVTDKEIDC
RECR_ALKMQ      -----------------PGIGRKTAQRLAFHVISMGYEDAEKLSNSIIEAKKSIKYCRICTNLTDKEV-C
RECR_RUBXD      -----------------PTIGPRSAQRIAFHIIRTRKXXXXXXXXXXREVKERIRPCRRCFNLTEGE-EC
RECR_HALHL      -------------------VGAKTAQRMALHLLQRDRDGARQLADALQRAVDGVGHCPECGLLTEEER-C
RECR_CLOD6      -----------------PGVGRKTAQRLAFHIINMNTNDVEALSKAIIDAKREIRYCSICCNITDTD-PC
RECR_PSYIN      -----------------PSVGPKSAQRMVYHLLDKNRKGALNLSSLLERAVNEIGHCQQCRTFTEQNL-C
RECR_MYXXD      -----------------PGIGEKTAQRLAFHILRAPGEYAAELSQAIREVKEKVHLCVRCFSL-TDAETC
RECR_BACAN      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACAC      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACAA      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_LEUCK      -----------------PGIGPKTATRLAFYTLGMQEDDVVDFSKSLLSAKKDLTFCRICGNITENSVNC
RECR_BACHK      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACCZ      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACCR      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACCQ      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACC7      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACC4      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACC3      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACC2      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACC1      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACC0      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_BACAH      -----------------PGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVCGHITDRD-PC
RECR_DESOH      -----------------PGIGQKTAERLAMHLLHVPDRAVHELARSLVDLKKNTRMCSVCFTLSDTPV-C
RECR_ANAPZ      -----------------PGLGPASSXXXXXXXXXXXXDVMTPLANGIRELEESTKECEICFNLDVTS-PC
RECR_ALHEH      -----------------PGVGPRSAQRMAFHLLQXXXXXXXXLATAIREAMDQVGHCRQCRVLTEEPV-C
RECR_ACIC1      -----------------PGIGPKSAQRIAFHILGADPSQVRRLAEVLLDVKERIRFCAICGNVAEHEQ-C
RECR_PARD8      -----------------PGVGRKTALRLALYMLRRDVGYTENFAAALVALRRDVKYCKVCHNICDDEV-C
RECR_HERAR      -----------------PGVGPKSAQRMAYHLMQHDRDGAAMLGRALSQAVERVQHCAMCNTFTESAV-C
RECR_GEOLS      -----------------PGIGERTALRLAFHLLKSPQNLGS-LAEALTQVQERVCACSVCFALTEQN-PC
RECR_THETN      -----------------PGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEV-C
RECR_SHEPA      -----------------PGVGPKSAQRMAFQLLERDRKAGAKLADSLAKAMSEVGHCQSCRTFTEETY-C
RECR_SHEHH      -----------------PGVGPKSAQRMAFQLLERDRKAGAKLADSLAKAMSDVGHCQSCRTFTEETY-C
RECR_CLOBA      -----------------PSIGKKTAQRLTLHILNLPDDEVREFAKALVKAKGTIKYCSTCGNFTDTD-PC
RECR_BACSK      -----------------PGIGPKTASRLAFHVLDMKEDDVLEFAKALVHAKRDLTYCSQCHNITDTD-PC
RECR_JANMA      -----------------PGVGPKSAQRMAYHLMQHDRDGAAMLGRALSQAVEKVQHCAMCNTFTEHEV-C
RECR_EDWI9      -----------------PGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCRDCRTFTEQEV-C
RECR_CHLP8      -----------------PGIGRKTAQRLTMHVLQERRGEVEKLAAALIDVKEKVVRCSICQNI--TDLGC
RECR_BIFLI      -----------------PGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCDICGNVCESS-PC
RECR_STRTR      -----------------PGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVCGRLTDDD-PC
RECR_STRTD      -----------------PGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVCGRLTDDD-PC
RECR_STRT2      -----------------PGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVCGRLTDDD-PC
RECR_STRT1      -----------------PGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVCGRLTDDD-PC
RECR_STRSY      -----------------PGIGIKTATRLAFYTIGMEDDVVNEFAKNLLAAKRDLSYCSICGNLTDQD-PC
RECR_STRPG      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_NOCSJ      -----------------PGVGPKGAQRIAFHLLQADPADVRRLADVLLEVKAKVKFCSICFNVSQDDQ-C
RECR_DESAH      -----------------PGIGRRTAERLALHILHAPLHEAQTLANDILELKQKVTLCRTCFSL-SDQPEC
RECR_CLOBM      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_CLOBL      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_CLOBK      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_CLOBJ      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_CLOBH      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_CLOB6      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_CLOB1      -----------------PGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSVCGNFTDKD-PC
RECR_VIBCM      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQECRTFTEQDV-C
RECR_VIBCH      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQECRTFTEQDV-C
RECR_VIBC3      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMVEIGHCQECRTFTEQDV-C
RECR_STRE4      -----------------PGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_PSEHT      -----------------PGIGPKSAQRIAFHLLERDRKGGTQLGNALTKAMTAVGHCESCRTFCEQSQ-C
RECR_CHLL2      -----------------PGIGRKTAQRLAMHILHEPKSGAERLAGALIDIKEKVIRCSVCQNVTDRDADC
RECR_PHEZH      --------------------------------------------------------CSTCGSLDTQD-PC
RECR_METFK      -----------------PGVGPKSALRMAYYLLQRDRKGAGILAKSLDQALQVVSHCNLCNNFSEQEI-C
RECR_LACS1      -----------------PGIGSKTATRLAFYTIDMQEDDVTEFAQSLISAKRDLSYCSICGNI-TESDPC
RECR_EXISA      -----------------PGIGPKTAVRLAFHVLDMEEDDVLTFAKSLVSAKRDIKYCTVCGHITDID-PC
RECR_DESAA      -----------------PGIGEKTAERLALHILRGSVKDAQALAESISEAKETVRLCSVCYGL-ADSDPC
RECR_SALRD      -----------------PTIGKKTARRLANYVLKMPQEEVETIANALTSVKEDVQRCSTCYVVADQD-PC
RECR_ROSS1      -----------------PGVGPKTASRLTFFXXXXXXXXXXXXXXXXXXXKQQVQLCSRCYFITQGDL-C
RECR_PSEU2      -----------------PGVGQKTAQRMALQLLERDRSGGSRLAQALGQAMDGVGHCRSCRTLTEEEL-C
RECR_ECOL5      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQTLTRAMSEIGHCADCRTFTEQEV-C
RECR_VIBHB      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLADALSQAMTEIGHCTECRTFTEEEV-C
RECR_SYMTH      -----------------PGIGPKTAQRLAFHILHMEPSVVEGIARTLVEARAKVKYCSVCCNLTDQD-PC
RECR_STRU0      -----------------PGIGIKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSVCGNLTDED-PC
RECR_SERP5      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDI-C
RECR_HALOH      -----------------PGIGPKTAQRLAFYILRLNPSEVRELSQSMIDAREKTKYCSVCNNLTEKD-PC
RECR_CLOPH      -----------------PGIGAKSAQRLAFHIINMPKEQVEHLAKTMLDARSNVKYCKVCQTLTDKEI-C
RECR_CLOCE      -----------------PGIGHKSAQRLAFHVINLPMEKVQKLSESILEAKQKTRYCSVCSNLTDID-PC
RECR_CHLPB      -----------------PGIGRKTAQRLSMHILQEKPGEVEKLSRALTDVKEKVISCSICQNVTDRGDDC
RECR_BIFA0      -----------------PGIGPKGAQRIAFYLLQAPDAESQRLVDAINEVKEKVRFCEVCGNVCESS-PC
RECR_TOLAT      -----------------PGVGPKSAQRMAFQLLERERKRGMQLGQTLQRALTEIGHCQHCRTFTENSL-C
RECR_STRPZ      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRPM      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRPF      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRPD      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRPC      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRPB      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRP8      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRP6      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRP3      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STRP1      -----------------PGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_SACEN      -----------------PGIGPKSAQRIAFHLLAAEPADVTRLQEVLQKVKEGVVFCDICGNV-SEEPTC
RECR_POLNS      -----------------PGVGPKSAQRMAFYLLQHDRNGAAVLAQSLGEAVETVGHCACCNTFSETQV-C
RECR_HELMI      -----------------PGVGPKTAQRLAFHLLHVPRNEAVALAKAIVEAHDKTLYCSVCTNLTDRD-PC
RECR_ACAM1      -----------------PGIGPKSAQRLALHLLKRPTAEVEALANALIEAKQQVGFCSVCFHLSADPV-C
RECR_VIBPA      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLADALSQSMTEIGHCAECRTFTEEEV-C
RECR_PSEE4      -----------------PGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMEGVGHCRQCRTLTEQEL-C
RECR_PSE14      -----------------PGVGQKTAQRMALQLLERDRSGGSRLALALGQAMDGVGHCRSCRTLTEEEL-C
RECR_PROMH      -----------------PGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCCDCRTFTEEER-C
RECR_POLSQ      -----------------PGVGPKSAQRMAFYLLQHDRNGAAVLAQSLGEAVDTVGHCARCNTFSETQI-C
RECR_LEUMM      -----------------PGIGPKTATRLAFYTLGMNEEDVQDFSKALISAKTDLTFCSICGNITATDTDC
RECR_BIFLO      -----------------PGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCDICGNVCESS-PC
RECR_BIFLD      -----------------PGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCDICGNVCESS-PC
RECR_VIBSL      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLAEALSQAMTEIGHCNECRTFTEEET-C
RECR_STRS7      -----------------PGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_STREM      -----------------PGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSICGNLTDDD-PC
RECR_DEIDV      -----------------PGIGPKSAQRLAFHLFEQPREDIERLAGALLAAKRDLHTCPVCFNI-TDAERC
RECR_CLOBB      -----------------PSIGKKTAQRLALHILNLPNDEVREFATALVKARGTIKYCSTCGNFTDTD-PC
RECR_BURVG      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_STRSV      -----------------PGIGIKTATRLAFYTIGMSDDDVNEFAKNLLAAKRELSYCSVCGNLTDED-PC
RECR_SHEDO      -----------------PGVGPKSAQRMAFNLLERDRKVGLKLAESLKNAMTDVGHCQSCRTFTEQSL-C
RECR_PSEPK      -----------------PGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQCRTLTEQEL-C
RECR_PSEP1      -----------------PGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQCRTLTEQEL-C
RECR_LEPIN      -----------------PGIGRKSAFRISFHLLRLEQGLFNQFIHQLTDTKNKIKFCKRCGSYAETEI-C
RECR_LEPIC      -----------------PGIGRKSAFRISFHLLRLEQGLFNQFIHQLTDTKNKIKFCKRCGSYAETEI-C
RECR_IDILO      -----------------PGVGQKSAQRMAFHLLERDRGGASRLAESLQSAVEKVGHCECCRTLTEEPL-C
RECR_BURS3      -----------------PGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BURCJ      -----------------PGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BURCH      -----------------PGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BURCC      -----------------PGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BURCA      -----------------PGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BDEBA      -----------------PGIGPKTAQRLAYYILRTGNEYPERLSEALLRVKAEVHDCPTCFNYTDTDI-C
RECR_AZOVD      -----------------PGVGQKTAQRMALHLLERDRSGGLRLAQALTQALEHVGHCRQCRTLSEDEL-C
RECR_STRGC      -----------------PGIGIKTATRLAFYTIGMSDDDVNEFAKNLLAAKRELSYCSICGNLTDED-PC
RECR_SHEPW      -----------------PGVGPKSAQRMAFQLLERDRKAGSKLADSLGKAMSEVGHCQSCRTFTEETY-C
RECR_ANAVT      -----------------PGVGPKTAQRLALHILKRPESEXXXXXXXXXXXXXXIGLCSVCFHLSSEPV-C
RECR_ANASP      -----------------PGVGPKTAQRLALHILKRPESEXXXXXXXXXXXXXXIGLCSVCFHLSSEPV-C
RECR_PHOLL      -----------------PGVGPKSAQRMAFHLLQRNRSGGMRLAQALTRAMSEIGHCKYCRTFTEQEQ-C
RECR_BURP1      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQI-C
RECR_BURMS      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQI-C
RECR_BURMA      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQI-C
RECR_BURM9      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQI-C
RECR_BURM7      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQI-C
RECR_BURCM      -----------------PGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BURA4      -----------------PGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_XANCP      -----------------PGVGQKSAQRMAYHVXXXXXXXXXXXXXXXXNAVEKVGHCVQCRDFTESEV-C
RECR_XANC8      -----------------PGVGQKSAQRMAYHVXXXXXXXXXXXXXXXXNAVEKVGHCVQCRDFTESEV-C
RECR_STRMU      -----------------PGIGIKTATRLAFYTIGMSDEDVNNFAKNLLAAKRELTYCSVCGNLTDDD-PC
RECR_SHEFN      -----------------PGVGPKSAQRMAFQLLERERKVGLKLADSLQKAMSEVGHCQSCRTFTEQDL-C
RECR_PSESM      -----------------PGVGQKTAQRMALQLLERDRSGGSRLALALGQAMDGVGHCRLCRTLTEEEL-C
RECR_PELTS      -----------------PGIGPKTAQRLAFYLLNAPLEVALNLXXXXXXXXXXXXYCSVCGNLTDTD-PC
RECR_NEIMF      -----------------PNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHCAMCNTFCEGGL-C
RECR_NEIMB      -----------------PNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHCAMCNTFCEGGL-C
RECR_LEPBL      -----------------PGIGRKSAFRISFHLLRLEQGHFNHFIHQLTNTKNKIKFCKRCGSYAETEI-C
RECR_LEPBJ      -----------------PGIGRKSAFRISFHLLRLEQGHFNHFIHQLTNTKNKIKFCKRCGSYAETEI-C
RECR_KLEP7      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_EXIS2      -----------------PGIGPKTAVRLAFHVLDMEEDDVLMFGKALVSAKRDISYCSICGNITDKD-PC
RECR_BURPS      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQV-C
RECR_BURP6      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQV-C
RECR_BURP0      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQV-C
RECR_AZOSE      -----------------PGVGPKSAQRMAYHLLQRDQRGAERLARALGNALAVLRHCERCNTFTETEI-C
RECR_SHISS      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_SHIFL      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_SHIF8      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_SHIB3      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_SHELP      -----------------PGVGPKSAQRMAFQLLERDRKAGHKLAQALSSAMSDVGHCSSCRTFTEESL-C
RECR_PSEF5      -----------------PGVGQKTAQRMALQLLERDRSGGLRLAQALSQAMEGVGHCRQCRTLTEDEL-C
RECR_PELLD      -----------------PGVGRKTARRLAMYVLQQPRLEAERLARALIDVKDRVIRCSVCQNVTDREEDC
RECR_PEDPA      -----------------PGIGYKTATRLAFFTLDMEKDDVTEFAKALISAQRDLSFCSICGNITEDD-PC
RECR_ESCF3      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOUT      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOSM      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOSE      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOLU      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOLI      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOLC      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOL6      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOK1      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOHS      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECODH      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECOBW      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO8A      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO81      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO7I      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO5E      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO57      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO55      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO45      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO27      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_ECO24      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_DECAR      -----------------PGIGPKSAQRMAYHLLQRDRPGAQRLGDAVLHALQAIRHCQRCNTFTEGDI-C
RECR_CHLCH      -----------------PGIGRKTAQRLAMYILHEPKIEAEQLAKALLDVKEKVVRCTICQNITDVGTDC
RECR_BURP8      -----------------PGVGPKSAQRMAYHLMQHDREGAEKLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BURM1      -----------------PGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLRHCDKCNTFTEAQI-C
RECR_XANAC      -----------------PGVGQKSAQRMAYHVXXXXXXXXXXXXXXXXSAVEKVGHCVQCRDFTESEI-C
RECR_TREPA      -----------------PGIGVKLATRLAYHLLKRDPAEAQVLARGIACLHERVYRCVCCGAFCEGRT-C
RECR_STRA5      -----------------PGIGTKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVCGNLTDDD-PC
RECR_STRA3      -----------------PGIGTKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVCGNLTDDD-PC
RECR_STRA1      -----------------PGIGTKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVCGNLTDDD-PC
RECR_SODGM      -----------------PGVGPKSAQRMVFHLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQPV-C
RECR_PSEPG      -----------------PGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQCRTLTEQEL-C
RECR_PSEFS      -----------------PGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMTGVGHCRQCRTLTEEEL-C
RECR_NEIMA      -----------------PNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVDHCARCNTFCEGGL-C
RECR_NEIM0      -----------------PNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVHHCAMCNTFCEGGL-C
RECR_CUPTR      -----------------PGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCQRCNTFTEQEI-C
RECR_BURTA      -----------------PGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCEKCNTFTEAQV-C
RECR_BACV8      -----------------PGVGRKTAMRLVLHLLRQDTAVVEAFGNAMITLKHEVKYCKVCHNI-SDTETC
RECR_STRPI      -----------------PGIGIKTATRLAFYTIGMSDDDVNEFAKNLLSAKRELTYCSVCGRLTDDD-PC
RECR_CITK8      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_BURPP      -----------------PGVGPKSAQRMAYHLMQHDRDGAEKLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_VIBVY      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLADALSHAMTEIGHCNECRTFTEEDV-C
RECR_VIBVU      -----------------PGVGPKSAQRMAFHLLQRDRKGGLQLADALSHAMTEIGHCNECRTFTEEDV-C
RECR_PROA2      -----------------PGIGRKTAQRLAMHILHQHTDEVEKFASALIDVKQKVIHCRVCQNVTDIGADC
RECR_KLEP3      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_BURXL      -----------------PGVGPKSAQRMAYHLMQHDRDGAEKLGRSLLFATEHLQHCEKCNTFTEAQI-C
RECR_BORPE      -----------------PGVGVRSARRMAYHLLQHDLQGADMLGRALSAAVQHLRHCARCNSFTEDEV-C
RECR_BORPD      -----------------PGVGVRSARRMAYHLMQHDLQGADMLGRALAGAVQNLRHCARCNSFTEDDI-C
RECR_XANOR      -----------------PGVGQKSAQRMAYHVLXXXXXXXXXLATTLANAVEKVGHCVQCRDFTESEI-C
RECR_XANOM      -----------------PGVGQKSAQRMAYHVLXXXXXXXXXLATTLANAVEKVGHCVQCRDFTESEI-C
RECR_VIBFM      -----------------PGVGPKSAQRMAFHLLQRNRQGGMQLADALSQAMSEIGHCSECRTFTEEDT-C
RECR_VIBF1      -----------------PGVGPKSAQRMAFHLLQRNRQGGMQLADALSQAMSEIGHCSECRTFTEEDT-C
RECR_PHOPR      -----------------PGVGPKSAQRMAFXXXXXXXXXXXXXADALNRAMTDIGHCRDCRTFTEDDI-C
RECR_LACLM      -----------------PGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLRFCSICGNL-TESDPC
RECR_LACF3      -----------------PGIGEKSATRLAFYTLGMSDADVDNFAKSLRAVKRDLHYCSVCGNITEDD-PC
RECR_STRZJ      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRPJ      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRP7      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_SALTY      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALTI      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALSV      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALPK      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALPC      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALPB      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALPA      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALNS      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALHS      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALG2      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALEP      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALDC      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_SALA4      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_PSEPW      -----------------PGVGQKTAQRMALQLLERDRSGGVRLAQALSLAMEGVGHCRQCRTLTEQEL-C
RECR_PHYMT      -----------------PGVGKKTAERYTFFLINQKNKKILYLSKHLKELVNNIKSCNICGYITEKNI-C
RECR_PASMU      -----------------PGVGPKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHCRTFTEEEV-C
RECR_METPP      -----------------PGVGVKSAQRMAYHLLQHDREGALRLARALEQAVATVRHCERCNTFTEAPV-C
RECR_LARHH      -----------------PGVGPKTAQRMAYHLMQRDPGGADRLARAIDHARSHLKHCARCNTFSETEL-C
RECR_LACSS      -----------------PGIGNKTATRLAFYTIDMNEDDVTNFAKNLISARRDLHYCSVCGNITDED-PC
RECR_LACRJ      -----------------PGIGQKTATRLAFYTLSMQEDDVTNFAKSLLSAKRDLHNCSICGNITEDD-PC
RECR_LACRD      -----------------PGIGQKTATRLAFYTLSMQEDDVTNFAKSLLSAKRDLHNCSICGNITEDD-PC
RECR_LACLS      -----------------PGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLRFCSICGNL-TESDPC
RECR_DESHY      -----------------PGIGPKTAGRLAFYLLQ-QPQVAENLAETMIRAQREIRQCSLCCNYTDHD-PC
RECR_DEIGD      -----------------PGIGPKSAQRLAFYLFEQPREDIERLAGAILEAKRDLHTCPVCFNI-TDAERC
RECR_BORA1      -----------------PGVGARSARRMAYHLLQHDVQGADMLGRALAGAVQNLRRCARCNSFTEDDV-C
RECR_TREDE      -----------------PGIGHKSAARIAYHLLKQGPADALRLAEAVSTLHEKIHPCTICGSYTEDEI-C
RECR_THEEB      -----------------PGIGPKTAQRLALHLIKRPEADIXXXXXXXXXXXXXVGLCSVCFHLSAEPV-C
RECR_SALCH      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_RHOSR      -----------------PGVGPKSAQRIAFHLLSVEPPEIDRLKNALQRVRDGVQFCVVCGTV-SDKEHC
RECR_PSEPF      -----------------PGVGQKTAQRMALQLLERDRSGGTRLAQALSQAMEGVGHCRQCRTLTEDDL-C
RECR_ACIBL      -----------------PGVGNKSAQRLAFHILRSSNDDAELLADAVRDVKAKLRLCSICNNITDVD-PC
RECR_SYNAS      -----------------PGIGEKTATRLAMHILRAPEGDARALADSILEVRDKIRFCRVCYNFSEAEL-C
RECR_SHIDS      ------------------GVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_SHIBS      ------------------GVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEV-C
RECR_OENOB      -----------------PGIGRKSATRLAFYTLGMSDDDVKNFARSLSASKSDLTFCRICGFITSKDDDC
RECR_LACLA      -----------------PGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLSFCSICGNL-TESDPC
RECR_ERWT9      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEI-C
RECR_THET8      -----------------PGIGPKTAQRXXXXXXXXXXXXXXXXXXXXG--IKRVRACRECGNLAEGEL-C
RECR_ENT38      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQDV-C
RECR_DEIRA      -----------------PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKC
RECR_CYAP4      -----------------PGVGPKTAQRLALHLLKRPDSEVXXXXXXXXXXXXXVGLCSVCFHLSAEPV-C
RECR_BORPA      -----------------PGVGVRSARRMAYHLLQHDLQGADMLGRALSGAVQHLRHCARCNSFTEDEV-C
RECR_BORBR      -----------------PGVGVRSARRMAYHLLQHDLQGADMLGRALSGAVQHLRHCARCNSFTEDEV-C
RECR_PSEAE      -----------------PGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQCRTLSEEEL-C
RECR_PSEA8      -----------------PGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQCRTLSEEEL-C
RECR_PSEA6      -----------------PGVGPKSAQRMAFHLLERNRSGALQLSQVLHNAMEHVGHCKQCRTFTESEL-C
RECR_PARUW      -----------------PGVGHKSAERFAFHLLNWPMEHLIELSETVKNTKDKIKQCLNCGCL-TDEAAC
RECR_HAMD5      -----------------PGVGPKSAQRMAFYLLQSDRSKGIRLAESLLKAMSEIGHCGVCRTFTEQPC-C
RECR_CARHZ      -----------------PGIGPKTAQKLALYXXXXXXXXXXXXXXXXXXXRKNTRYCSICFNLTDTD-PC
RECR_ANADE      -----------------PGIGEKTAQRLAFHILKXXXXXXXXXXXXXXXVVRDVRLCSTCQTLTDQD-PC
RECR_STRZT      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRZP      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRR6      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRPS      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRPN      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRP4      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_STRP2      -----------------PGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDD-PC
RECR_SALAR      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMAEIGHCADCRTFTEQEV-C
RECR_RALME      -----------------PGVGPKSAQRMAYHLLQHDREGARKLGDALRGAVDGIRHCTRCNTFTELEI-C
RECR_RALEJ      -----------------PGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCARCNTFTEQEI-C
RECR_PSEAB      -----------------PGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRRCRTLSEEEL-C
RECR_PSEA7      -----------------PGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQCRTLSEEEL-C
RECR_PECCP      -----------------PGVGPKSAQRMAFQLLQRNRSGGMRLAQALTRAMSEIGHCSDCRTFTEQDV-C
RECR_LACCB      -----------------PGIGAKTATRLAFYTIDMNKDDVTAFAKSLVAAKEDLHYCSICGNITDED-PC
RECR_LACC3      -----------------PGIGAKTATRLAFYTIDMNKDDVTAFAKSLVAAKEDLHYCSICGNITDED-PC
RECR_LACBA      -----------------PGIGQKSATRLAFFTIDMAEDDVTAFSKALIAAKRDLHFCSICGNITEGD-PC
RECR_DESHD      -----------------PGIGPKTAGRLAFYLLQ-QPQVAENLAEAMIRAQREIRQCSLCCNYTDHD-PC
RECR_ACTSZ      -----------------PGVGPKSAQRMAYHLLQRDRSGGMNLARALTDAMSKIGHCSQCRTFTEQET-C
RECR_SHEAM      -----------------PGVGPKSAQRMAFALLESDRKAGIRLADTLSRAMSDVGHCQKCRTFTEQSL-C
RECR_RHOBA      -----------------PGIGRKSAERLAFHLLRVHEDEALALASAIRRVRTDVRYCSVCYNLSETEL-C
RECR_MYCLE      -----------------PGIGPKSAQRIAFHLLSVEPQDIDRLTAVLVKVRDDVRFCTVCGNV-SDDERC
RECR_HAEIN      -----------------PGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQCRDFTEEDT-C
RECR_HAEIG      -----------------PGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQCRDFTEEDT-C
RECR_HAEIE      -----------------PGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQCRDFTEEDT-C
RECR_HAEI8      -----------------PGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQCRDFTEEDT-C
RECR_CLOAB      -----------------PGVGYKTAQRLTMHVLNLPKEEVEGFADALKKARGTIKYCSVCGNYTDTD-PC
RECR_ARTAT      -----------------PGVGPKSAQRLAFHILEADPEDMKRLVTAITTVKERVKFCTVCFNVTEQET-C
RECR_ACIF5      -----------------PGIGPRSAQRISYELLVRKRDLMPQLAAAFQQAHAVVRFCERCNNLSEAPL-C
RECR_ACIF2      -----------------PGIGPRSAQRISYELLVRKRDLMPQLAAAFQQAHAVVRFCERCNNLSEAPL-C
RECR_PELPD      -----------------PGVGERTALRLAFHLLKTPQNLTA-LSESLLEVKSRVRSCSICFAITEDD-PC
RECR_NOCFA      -----------------PGVGPKSAQRIAFHLLQVEPPEIDRLQAALQKVRDGVQFCVVCGTVSDGEL-C
RECR_MYCTU      -----------------PGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNE-RC
RECR_MYCTA      -----------------PGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNE-RC
RECR_MYCS2      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLGRIRDGVTFCSVCGNV-SDEERC
RECR_MYCBP      -----------------PGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNE-RC
RECR_MYCBO      -----------------PGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNE-RC
RECR_HAEPS      -----------------PGVGPKSAQRMAYHLLQRNRSGGVNLAKALSEAMTHIGHCKSCRTFTEED-EC
RECR_YERE8      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQSLTRAMSEIGHCADCRTFTEQE-HC
RECR_MYCPU      -----------------PGVGTKQAEKISFFLLKQNENEVEQIINSIVDLKKNIKECQNCNFLQSNNI-C
RECR_LACPL      -----------------PGIGGKTATRLAFYTIDMNGDDVTEFAKSLIAAKRDLHFCSICGNITEDD-PC
RECR_FINM2      -----------------PTIGRKSARRLAYRIIDMDPKKVDELVESIVNVKTNIRPCANCGNLTDKKL-C
RECR_SHESR      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDIGHCQSCRTYTEESL-C
RECR_SHESM      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDIGHCQSCRTYTEESL-C
RECR_SHESA      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDIGHCQSCRTYTEESL-C
RECR_PSEU5      -----------------PGVGQKTAQRMALQLLERDRSGGLRLAQALTRAMEGVGYCRQCRTLTEDEL-C
RECR_PSEMY      -----------------PGVGQKTAQRMALQLLERDRSGGQRLAQALNAAMEGVGHCKRCRSLSEDEV-C
RECR_POLSJ      -----------------PGVGVKSAARMAFHLLQHDKPGALQIARALEHAVNSVRHCTLCNTLTEQEV-C
RECR_MYCPA      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLARVRDGVRFCAVCGNV-SDDERC
RECR_MYCA1      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLARVRDGVRFCAVCGNV-SDDERC
RECR_GEOBB      -----------------PGVGEKSAQRLAFHLLKHPSN-IEALAQSLLQVGERVHLCSVCFAITEDD-PC
RECR_ENTS8      -----------------PGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEK-C
RECR_ACTP2      -----------------PGVGPKSAQRMAYHLLQRNRSGGINLSKALNEAMTHIGHCRSCRTFTEED-EC
RECR_YERPS      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_YERPP      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_YERPN      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_YERPG      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_YERPE      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_YERPA      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_YERP3      -----------------PGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQE-HC
RECR_THET2      -----------------PGIGPKTAQRXXXXXXXXXXXXXXXXXXXXXXX--RVRACRECGNLAEGEL-C
RECR_SHESW      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDVGHCQSCRTYTEETL-C
RECR_SHEPC      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDVGHCQSCRTYTEETL-C
RECR_RHOFD      -----------------PGVGVKSASRMAFHLLQHDRPGALALSRALQVAADQMRHCERCHTFTQADI-C
RECR_POLNA      -----------------PGVGAKSAARMAFHLLQHDKPGALQIARALEHAVQSIRHCALCNTLTEQEV-C
RECR_LACAC      -----------------PGIGEKTATRLAFYTMDMPQEDVEDFSKALIQVKQDIHQCPICGNITEKEI-C
RECR_SHEWM      -----------------PGVGPKSAQRMAFQLLERDRKAGQXXXXXXXXXXXDVGHCQACRTFTEETL-C
RECR_LACH4      -----------------PGVGEKTATRLAFYTMDMPEKDVEDFSKALIQVKNDIHQCPICGNITEKEV-C
RECR_GLOVI      -----------------PGIGPKTAQRLAFHLLRRPKSXXXXXXXXXXXXXXXIGVCSRCFNLSAED-PC
RECR_GEOSM      -----------------PGVGEKSALRLAFHLLKHPNN-IEALAQSLLQVGERVHLCSVCFAITEDD-PC
RECR_ERWCT      -----------------PGVGPRSAQRMAFQLLQRNRSGGMRLAQALTQAMSEIGHCSDCRTFTEQDV-C
RECR_CHLPN      -----------------PGIGFKTAEKLAFELISWDSEQLKILGNAFHNVASERSHCPLCFTLKSKEADC
RECR_SHEON      -----------------PGVGPKSAQRMAFQLLERDRXXXXXXXXXXXXXMSDIGHCQSCRTYTEETL-C
RECR_SHEB9      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDVGHCQSCRTYTEETL-C
RECR_SHEB8      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDVGHCQSCRTYTEETL-C
RECR_SHEB5      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDVGHCQSCRTYTEETL-C
RECR_SHEB2      -----------------PGVGPKSAQRMAFQLLERDRKAGXXXXXXXXXXMSDVGHCQSCRTYTEETL-C
RECR_PELPB      -----------------PGVGRKTAQRLAMYIXXXXXXXXXXXXXXXXXXKDNVIRCSVCQNITDVGVDC
RECR_GEOSF      -----------------PGVGDKTALRLAFHLLKSPDNLTA-LAESLLEVKAGVRFCSVCFGITEDD-PC
RECR_AERS4      -----------------PGVGPKSAQRMAFTXXXXXXXXXXXXAQLLNRALTEIGHCSHCRTFTENAL-C
RECR_ACIC5      -----------------PGIGTRSAQRLAFHILRSSTADAEALAGAVRDLKAQLRLCSVCNNITDVD-PC
RECR_PROVI      -----------------PGVGRKTARRLAMHVLQQPXXXXXXXXXXXXXXKDLVVRCSICQNVTDRDADC
RECR_MYCUA      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLAKVRDGVRFCAVCGNV-SDDERC
RECR_ACISJ      -----------------PGVGVKSAQRMAFHLLQHDRXXXXXXXXXXXXXXXXXRHCERCHTFTEGAV-C
RECR_ACIAC      -----------------PGVGVKSAQRMAFHLLQHDRQGAEVLSRALHDAAQSVRHCARCHTFTEGEV-C
RECR_SOLUE      -----------------PGIGQKSAQRLAFHVLRAKREDAEHLSQAILDVKDKLGLCAVCNNIADGEI-C
RECR_LACJO      -----------------PGIGEKTATRLAFYTMDMPEQDVEDFSKSLMQVKENLHSCSICGNI-TESDPC
RECR_CHRVO      -----------------PGVGPKTAQRMAFHLLQRDKQGXXXXXXXXXXXXTQLTHCQRCNTFSEAEL-C
RECR_PELCD      -----------------PGIGRKTAVRLTLFMLRQTSQDALALGEAVRELKERTRFCSRCFYFTEED-PC
RECR_HAHCH      -----------------PGVGAKTATRMALNLLERDQGRXXXXXXXXXXXXTRVKRCSRCQNFCEAEL-C
RECR_HAES2      -----------------PGVGPKSAQRMAYHLLQRDRSGGMNLAGALTEAMSKIGHCTHCRTFTEEE-SC
RECR_SHESH      -----------------PGVGPKSAQRMAFQLLERDRKAGQTLAQALASAMSDVGHCRSCRTFTEES-HC
RECR_HAES1      -----------------PGVGPKSAQRMAYHLLQRDRSGGMNLAGALTEAMSKIGHCTHCRTFTEEE-SC
RECR_DICNV      ------------------GVGKKTAQRMALDXXXXXXXXXXXXXXXXXXXXXXVQRCRYCRNL-SDAEVC
RECR_VEREI      -----------------PGVGVKSAQRMAFHLLQHDRAGGQALAQALHDALGSVQHCARCHTF-TEAETC
RECR_LACGA      -----------------PGIGEKTATRLAFYTMDMPEDDVEDFSKSLIQVKENLHSCSICGNI-TESDPC
RECR_MYCSS      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRIRDGVKFCEVCGNV-SDADRC
RECR_MYCSK      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRIRDGVKFCEVCGNV-SDADRC
RECR_MYCSJ      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRIRDGVKFCEVCGNV-SDADRC
RECR_FRAP2      -----------------PTIGKKSSQRLALYLLDKSPETAITIANSLLDAAENIKKCKYCQSLTEKDV-C
RECR_DESAP      -----------------PGIGPKTAQRLAFHLVTAPREAAESLSRAILEARDKLVFCRVCANIADEN-PC
RECR_SYNJA      -----------------PGIGSKTAQRLALHLLNRPAGEVXXXXXXXXXXXQTVKHCSICFNWSAED-PC
RECR_MYCVP      -----------------PGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNKVRDGVTFCAVCGNV-SDEERC
RECR_UNCTG      -----------------PGVGHKMAERLSYHILKMPQVEVDRLIDSIQNARRTMKCCSICCNLSEHD-PC
RECR_GEOUR      -----------------PSVGDKTALRLAFHLLKSPENL-SALAKSLLEVRDGVRFCSTCFGI-TESDPC
RECR_CHLFF      -----------------PGIGFKTAEKLAFELLDWEQDQLEALGKAFSELSIARSHCPCCFCLKNPESQC
RECR_CHLCV      -----------------PGIGFKTAEKLAFELLDWDQDQLEAMGQAFSEVSAARSHCSTCFCLKNPESNC
RECR_COLP3      -----------------PGVGAKSAQRMAFQLLERNRRGGSKLANTLAKAMTDIGHCQQCRNFTEEAL-C
RECR_MANSM      -----------------PGVGPKSAQRMAYHLLQRDRSGGMNLARALTEAMSKIGHCEHCRTFTEEDI-C
RECR_SYNJB      -----------------PGIGSKTAQRLALHLINRPAGEIXXXXXXXXXXXQTVRHCSICFNWSAED-PC
RECR_GEOSL      -----------------PGVGEKTALRLAFHLLKSPDNAAA-LADSLRDVMSRVRFCSVCFGITEDD-PC
RECR_XANC5      -----------------PGVGQKSAQRMAYHVXXXXXXXXXXXXXXXXNAVEKVGHCVQCRDFTESEI-C
RECR_RALSO      -----------------PGVGPKSAQRMAYHLLQHDXXXXXXXXXXXXXXXXXIHHCSRCNTFTEQDV-C
RECR_CHLAB      -----------------PGIGFKTAEKLAFELLDWDKDQLESMGKAFSELSAARSHCPTCFCLKSHPESC
RECR_GEOMG      -----------------PGVGEKTALRLAFHLLKY-PENTAALAESLGEVLSRVKFCSVCFGITEED-PC
RECR_LACDB      -----------------PGIGEKTATRLAFYAMDMPKEDVDEFAQALVDVKEKLRQCSVCGNITEQD-PC
RECR_LACDA      -----------------PGIGEKTATRLAFYAMDMPKEDVDEFAQALVDVKEKLRQCSVCGNITEQD-PC
RECR_COREF      -----------------PGVGPKSAQRIAFHLLNVDPDDITRLQDALGAVRDGVRFCRICCNISRDEV-C
RECR_CHLTR      -----------------PGIGFKSAEKIAFELLEWDPSQIEAMAQALQEFSTSHATCSNCFCLKSQTSPC
RECR_CHLTA      -----------------PGIGFKSAEKIAFELLEWDPSQIEAMAQALQEFSTSHATCSNCFCLKSQTSPC
RECR_AZOSB      -----------------PGVGPKSAQRMAYHXXXXXXXXXXXXXXXXXXXXEVLRHCQRCNNFSEEAV-C
RECR_AERHH      -----------------PGVGPKSAQRMAFTXXXXXXXXXXXXAQLLSRALTEIGHCSHCRTFTENER-C
RECR_CHLTB      -----------------PGIGFKSAEKIAFELLEWDPSQIEAMALALQEFSTSHATCSNCFCLKSQTSPC
RECR_CHLT2      -----------------PGIGFKSAEKIAFELLEWDPSQIEAMALALQEFSTSHATCSNCFCLKSQTSPC
RECR_ALISL      -----------------PGVGPKSAQRMAFHLLQRNRQGGMQLADALSRAMSEIGHCSECRTFTEEDT-C
RECR_THIDA      -----------------PGVGPKSAARMAYHLLQRDRRXXXXXXXXXXXXXXXXXXCRLCNNFSEAEV-C
RECR_CORDI      -----------------PGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICCNISREEV-C
RECR_CHLMU      -----------------PGIGFKSAEKIAFELLEWDPSQVEAMGLAMQEFSASHATCPDCFCLKSKTSSC
RECR_UREU1      -----------------PGVGTKNAKKWAFFLLQQDQKYIDDFIKRIKDAKTNIIKCKYCSNF-GNKDEC
RECR_CORGL      -----------------PGVGPKSAQRIAFHLLNVDPSDITRLQEALGGVRDGVQFCRICCNISREEV-C
RECR_ENTFA      -----------------PGIGQKTATRLAFYTIDMKEEDANAFAKALISVKRDLHFCSICGNITEED-PC
RECR_CORGB      -----------------PGVGPKSAQRIAFHLLNVDPTDITRLQEALGGVRDGVQFCRICCNISREEV-C
RECR_UREPA      -----------------PGVGTKNANKWAFFLLQQDQKYIDDLIKRIKEAKTNILKCKYCANF-TNKDEC
RECR_UREP2      -----------------PGVGTKNANKWAFFLLQQDQKYIDDLIKRIKEAKTNILKCKYCANF-TNKDEC
RECR_DESVM      -----------------PGLGPKSALRLAMTLLKWPASETRRLGRAVHDLRDNLHLCGRCGAL-TDVDPC
RECR_ANADF      -----------------PGIGEKTAQRLAFHILKAGPGYAGELAGAIAGVVRDVRLCSECQTLTDKD-PC
RECR_ALCBS      -----------------PGVGPRSAQRMAYALLDRGRESGRRLGDALHAAMDGVQHCERCRNYAQSTL-C
RECR_SYNFM      -----------------PGLGEKSATRIAMHLLKMSRTDAESLADAIRELRSRIRTCSRCFHF-TDAEEC
RECR_SYNWW      -----------------PGIGPKTAQRLALYILKLPEMEARQLAQAIVDCRQKVFPCSRCGYLTDFD-PC
RECR_AQUAE      --------------------------------------------------------CRECFLITDREV-C
RECR_HAEDU      -------------------------------------------AKALNEAMTHIGHCNACRTFTEEE-EC
RECR_NEIG1      -----------------PNVGPKSAQRMAYHLLQQKRKEAEELVDALQTALRQVCHCARCNTFCEGGL-C
RECR_NITSB      -----------------PSIGKKSAGRLAFHMVLHSPMDALKLAHAIEDAVSSIHRCTQCGGLSEDEL-C
RECR_NEIG2      -----------------PNVGPKSAQRMAYHLLQQKRKEAEELVDALQTALRQVRHCARCNTFCEGGL-C
RECR_HELPH      -----------------PNVGKKSAFKIAYHLGLENPYLALKITHALENALENLKTCTSCNALSESEV-C
RECR_CORJK      -----------------PGIGPKSAQRIALHLLNEEPEDIERFQSALGRLQRGVTFCRICHNISQEDV-C
RECR_HELPY      -----------------PNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKTCSSCNALSESEV-C
RECR_HELPG      -----------------PNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKTCSSCNALSESEV-C
RECR_HELP2      -----------------PNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKTCSSCNALSESEV-C
RECR_DESAD      -----------------PGLGPKSALRIALTMLKMPKEKVTGIGQSVIDLREKLCICEQCASI-TDTCPC
RECR_HELPJ      -----------------PNVGKKSAFKMAYHLGLENPYLALKITHALRNALENLKTCASCNALSETEVS-
RECR_GLUOX      -----------------------------------------PLAHLMERAATRVKTCSLCGNLDTVD-PC
RECR_CAMJD      -----------------PTIGKKTAIRLAYHLINNQIDGMK-LAHNIENAIRFIKPCEQCGALSENEL-C
RECR_HELPS      -----------------PNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKRCASCNALXXXXXXX
RECR_CAMJJ      -----------------PTIGKKTAIRLAYHLINNQIDGMK-LAHNIENAIRFIKPCEQCGALSENEL-C
RECR_CAMJE      -----------------PTIGKKTAIRLAYHLINNQIDGMK-LAHNIENAIRFIKPCEQCGALSENEL-C
RECR_CAMJR      -----------------PTIGKKTAIRLAYHLINNQIDGMK-LAHNIENAIRFIKPCEQCGALSENEL-C
RECR_CAMJ8      -----------------PTIGKKTAIRLAYHLINNQIDGMK-LAHNIENAIRFIKPCGQCGALSENEL-C
RECR_HELAH      -----------------PNVGKKSAFKMAYHLGLENPYLALKLTHALENALENLKTCTSCNALXXXXXXX


                         .         .         *         .         .         .         .:140
query           NNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVI
RECR_PELUB      NNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVI
RECR_JANSC      EICMDVRRATGEICVVEDVADLWAMERGQAFKGRYHVLGGTLSALDDGPEDLRIPKLRARMADEGITEVI
RECR_MARMM      TVCAAPNRLDAAICVVETVGDLWALERAGAFKGRYHVLGGVLSALGVRPEDLNITKLVERSAREEVSEIV
RECR_SILST      ALCEDETRANGELCVVEDVADLWAMERAGVFKGRYHVLGGTLSALDAGPEDLRIPRLVDRVSTEGVSEVI
RECR_SILPO      DICTDERRATGELCVVEDVADLWAMERSGVFKGRYHVLGGTLSALGVGPDELRIPRLADRVTAEAISEVI
RECR_NOVAD      GICTDHRRDQRSICVVEEVADLWALDRARLFTGKYHVLGGRLSALGVRPEDLTIGSLLDRVAQGGIDEVV
RECR_BEII9      TICADAKRDPTLLVVVETVADLWALERAAALPARYHVLGGTLSPLGVGPKDLNLQSLTERVAQGEIREVI
RECR_RHOS5      DICRDDRRATGELCVVEDVADLWALERAGVFRGRYHVLGGVLSALDSGPDELRIPRLAERVRDEGISEVI
RECR_ROSDO      DICTCEKRANGELCVVEDVADLWAMERSGIFKGRYHVLGGTLSALAVGPQELRIPRLLDRVPSEGITEVI
RECR_METRJ      TICRDAERDPTTLVVVEDVSDLWALERSGAVKARYHVLGGVLSALGVRPEHLNLASLVERVARPEVTEVI
RECR_RHOSK      GICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSGPEELRIPRLAERVREEGISEVI
RECR_RHOS4      GICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSGPEELRIPRLAERVREEGISEVI
RECR_RHOS1      GICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSGPEELRIPRLAERVREEGISEVI
RECR_ZYMMO      SICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALGITPEDLSIDALVKRVQSGKIKEVV
RECR_PARDP      PICEDPDRATGEICVVTDVADLWALERGRAFHGRYHVLGGSLSALDEGPEDLRIPQLIARIAEEGITEVI
RECR_NEOSM      SICRSTKRSSDIVCVVEEITDLWAIEKAGVHNGRYHVLNGALSIVGITPETLQIEKLKRRVSSGAVKELI
RECR_SPHWW      GICADPRRDARMLCVVEEVADLWALDRSRLFPGRFHVLGGRLSALGIRPEDLSIDLLIGRIAAGGIDEVV
RECR_ORITI      NICKHSERDSSTIAVVESVADLWALERSKVFKGWYHVLGKTLSSGNDAVNSLKLPKLLNRIREYKVQEII
RECR_METEP      TICRDETRDPTTLVVVEDVSDLWALERSGAVKARYHVLGGVLSALGVRPEHLTIARLVERAGEPGVKEII
RECR_METC4      TICRDETRDPTTLVVVEDVSDLWALERSGAVKARYHVLGGVLSALGVRPEHLTIARLVERAGEPGVKEII
RECR_ERYLH      GICADPRRDRKSICVVEDVADLWALDRARLFTGRYHVLGGKLSALGVRPEDLNIANLLGRVEEGGIDEVV
RECR_SPHAL      AICADPRRDARSLCVVEEVSDLWALDKSRLFPGKYHVLGGRLSALGVRPQDLSIDALVTRVAAGGIDEVV
RECR_RICBR      GICTSEYRDKSVIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLDRCFKENIKEVI
RECR_RICB8      GICTSEYRDKSVIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLDRCFKENIKEVI
RECR_METSB      TICRDERRDPSTLIVVETVGDLWALERSGAVKGRYHVLGGVLSPLGVGPKDLNISSLIERVAAGGISEVV
RECR_RICAH      SICSSKYRDKSVIAVVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLKRCFAENIKEVI
RECR_RHIME      TVCTDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLGIGPEDLNIRGLIDRVAKGGVRELI
RECR_ORITB      NICRHSERDSSIIAIVESVADLWALERSKVFKGWYHVLGKTLSSGNDAINSLKLPKLLNRIREYKVQEII
RECR_METPB      TICRDETRDPTTLVVVEDVSDLWALERSGAVKARYHVLGGVLSALGVRPEHLTIALLVERASAPGVKEII
RECR_DINSH      DICTSEKRATGEICVVEDVADLWAMERAGVFKGRYHVLGGTLSALDAGPEELRIPKLRDRAVSEGATEII
RECR_RICFE      I-CSSEYRDKSVIAVVETVAELWAMERSSNFKGLYHVLGHNLSAASRQNPSILLPELLKRCFAENIKEVI
RECR_RHIL3      IVCTDVQRDQSVIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLGVGPDDLNIRGLIDRVGEGGIRELI
RECR_AGRVS      TVCTDERRDQSMIIVVEDVSDLWALERAGAMNVAYHVLGGTLSPLGVGPDDLNIKGLIDRVAKGGVREII
RECR_METNO      TICRDHSRDPSILVVVEDVSDLWALERSGAVTARYHVLGGVLSALGIRPENLNLSRLVERASVPEMREVI
RECR_MESSB      TICTDPRRESATLIVVEDVSDLWALERAAALNARYHVLGGTLSPLGVGPDDLNIKGLVSRIAEGGVSEVI
RECR_METS4      TICRDHGRDPSMLVVVEDVSDLWALERSGAVTARYHVLGGILSALGIRPENLNLARLVERASVPEMREII
RECR_RICM5      RICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLKRCFAENIKEVI
RECR_RHIEC      XXXXXQRDQ-SVIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLGIGPDDLNIRGLIDRVGEGGIRELI
RECR_XANP2      TICTDTSRDRRTLVVVADVGDLWALERAGVLNAPYHVLGGVLSPLGVGPEDLNLAKLVTRVHEDEVGEVI
RECR_RICRS      RICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLTRCFAENIKEVI
RECR_RICRO      RICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLTRCFAENIKEVI
RECR_RICPU      RICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVFGHNLSAASRQNPSILLPELLTRCFAENIKEVI
RECR_RICAE      RICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNPSILLPELLTRCFAENIKEVI
RECR_RHILO      MICTDPRRDAGTIIVVEDVSDLWALERAAAMNVRYHVLGGTLSPLGIGPDQLNIRSLIDRVAGGEVKEII
RECR_PARL1      AICADELRDPHILCIVEEVGDLWALERAGAHKGRYHVLGGVLSALGVGPDDLNIGRLVERLTGGEVREVV
RECR_BARBK      SICTDPRRDNGTIIVVEDISDLWALERAGTLLARYHVLGGRLSPLGIGPDELNITSLINRVIKDPITEII
RECR_RICCN      RICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSATSRQNPSILLPELLTRCFAENIKEVI
RECR_OLICO      TICSDPRRDPAIIVVVADVSDLWALERAHATQGRYHVLGATLSPLGIGPQDLTIDALVTRAQVPEVTEII
RECR_BARQU      SICRDPRRDDTTIIVVEDVADLWALERARTLAARYHVLGGRLSPLGIGPDELNITSLVQRVVQNPIMEII
RECR_CAUCR      AVCADGSRDGRLLCVVEEVGSVWAMERGGSFKGRYHVLGGLLSALGIGPEALRIGELVGRVADGSVAEVI
RECR_CAUCN      AVCADGSRDGRLLCVVEEVGSVWAMERGGSFKGRYHVLGGLLSALGIGPEALRIGELVGRVADGSVAEVI
RECR_BART1      SICTDSRRDDTTIIVVEDIADLWALERAKTLAARYHVLGGRLSPLGIGPDELNIATLIQRVVQNPITEII
RECR_SINMW      TVCGDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLGIGPEDLNIRALVDRVAKGGVRELI
RECR_RICPR      HICSSEYRDKSTIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPRILLPELLKRCFVENIKEVI
RECR_HYPNA      AVCQMPGRDDGIICVVEDVPDLWALERGGSFRGRYHVLGGALSAIGIGPEDLGIASLVARVDAGGVREVI
RECR_BARHE      SICTDPRRDDATIIVVEDIADLWALERAKTLAARYHVLGGKLSPLGIGPDELNIAPLIQRVVQNPITEII
RECR_RICTY      HICSSEHRDKSTIAIVETVAELCAMERSGNFKGLYHVLGHNLSAASRQNPRILLPELLKRCFVENIKEVI
RECR_EHRCR      SICSDTKRDHQLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIGIGPDQLNLDSIVERIKKFNVQEVI
RECR_AGRT5      TVCADDRRDQSVIIVVEDVSDLWALERAGAMNTAYHVLGGTLSPLGVGPEDLNIKGLIDRVSAGGIRELI
RECR_AGRRK      TVCTDGHRDQSVIIVVEDVADLWALERAAAMNAAYHVLGGVLSPLGVGPDDLNIRGLIQRVGEGGVREII
RECR_MAGSA      AICADHRRDPSMLCVVEDVAGLWAMERTGSFKGRYAVLGGLLSALGVGPEDLGIESLVARALDPAITEII
RECR_ACICJ      MICADAARE-PLICVVETVADQWALERAAVYRGRYHVLGGLLSAAGHGPEDLGIDRLVARLDG-SVREVI
RECR_EHRCJ      SICSDTKRDHQLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIGIGPDQLNLDNIVERIKKFDIKEVI
RECR_OCHA4      TICTDERRDPTTLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVSTGEIKEVI
RECR_CAUSK      AICSDAARDNRLLCVVEEVGSLWAMERGGSFKGRYHVLGGLLSALGVGPEALRVGELLGRAKGGEVSEVI
RECR_BRASO      TVCTDPRRDPAMIXXXXXXXXLWALERAKASNGRYHVLGGTLSPLGVGPQDLTIDALVQRAHAPEVSEII
RECR_BRASB      TVCTDPRRDPAMIXXXXXXXXLWALERAKASNGRYHVLGGTLSPLGVGPQDLTIDALVQRAHAPEVSEII
RECR_SACD2      NICSNARRNRKELCIVETPADVIAIETSAVFSGYYFVLLGRLSPIGIGPKEIGMDVLASRFAEGEIEEVI
RECR_RHOPT      TVCTDPRRXXXXXXXXXXXXXLWALERASATNGRYHVLGATLSPLGVGPEDLTIDALVKRAHDPGVAEII
RECR_RHOPA      TVCTDPRRXXXXXXXXXXXXXLWALERASATNGRYHVLGATLSPLGVGPEDLTIDALVKRAHDPGVAEII
RECR_NITWN      TICTDARRDPSXXXXXXXXXXLWALERAGATNGFYHVLGATLSPLGVGPQDLTIDALVARAHDPRVAEIV
RECR_BRUME      TICTDERRDPATLIVVEDVSDLWALERADTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUMB      TICTDERRDPATLIVVEDVSDLWALERADTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUSU      TICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUSI      TICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUO2      TICTDERRAPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUC2      TICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUAB      TICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_BRUA2      TICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLGIGPDDLNIKGLVERVASGAIKEVI
RECR_WOLPM      SICTNPKRDTKLLCVVEELGDLWAFEKGNIYSGLYHVLGGRLSAIGIGPKELNLDTILKRVTESKIEEII
RECR_RHOPS      TVCTDPRRDPSXXXXXXXXXXLWALERASATNGRYHVLGATLSPLGVGPDDLTIDALVARAHDPAVSEII
RECR_NITHX      TVCTDMRRDPSXXXXXXXXXXLWALERAGATNGFYHVLGATLSPLGVGPQDLTIDALVSRAHDPRVTEIV
RECR_DEHE1      PICQNTKREANKICVVEQPQDILALEHVGVYRGYYHVLHGAISTEGITSQNIRINELMSRLNDGQVDEVI
RECR_RHIE6      TVCTDAQRDQSVIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLGIGPDDLNXXXXXXXXXXXXXXXXX
RECR_PSYCK      PLCQDPRRDDTLLCVVETAADVMAIEQTAGYRGRYFVLGGHLSPIGISADDLNIEQLVWRVKQEPVEELI
RECR_DEHSC      PICQNTKRETNKICVVEQPQDILALEHVGVYRGYYHVLHGAISTEGITSQNIRINELMVRLDNGQVEEII
RECR_DEHSB      PICQNTKRETNKICVVEQPQDILALEHVGVYRGYYHVLHGAISTEGITSQNIRINELMVRLDNGQVEEII
RECR_PSYA2      PLCQDPRRDDALLCVVETAADVMAIEQTAGYRGRYFVLGGHLSPIGISADDLNIEQLVWRVKQEPVEELI
RECR_RHOP5      TVCTDPRRDPXXXXXXXXXXXLWALERAHASNGRYHVLGATLSPLGVGPQDLTIDALVARAHDPQVSEIV
RECR_RHOP2      TVCTDPRRDPSXXXXXXXXXXLWALERASATNGRYHVLGATLSPLGVGPDDLTIDALVARAHDPAVGEII
RECR_RHISN      TVCTDERRDRSVIIVVEDVADXXXXXXXXXXXXXYHVLGGTLSPLGIGPDDLNIKGLVDRVAKGGVRELV
RECR_WOLTR      SICTNPKRDTKLMCVVEELGDLWAFEKGSIYSGMYHVLGGRLSAIGIGPEKLNLDNIPKRVTEFKIEEVI
RECR_RICCK      RICSSEYRDKSVIAIVETVAELWAMERSGNFKGLYHVLGYNLSAASRKNPSMLLPELLTRCFAANIKEVI
RECR_ROSCS      AICANPARDQRIVCVVEEPLDVVAIERTGVYRGLYHVLHGRIAPLGMNREDIYFDELLDRVRAEPIDEVI
RECR_RHOPB      TVCTDPRRDPSXXXXXXXXXXLWALERAHAASGRYHVLGATLSPLGVGPDDLSIDALVARAHDPQVSEIV
RECR_ACIAD      DICLSNDRDQHLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLGIGPEEIGIPYLIQRLSSGEIEEVI
RECR_PSYWF      PICVDPRRDDSVLCVVETAADVMAIEQAAGYRGRYFVLGGHLSPLGINADDLNIDQLVNRVKTAPVDEII
RECR_DESRM      SICQDTTRNSNLLCVVEEPRDVIAMEKARGYRGYYHVLHGAISPMGIRPEDLTIKELLHRLQNGDIQEVI
RECR_CYTH3      AICTSNKRDKRVVCIVEDIRDVLAIENTNQYFGVYHVIGGVISPMERIGPDQLINSLIERVITDTIKEII
RECR_RHORT      SICADPRRDGTLICVVRDVADLWALERGGVFSGRYHVLGGLLSAIGVGPEDLGLDRLAARVAEGPVVEVI
RECR_PROM2      EICKNTQRNQKLICVVAETKDLLALERAREFKGVYHVIGGLISPMDSVGPELLIRSLVERVSKSEIDEII
RECR_AMOA5      SICANPHRDTGLICVVENIQDVIAIENTAQYKGIYHVLGGLISPVGIGPEQLYIEHLVQRVQQEQPQEII
RECR_PROMS      EICRNTERNQKLICVVSETKDLLALERAREFKGVYHVIGGLISPMDSVGPELLIRSLVERVSKSEIDEII
RECR_PROM5      DICRNAERNQNIICVVAETKDLLALERAREFKGVYHVIGGLISPMDSIGPEILIRSLVERVSKSEIDEII
RECR_PROMP      EICRNTERNQKIICVVAETKDLLALERSREFKGTYHVIGGLISPMDSISPELLIRSLVERVSKSDIDEII
RECR_PROM0      EICRNTERNQKLICVVAETKDLLALERAREFKGVYHVIGGLISPMDSVGPELLIRSLVERVSKSEIDEII
RECR_CHRSD      SICEDARRDEGLLCVVESPADMLAIEQAGGFRGLYFVLHGHLSPLGIGPEDIGLDQLDERLAGGSVEEVI
RECR_ANOFW      YICEDDKRDRSIICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMGIGPEDIKIAELLRRLQDETVQEVI
RECR_SYNPW      EICRNPERANGQICVVADSRDLLALERTREFSGHYHVLGGLISPMDGIGPDLLISSLVKRVAANNTEEVI
RECR_AZOC5      TVCTDIHRDSSVLVVVAEVADLWALERANAINAKYHVLGGVLSPLGVGPDDLNLTKLVERVGAGGVNEVI
RECR_PROM9      EICKNTERNQKLICVVAETKDLLALERAREFKGVYHVIGGLISPMDSVGPELLIRSLVERVSKSEIDEII
RECR_LEGPH      ALCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLGLGPDDIGLPKLKELITREKIQEVI
RECR_FUSNN      NICSDNARDHRIICVVEESKDIMILEKTTKFRGVYHVLNGRLDPLGITPNELNIKSLLERIAKDDIEEII
RECR_BACTN      QICANPQRDASTVCVVENIRDVMAVEATQQYRGLYHVLGGVISPMGVGPSDLQIESLVQRVSEGGIKEVI
RECR_RHILW      XXXXXQRDQ-SIIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLGIGPDDLNXXXXXXXXXXXXXXXXX
RECR_LEGPL      TLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLGLGPDDIGLPKLKELIIREKIQEVI
RECR_LEGPC      TLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLGLGPDDIGLPKLKELIIREKIQEVI
RECR_LEGPA      TLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLGLGPDDIGLPKLKELIIREKIQEVI
RECR_STAAW      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAAT      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAAS      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAAR      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAAE      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAAC      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAAB      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAA8      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAA3      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKNDEVSELI
RECR_STAES      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPALVERLKNDEVKELI
RECR_STAEQ      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPALVERLKNDEVKELI
RECR_STAAN      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKSDEVSELI
RECR_STAAM      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKSDEVSELI
RECR_STAA9      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKSDEVSELI
RECR_STAA2      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKSDEVSELI
RECR_STAA1      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLIERLKSDEVSELI
RECR_NITOC      SLCADSRRDRGQLCVVEMPSDVQAIEQATSYSGRYFVLMGHLSPLGVGPEALGMDLLAKRLDTDQIREVI
RECR_MAGSM      AICQDSKRDHGLICVVEEPVDVLAMERAGAYRGLYHVLGGRLSPMGIGPDALYLDALLERLQQGGVRELI
RECR_MACCJ      YICEDKTRDQSMICVVEETKDVIAMEKMREYKGLYHVLHGAISPMGVGPEDINVPSLLTRLRDEHIQELI
RECR_THICR      GFCASKSRQTDQLCIVETPTDVVAIEQSGIYKGQYFVLMGHLSPIGIGPDELGLPILRDRLAQGEIQELI
RECR_GRAFK      EICANPSRVSEIVCVVEDIRDVMAIENTGQYRGHYHVLGGKISPMGIGPSQLTIKPLIEKVQAGKIDEII
RECR_CYAP7      EICRNPNRDNQTLCVVADSRDVIALEKTREYQGKYHVLGGVISPMGIGPEQLNISPLVRRVSQHQIKEVI
RECR_STRAW      NICRDPRRDLSVICVVEEPKDVVAIERTREFRGKYHVLGGAISPIGVGPDDLRIRELLARLADGTVTELI
RECR_STAHJ      YICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPTLIDRLKDEEVKELI
RECR_BIFAA      PVCADPRRDHSVICVVEEPKDVMSIERTREYRGMYHVLGGVINPANVQPSDLNIAKLIERLKDSEVKEVI
RECR_PROAC      QYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLGKGPADLHIRELCQRLADETVTEVI
RECR_PROMM      DICRDGKRCDQLLCVVADSRDLLALERTREYKGRYHVLGGLISPMDGIGPDMLIPSLIQRVDRDGISEVI
RECR_BRAHW      DICSNDKREHNKICIVESYPDMLAIEKTEEYNGVYHILGGLISPKGIGISDIRIKELIERVNNNSIEEIM
RECR_ANAMM      SICSDKGRDQSIICVVEELGDLWAFERGRIYSGVYHVXXXXXXXXXXGPEDLNLGGIVDRIRTHGVKEVI
RECR_STACT      YICNDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGAISPMGIGPEDINIPSLIERLKDEEVKELI
RECR_LEIXX      SICRDPRRDPALICVVEEAKDVVAIERTREFRGLYHVLGGAISPIGVGPDDLRIRQLVQRLADGTVQEVI
RECR_BACHD      RICEDSKRDESVICVVQDAKDVIAMEKMKEYHGKYHVLHGAISPMGIGPEDIKIPELIKRLQDDTIQEVI
RECR_SYNS9      EICSKPERNNGLICVVADSRDLLALERTREFKGQYHVLGGLISPMGIGPELLHIKPLIERIAKDGISEVI
RECR_SYNR3      DICRNPERNIGVICVVADSRDLLALERTREFSGSYHVLGGLISPMGIGPEALGIQPLLQRLDPEQVEEVI
RECR_STAS1      YICQDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMGIGPEDINIPSLINRLKDEEVKELI
RECR_STRCO      NICRDTRRDPSVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIGVGPDDLRIRELLARLADGSVTELI
RECR_FRATM      NICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLNILQQIIADRKIDEVI
RECR_FLAPJ      EICSNKNRNHQIVCVVEDVRDVMAIENTGQFRGVYHVLGGKISPIGVGPSQLNISSLVEKVKSGSVSEII
RECR_CLOTH      PLCSSEKRDSSVICVVEDPRDVVAMEKIREFKGLYHVLHGAISPMGIGPEDIKIKELLDRIKEGNVKEVI
RECR_BRAJA      TVCTDPKRDPXXXXXXXXXXXLWALERANATQGRYHVLGATLSPLGVGPQDLTIDXXXXXXXXXXXXXXI
RECR_SYNS3      EICRNPERSIGMLCVVADSRDLLALERTREYAGRYHVLGGLISPMGIGPEMLQISNLVKRVAADEINEVI
RECR_PORGI      TICADPTRDQSTLCVVENIRDVMAIENTSQYRGLYHVLGGVISPMGIGPGDLQIDSLVHRVASEQIHEVI
RECR_PORG3      TICADPTRDQSTLCVVENIRDVMAIENTSQYRGLYHVLGGVISPMGIGPGDLQIDSLVHRVASEQIHEVI
RECR_FRATN      NICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGVGPSELKLDILQRIIADRKIDEVI
RECR_CYAP8      EICRNPNRDKQTICVVADSRDVIALEKTREYKGRYHVLGGVMSPMGIGPEQLYIQPLVRRVTQDGVKEVI
RECR_METCA      EYCASPGRDRSLLCIVESPAEVLAISRSTGYKGLFFVLNGRLSPLGIGPEELGLDVLEQRLKDDGVAELI
RECR_COXBU      NICNNPKRDSTLLCVVESPADVVAIEQTQIYSGRYFVLHGHLSPLGIGPQEIGIPALLDRLRNETIKELI
RECR_BACP2      YICEDTRRDQSVICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMGIGPEDIKIPDLLKRLQDDQVTEVI
RECR_BACLD      YICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMGIGPEDIKIPELLKRLQDDQVTEVI
RECR_THEFY      RICRDPRRDDTVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIGVGPDDLRVKELMARLSEGRVTEVI
RECR_GEOSW      YICKDERRDRTTICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMGIGPEDIKIAELLKRLQDEAVQEVI
RECR_FRATO      NICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLDILQQIIADRKIDEVI
RECR_FRATH      NICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLDILQQIIADRKIDEVI
RECR_FRATF      NICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLDILQQIIADRKIDEVI
RECR_BACSU      YICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMGIGPEDIKIPELLKRLQDDQVTEVI
RECR_PROM3      DICRDGTRCDQLLCVVADSRDLLALERTREYKGRYHVLGGLISPMDGIGPDMLIPSLIQRVDRDGISEVI
RECR_NATTJ      TICQDESRDSNLICVVQDARDVTAIEKVQDFQGKYHVLQGVISPMGIGPDDLNLKALMDRIQGEGITELV
RECR_GRABC      SVCTDPSRENGLICVVESVGDLWAMDRAGIYRGLYHVLGGVLSAAGTGPDALNWPALMRRISATPVTEVI
RECR_FRATT      NICSNTNRDNTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLDILQQIIADRKIDEVI
RECR_FRAT1      NICSNTNRDNTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLDILQQIIADRKIDEVI
RECR_BACFR      QICANPQRDASMVCVVENIRDVMAVEATQQYRGLYHVLGGVISPMGVGPGDLQIESLVRRVAEGGINEVI
RECR_BACFN      QICANPQRDASMVCVVENIRDVMAVEATQQYRGLYHVLGGVISPMGVGPGDLQIESLVRRVAEGGINEVI
RECR_ARTS2      NICRDPRRDPSIICVVEESKDVLAVERTRSFRGRYHVLGGAINPAGVGPEQLRIRELLTRLNDGAIQEII
RECR_FRATW      NICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLGIGPSELKLDILQQIIADRKIDEVI
RECR_CLOTE      AICSNPNRDKNTICVVEHPKDIMTMEKVREYNGMYHVLHGTISPAGRGPNDIKLKELISRINGE-IKEVI
RECR_BACA2      YICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMGIGPEDIKIPELLKRLQDDQVTEVI
RECR_ALKOO      NICSDERRDPLLICVVEDPRDVVAMERTKEFKGYYHVLHGAISPLGIGPEDIKIKELLVRLSAQSADEVI
RECR_THEP3      NICSDKERDHSLICVVSHPMDVVAMEKIREYKGVYHVLHGVISPIGVGPEDIKIKELLDRVKNGNVKEVI
RECR_FLAJ1      EICANSVRNHQTICVVEDIRDVMAIENTGQYKGIYHVLGGKISPEGVGPSQLNISSLVEKVKSGKVVEII
RECR_CLONN      AICSNPNRDESIICVIEQPKDIMSLEKIREYNGTYHVLHGVISPSGKGPEDINLKGLIRRIN-ENVKEVI
RECR_CLAM3      GICRDPRRSPATICVVEEAKDVVAIERTREFRGLYHVLGGAISPIGIGPDDLRIRQLMQRLADATVTEVI
RECR_CALS8      HICSDDKRDRSIICVVEEPQDVVALEKVKEYKGLYHVLHGAISPLGKYPEQLTIDVLLKRLADTNVKEVI
RECR_XYLFT      AICANSSRDRHQLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLGIGPHELGLDHLGQRLAAGEVTELI
RECR_THEPX      NICSDKERDHSLICVVSHPMDVVAMEKIREYKGVYHVLHGVISPIGVGPEDIKIKELLDRVKNGNVKEVI
RECR_SYNSC      EICRNPERRNGVICVVADSRDLLALERTREFHGRYHVLGGLISPMGIGPELLRVTELVQRISNEEISEVI
RECR_SYNPX      EICRNPERRNGLICVVADSRDLLALERTREFQGRYHVLGGLISPMGIGPELLHVTPLVARINQEDITEVI
RECR_LISW6      YICSDTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMGIGPEDINIPDLLKRLQDDTIEEVI
RECR_FRASC      RICSDPRRDPSSICVVEEPKDVVAIERTREFRGRYHVLGGAINPGGVGPDDLHIRELVARLADGTVTELI
RECR_BACCN      YICDDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLQDETVQEVI
RECR_LISMO      YICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMGIGPEDINIPDLLKRLQDDTIEEVI
RECR_LISMH      YICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMGIGPEDINIPDLLKRLQDDTIEEVI
RECR_LISMF      YICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMGIGPEDINIPDLLKRLQDDTIEEVI
RECR_LISMC      YICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMGIGPEDINIPDLLKRLQDDTIEEVI
RECR_GEOKA      YICKDERRDRTTICVVQDPKDVIAMERMKEYNGLYHVLHGAISPMGIGPEDIKIAELLTRLQDETVQEVI
RECR_CHLTE      HICTSAGRDRSVICVVESPTEVLAFEKTGHYKGLYHVLHGVISPLGVGPDDIKVRELIARISTGGVREVV
RECR_MARAV      QICEKPERRNGTLCVVESPSDLLAIEQAGDYKGSYFVLMGHLSPIGVGPEEIGIERLLDRVRREGVTELI
RECR_LISIN      YICSDTSRDRSVLCVVQESKDVIAMEKMRDFHGLYHVLHGTISPMGIGPEDINIPDLLKRLQDDTIEEVI
RECR_GEOTN      YICKDERRDRTMICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMGIGPEDIKIAELLARLQDETIQEVI
RECR_SYNY3      DICRHPQRDNSVICVVSDPRDVIALEKTREFRGKYHVLGGVISPMGIGPEQLTIQPLLHRVSQPEIKEVI
RECR_SYNP6      NICRDPKRDAQTICVVADPRDVIALEKTREYKGLYHVLGGLISPMGIGPEQLTVQALVRRVAQEQTQEVI
RECR_SYNE7      NICRDPKRDAQTICVVADPRDVIALEKTREYKGLYHVLGGLISPMGIGPEQLTVQALVRRVAQEQTQEVI
RECR_OCEIH      AICTDTSRDGSLICVVQDPKDVIAMEKMKEFHGKYHVLHGAISPMGIGPEDINVPDLINRLKDEEVEELI
RECR_NITMU      ELCSSQRRDPALLCVVEMPADLLMMEQAHCYKGMYFVLMGRLSPLGIGPREINLDRLLKRARDNMVKEVI
RECR_MOOTA      RLCSDPERDHSCICVVEEARDIIALEKTRQYRGLYHVLQGAISPVGIGPEQLRVKELLARLHDGKVKEVI
RECR_CHLPD      VLCRSSGRDRTVICVVESPVDLLAFEKTGHYKGLYHVLHGVISPLGIGPDDIKVRELLARVSRPEVREVV
RECR_CLOPS      AICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMGRGPQDIRIRELVARMSGD-VKEVI
RECR_CLOPE      AICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMGRGPQDIRIRELVARMSGD-VKEVI
RECR_CLOP1      AICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMGRGPQDIRIRELVARMSGD-VKEVI
RECR_CLOK5      AICSNPNRDKSIICVIEEPKDIMSMERIKEYNGVYHVLHGNISPAGRGPEDIKLRELIRRINGD-VNEVI
RECR_CLOK1      AICSNPNRDKSIICVIEEPKDIMSMERIKEYNGVYHVLHGNISPAGRGPEDIKLRELIRRINGD-VNEVI
RECR_HERA2      TICTNANRNERQVCVVEEPLDVVALERTGEFKGLYHVLHGAISPVGINPEDLRIRELLARLRVEPIEEVI
RECR_BREBN      HICRDKRRDGSIICVVQEPRDVVAMEKTREFEGYYHVLHGAISPMGIGPEDIRIPDLLKRLGDEQVKEVI
RECR_TROWT      VICSDPRRDRGVICVVEEPKDVVAIEKTREFSGLYHVLGGAISPIGVGPDDLNIRQLLQRLADGTITEVV
RECR_TROW8      VICSDPRRDRGVICVVEEPKDVVAIEKTREFSGLYHVLGGAISPIGVGPDDLNIRQLLQRLADGTITEVV
RECR_FRAAA      RICADPRRDQALICVVEEPKDVVAIERTREFRGRYHVLGGAINPGGVGPDDLHIRELVARLADGTVTELI
RECR_CHLSY      AICLDPSRDQTKICVVEEPLDVLAIERTGAYRGLYHVLHGHIAPLGIYREDLKIEELLARVRSEPVQEVI
RECR_CHLAD      PICRDPSRDQTKICVVEEPLDVLAIERTGAYRGLYHVLHGHIAPLGIYREDLKIDELIARVRSEPVNEVI
RECR_CHLAA      AICLDPSRDQTKICVVEEPLDVLAIERTGAYRGLYHVLHGHIAPLGIYREDLKIEELLARVRSEPVQEVI
RECR_BACWK      YICDDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLQDETVQEVI
RECR_XYLFA      AICANYSRDRHQLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLGIGPHELGLDHLGQRLAAGEVTELI
RECR_CHLT3      NICTSVKRDKRVVCVVEAPNDVLAFEKTNQYNGLYHVLHGVISPLGVGPDDLKVKELIHRLSETDIKEVI
RECR_ALKMQ      NICSDPNRKKSVICVIEDPRDVVAMERTREFKGQYHVLHGAISPLGIGPEEINIKELLIRLQEHPVEEVI
RECR_RUBXD      DICRDPRRDRSVICVVEDPYDIGPIERTGEYRGLYHVLGGALSPLGVEPEDLRIAELVERVRSEGTRELI
RECR_HALHL      GLCASPQRRRTLLCVVESSADVFALEQATDFQGLYFVLGGALSPLGIGPEELGLDRLQQRLEAGEVEEII
RECR_CLOD6      SMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQYHVLNGVISPMDGIGPDMLIKELIQRLGNQEVKEII
RECR_PSYIN      AICDNDKRNKNMICVVEMPVDVLAIEQTALFSGTYFVLMGHLSPLGVGPEQLGLNLLDKQLSSGQHSEVI
RECR_MYXXD      NFCRDARRDERVLCVVETFADLMALERTREFKGRYHVLHGVLSPLGVGPDQLRIRELLERLNDSRVEELI
RECR_BACAN      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGGGPEDINIPQLLKRLHDETVQEVI
RECR_BACAC      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGGGPEDINIPQLLKRLHDETVQEVI
RECR_BACAA      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGGGPEDINIPQLLKRLHDETVQEVI
RECR_LEUCK      AICQDKSRDQSTVFVVENSRDVMAMENTRDYYGLYHVLNGVISSAGTGPEDINLPSLIRRLSHQEINEVI
RECR_BACHK      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACCZ      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACCR      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACCQ      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACC7      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACC4      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACC3      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACC2      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACC1      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACC0      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_BACAH      YICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMGIGPEDINIPQLLKRLHDETVQEVI
RECR_DESOH      AICGDPDRNASLLCVVEGPTEVMAIEKTAAFKGVYHVLHGVLSPMGIGPDDIRIRELVDRVKKGIVKEIV
RECR_ANAPZ      SICTDSRRDKSLLCIVEELGDLWAFEKGRIYQGMYHXXXXXXXXXXXXXEDLNMSSIPERVRLHGVKEVI
RECR_ALHEH      GLCASDRRDRSLLCVVEGPADVFALEQATDFRGLYFVLMGRLSPLGVGPEALGLDRLEARLAEGEVQEVI
RECR_ACIC1      RICADPRRDPTVLCVVEEPKDVVAIEKTREFHGRYHVLGGAISPIGIGPDDLRIRELLQRLADGTVKELI
RECR_PARD8      SICANPSRDHSLVCVVENIKEVMAIENTGQFRGVYHVLGGIISPMGIGPGDLRIDSLVRRVAEGEVKEII
RECR_HERAR      ETCLDAERNAALLCVVETPGDQLMIEQTLTFKGLYFVLMGRLSPLGIGPKDIHLEKLISRATDGIVQEVV
RECR_GEOLS      PICSGGRDS-SVICVVETSQDMLALERSNAYHGSYHVLQGAISPLGVNPDDLRIRELLMRIEQGKVEEVV
RECR_THETN      DICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIGVGPEDIRIKELLERVRDGSVKEVI
RECR_SHEPA      PICVSTKRGHSEICVVETPADVLAIEAGGHFSGYFVLLGHLSPLDGVGPDELGLDLLEQHLATGDVSELI
RECR_SHEHH      PICVSTKRGHSDICVVETPADVLAIEAGGHFSGYFVLLGHLSPLDGVGPEELGLALLEQHLASGDVSELI
RECR_CLOBA      ALCSNPNRDKSTICVVEQPKDIMTMEKVKEFNGLYHVLHGNISPMGRGPQDIKIRELVARMNEE-VKEVI
RECR_BACSK      QICEDKHRDRTTICVVQESRDLIAMEKMREYTGLYHVLHGAISPMGIGPEDIKIAELIKRLQDESVKEVI
RECR_JANMA      ETCLDAERNPALLCVVETPGDQLMIEQTLTFKGLYFVLMGRLSPLGIGPKDIHLEKLISRATDGIVQEVV
RECR_EDWI9      TICTNARRRENQICVVESPADIHAIEQTGQYSGRYFVLMGHLSPLGIGPQDIGLDRLEVRLSQEAVSEVI
RECR_CHLP8      LLCTSTGRDRSVICVVESPTEVLAFEKTGHYKGLYHVLHGVISPLGVGPDDIKVRELLARISPDSVREVV
RECR_BIFLI      PVCADPRRDRSVICVVEEPKDVMSIERTREYRGLYHVLGGAINPANVGPADLRIPSLLKRLEGDEVKEVI
RECR_STRTR      IICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMGVGPDDINLKSLITRLMDSEVDEVI
RECR_STRTD      IICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMGVGPDDINLKSLIARLMDSEVDEVI
RECR_STRT2      IICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMGVGPDDINLKSLITRLMDSEVDEVI
RECR_STRT1      IICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMGVGPDDINLKSLITRLMDSEVDEVI
RECR_STRSY      AICQDSTRDQSTILIVEDSRDVTALENIQEYHGLYHVLHGLISPMGIGPDDINLKTLLTRLMENEVTEVI
RECR_STRPG      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYRGYYHVLHGLISPMGMGPDDINLKSLITRLMDGKVSEVI
RECR_NOCSJ      RICRDPRRDPSVLCVVEEYKDVVAIERTREFRGRYHVLGGAISPIGVGPEQLRIRELMVRLADGTITEVI
RECR_DESAH      RICSNPRRDASIICVVEKPTDIVAIEKSGAFSGLYHVLGGALSPMGIGPDELRIRELFSRACSKTTTEVI
RECR_CLOBM      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_CLOBL      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_CLOBK      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_CLOBJ      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_CLOBH      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_CLOB6      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_CLOB1      AICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPAGRGPEDIKLKELIRRIDG-SVNEVI
RECR_VIBCM      HICSNPKRKENQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLGIGPSDIGLDTLDYRLQRGDISEVI
RECR_VIBCH      HICSNPKRKENQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLGIGPSDIGLDTLDYRLQRGDISEVI
RECR_VIBC3      HICSNPKRKENQLCVVESPADIAALEATGQFSGRYFVLMGHLSPLGIGPSDIGLDTLDYRLQRGDISEVI
RECR_STRE4      HICTDSSRDKEIILVVEDSKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMAGEATEVI
RECR_PSEHT      DICLSTKRQDSGICVVESPSDVLAIEQTGQYLGLYFVLMGHLSPIGIGPKEIGLDVLETKLAQSGISEVI
RECR_CHLL2      YICSSTGRDRSVICVVESPADVLAFEKTGHYKGQYHVLHGLVSPLGIGPDDIRIHELLARLGERHVKEVV
RECR_PHEZH      AICSDGTRDASLICVVEEVGALWAMERAGAFRGRYHVLGGLLSALGVGPDALRVGPLVARASEPGVREVI
RECR_METFK      PLCASPARDRTLLCIVEMPSDLMMLEQTQTYQGMYFVLMGRLSPLGIGPRDIHLDKLLKRAQDGKVEEVI
RECR_LACS1      MICADKSRDNSKVVVVEQPKDVMSLERMNEYHGLYHVLHGVLSPIGKGPEDINIASLLRRLQKEAIKEVI
RECR_EXISA      AICKDSHRDETVVCVVQDSRDVIAMEKMREYRGKYHVLHGAISPMGIGPEDINVSSLLTRLQEESIQEVI
RECR_DESAA      HICRDATRDQDVVCVVEQGTDMVALEKSGAFKGRYHVLQGCLSPMGVGPDNLRIRELVERLKKEKIKEVV
RECR_SALRD      PICGSDKRDASTICVVEESSDLTAIEQTNEYRGVYHVLGGVISPLGVGPDDLRVHELATRIAESGVDEVI
RECR_ROSS1      AICANPARDQRVICVVEEPLDVVAIERTGVYRGLYHVLHGRIAPLGMNREDIYFDELLDRVRAEPVEEVI
RECR_PSEU2      PQCADPRRDDTLLCVVEGPTDVYAVEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPQLMERISQQGFTEVI
RECR_ECOL5      NICSNPRRKENQICVVESPADIYAIEQTGQFSGRYFVLMGHLSXXXXXXXXXXXXXRLERLAEEKITEVI
RECR_VIBHB      HICTNPKRQENQICVVESPADIAAVEATGQYSGRYFVLMGHLSPLGIGPSDIGLDVLDYRLRRGDISEVI
RECR_SYMTH      QICADDGRDHSTICVVQEPRDVVAMEKTREYHGVYHVLHGALNPMGIGIDDIRVKELVARLGDGRVQEVI
RECR_STRU0      SICTDPSRDKSMILVVEDSKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKTLITRLMDSDVSEVI
RECR_SERP5      TICANPRRQQNQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPMGIGPGDIGLDRLEQRLEKESVTEVI
RECR_HALOH      DFCSSPERDHNLICVVESPKDVIAMERTGEYKGLYHVLHGSISPIGIGPEDIKIRNLLPRL-KEGVKEVI
RECR_CLOPH      PICSSEKRDQKVIMVVENTRDLAAYEKTGKFDGVYHVLHGAISPMGIGPQDIKLKELMLRLQGD-VDEVI
RECR_CLOCE      PLCSGTSRDKTVICVVQDPRDVVAMERTREFKGLYHVLHGAISPMGIGPEEIRIKELITRLGSGDVKEVI
RECR_CHLPB      SICRGKGRDLSKICVVESPPDVLAFEKTAQYRGLYHVLHGVISPLGVGPDDIKVKELLARLSLQDVSEVI
RECR_BIFA0      TICSDPRRDHGTICVVEEPKDVMSIERTREYRGLYQVLGGAINPANVGPSDLNIAQLLNRLHDGEVKEII
RECR_TOLAT      DICANPKRESGQLCIVETPADVAAIEQTHLYSGRYFVLMGHLSPLGIGPKELGLDQLDNVLQGGQWKEVI
RECR_STRPZ      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRPM      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRPF      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRPD      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRPC      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRPB      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRP8      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRP6      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRP3      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_STRP1      HICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMDGKVSEVI
RECR_SACEN      RICRDARRDPAVVCVVEEPKDVLAVERTREFRGRYHVLGGALDPSGVGPDQLRVRELLTRIGRDEITEVI
RECR_POLNS      STCSDERRDPSLLCIVETPADQVMVEQTLSFKGNYFVLMGRLSPLGMGPNEISFDRLLNRIETPDIREVV
RECR_HELMI      RICSDANRDRAVICVVEEPRDVVAVEKTREYRGHYHVLHGALSPIGVGPEQLRISQLMARLADPELKEVI
RECR_ACAM1      DICRAPSRDKTVICVVADSRDVIALEKTREFKGQYHVLGGLISPMGIGPDQLNVQPLIRRVHQTKTQEVI
RECR_VIBPA      HICTNPKRQENQICVVESPADIAAVEATGQYSGRYFVLMGHLSPLGIGPSDIGLDVLDYRLRRGDISEVI
RECR_PSEE4      PQCADPRRDDTQLCVVEGPVDVYAVEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPQLMARIEEQGFSEVI
RECR_PSE14      PQCADPRRDDTLLCVVEGPTDVYAVEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPQLMERISQQGFTEVI
RECR_PROMH      TICANARRQQNQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLGIGPMDIGLDRLEERLSQEPISEVI
RECR_POLSQ      STCADGRRDPSLLCIVETPADQVMVEQTLSFKGNYFVLMGRISPLGMGPNEIHFDRLLTRIENPDIREVV
RECR_LEUMM      VICRDQSRDQSTVFVVENSRDVMAMENTRDYHGLYHVLNGVISSAGTGPEDINLPSLIRRLSEEEIKEVI
RECR_BIFLO      PVCADPRRDRSVICVVEEPKDVMSIERTREYHGLYHVLGGAINPANVGPADLRIPGLLKRLEGDEVKEVI
RECR_BIFLD      PVCADPRRDRSVICVVEEPKDVMSIERTREYHGLYHVLGGAINPANVGPADLRIPGLLKRLEGDEVKEVI
RECR_VIBSL      HICTNPKRQDNQICVVESPADIAAIEATGQYSGRYFVLMGHLSPLGIGPSDIGLDVLDYRLRRGDITEVI
RECR_STRS7      HICTDSSRDKETILVVEASKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMAGEATEVI
RECR_STREM      HICTDSSRDKETILVVEASKDVSAMEKIQEYHGYYHVLHGLISPMGVGPDDINLKSLITRLMAGEATEVI
RECR_DEIDV      DVCSDPSRDQNLICVVEEPGDVIAIERSGEYRGLYHVLHGVLSPMGVGPEKLHIKPLLPRVQEG--QEII
RECR_CLOBB      ALCSNPNRDKSTICVVEQPKDIMTMEKVKEFNGLYHVLHGNISPMGRGPQDIKIRELVARMNEE-AKEVI
RECR_BURVG      EVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_STRSV      AICQDQSRDQSTILIVEDSRDVSAMENIQEYHGLYHVLHGLISPMGVGPDDINLKSLITRLMDSEVTEVI
RECR_SHEDO      PICASHKRGASGICVVETPADVLAIEAGGHFNGYFVLLGHLSPLDGVGPEELGLSLLEQHLQTLDVTELI
RECR_PSEPK      PQCADPRRDDTQLCVVEGPTDVYAVEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPQLMARIEEQGFTEVI
RECR_PSEP1      PQCADPRRDDTQLCVVEGPTDVYAVEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPQLMARIEEQGFTEVI
RECR_LEPIN      EICVSEKRDSHTFCVVEQPEDIFFIENTREFQGKYHVLNGVISPLGIGPRDLRIKELLERIEPEQVKEVL
RECR_LEPIC      EICVSEKRDSHTFCVVEQPEDIFFIENTREFQGKYHVLNGVISPLGIGPRDLRIKELLERIEPEQVKEVL
RECR_IDILO      RICSNPMRRENGVCIVETPADVLAIEQTSQFQGRYFVLMGHLSPLGIGPADIGLDELERQLQSEPVEEIV
RECR_BURS3      EVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_BURCJ      EVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_BURCH      EVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_BURCC      EVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_BURCA      EVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_BDEBA      RYCEDSHRSDESICVVEEPSDIMRIESSGAFRGRYHVLHGAISPLGIGPKELKIKELIDRVTGPAIKEII
RECR_AZOVD      PQCADPRRDDSLLCVVQGPMDVFAIEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPELLARVEQGAFEEVI
RECR_STRGC      AICRDESRDQSTILIVEDSRDVSAMENIQEYHGLYHVLHGLISPMGVGPDDINLKSLITRLMDSEVSEVI
RECR_SHEPW      PICVSTKRGHSSICVVETPADVLAIEAGGHFSGYFVLLGHLSPLDGVGPDELGLALLETHLASGEVTELI
RECR_ANAVT      EICRNPNRENNTICVVADSRDVIALEKTREFKGKYHVLGGVISPMGIGPEQLTITPLLRRVSQQQPKEVI
RECR_ANASP      EICRNPNRENNTICVVADSRDVIALEKTREFKGKYHVLGGVISPMGIGPEQLTITPLLRRVSQQQPKEVI
RECR_PHOLL      TICANPRRQQNQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLGIGPMDIGLDRLEDRLATEEISEVI
RECR_BURP1      EVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGIVKEVV
RECR_BURMS      EVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGIVKEVV
RECR_BURMA      EVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGIVKEVV
RECR_BURM9      EVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGIVKEVV
RECR_BURM7      EVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGIVKEVV
RECR_BURCM      EVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_BURA4      EVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLGIGPKEIHFDRLVRRASDGVVKEVV
RECR_XANCP      AICANSGRDRQQLCVVESPADRLAIEHATGYRGVYFILQGRLSPLGIGPRELGLDRLAERLAAGEVTEMI
RECR_XANC8      AICANSGRDRQQLCVVESPADRLAIEHATGYRGVYFILQGRLSPLGIGPRELGLDRLAERLAAGEVTEMI
RECR_STRMU      NICTDESRDRSTVLVVEDSKDVSAMEKIQEYHGLYHVLHGLISPMGIGPDDINLKSLLTRLDNSDIHEVI
RECR_SHEFN      PICSSHRRNTGIICVVETPADVLAIEAGGHFNGYFVLLGHLSPLDGVGPEELGLALLERHLTSNEVSELI
RECR_PSESM      PQCSDLRRNDTLLCVVEGPTDVYAVEQTG-YRGRYFVLKGHLSPLGLGPEAIGIPQLMERISQQTFTEVI
RECR_PELTS      FICGXXXXXXXLLCVVERPRDVVALEKARVFKGLYHVLHGSISPVGIGPEQLRIRELLKRLEGGTVREVI
RECR_NEIMF      DICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTAGMDVSAIALDRLAQRLGGGEVEEII
RECR_NEIMB      DICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTAGMDVSAIALDRL