[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21392.1

[Show Plain Result]


## Summary of Sequence Search
    1::312
   15::320     5e-74  45%  328 aa  FCL2_ARATH RecName: Full=Putative GDP-L-fucose synthase 2;       
    1::307     2e-72  44%  312 aa  FCL1_ARATH RecName: Full=GDP-L-fucose synthase 1;       
   14::320     2e-69  43%  328 aa  FCL1_ORYSJ RecName: Full=Probable GDP-L-fucose synthase 1;       
    5::313     5e-68  44%  321 aa  FCL_ECOLI RecName: Full=GDP-L-fucose synthetase;       
   10::308     5e-60  39%  314 aa  Y4AF_RHISN RecName: Full=Uncharacterized protein y4aF;
   32::337     1e-54  38%  347 aa  FCL2_ORYSJ RecName: Full=Putative GDP-L-fucose synthase 2;       
    1::308     1e-33  29%  312 aa  NOLK_AZOC5 RecName: Full=Nodulation protein nolK;
    9::263     7e-30  29%  321 aa  FCL_PONAB RecName: Full=GDP-L-fucose synthetase;       
    9::263     3e-29  28%  321 aa  FCL_HUMAN RecName: Full=GDP-L-fucose synthetase;       
    9::263     7e-27  30%  321 aa  FCL_CRIGR RecName: Full=GDP-L-fucose synthetase;       
    9::263     2e-26  30%  321 aa  FCL_MOUSE RecName: Full=GDP-L-fucose synthetase;       
   69::249     2e-24  30%  320 aa  FCL_DICDI RecName: Full=GDP-L-fucose synthetase;       
   34::261     4e-14  23%  321 aa  FCL_DROME RecName: Full=Probable GDP-L-fucose synthetase;       
   25::333     1e-13  25%  377 aa  GME_ARATH RecName: Full=GDP-mannose 3,5-epimerase;       
   31::334     2e-13  26%  378 aa  GME1_ORYSJ RecName: Full=GDP-mannose 3,5-epimerase 1;       
   31::334     2e-13  26%  378 aa  GME1_ORYSI RecName: Full=GDP-mannose 3,5-epimerase 1;       
   24::327     2e-12  25%  371 aa  GME2_ORYSJ RecName: Full=GDP-mannose 3,5-epimerase 2;       
    2::293     2e-10  25%  305 aa  GALE_METJA RecName: Full=Putative UDP-glucose 4-epimerase;       
  125::335     4e-10  26%  355 aa  TGDS_MOUSE RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
  125::335     7e-09  26%  350 aa  TGDS_HUMAN RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
  125::335     9e-09  26%  355 aa  TGDS_BOVIN RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
    2::233     2e-08  27%  334 aa  CAPI_STAAU RecName: Full=Protein capI;         EC=4.-.-.-;
   93::305     8e-08  25%  326 aa  Y1055_METJA RecName: Full=Uncharacterized protein MJ1055;
   88::228     3e-07  28%  334 aa  YCL2_ECO11 RecName: Full=Uncharacterized 37.6 kDa protein in cld
   84::229     4e-07  25%  341 aa  LPSL_RHIME RecName: Full=UDP-glucuronate 5'-epimerase;       
   81::268     9e-07  28%  334 aa  GALE_BACHD RecName: Full=UDP-glucose 4-epimerase;       
  159::315     4e-06  22%  669 aa  RHM1_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 1;  
  194::440     6e-06  24%  460 aa  GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6;       
   90::264     7e-06  25%  329 aa  GALE_CORGL RecName: Full=UDP-glucose 4-epimerase;       
  179::328     2e-05  24%  437 aa  GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4;       
  159::315     2e-05  22%  664 aa  RHM3_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 3;  
  173::322     3e-05  23%  430 aa  GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3;       
  161::317     4e-05  21%  667 aa  RHM2_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 2;  
  174::323     4e-05  23%  434 aa  GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2;       
  108::270     8e-05  24%  279 aa  RFBS_SALTI RecName: Full=Paratose synthase;         EC=1.-.-.-;
  170::319     8e-05  26%  429 aa  GAE1_ARATH RecName: Full=UDP-glucuronate 4-epimerase 1;       
   97::259     1e-04  28%  315 aa  SPSJ_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
   86::264     1e-04  23%  328 aa  GALE_CORDI RecName: Full=UDP-glucose 4-epimerase;       
  178::327     1e-04  24%  436 aa  GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5;       
  191::286     2e-04  21%  293 aa  RFBJ_SALMU RecName: Full=CDP-abequose synthase;         EC=4.2.1.-;
  163::267     3e-04  29%  434 aa  TGDS_DICDI RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
    2::243     3e-04  22%  309 aa  HLDD_EDWI9 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::269     3e-04  24%  331 aa  GALE_LACCA RecName: Full=UDP-glucose 4-epimerase;       
   98::259     5e-04  21%  316 aa  YTCB_BACSU RecName: Full=Uncharacterized UDP-glucose epimerase
  167::358     5e-04  27%  365 aa  YHEB_SCHPO RecName: Full=Uncharacterized protein PB2B2.11;
   95::325     5e-04  23%  336 aa  GALE_YEREN RecName: Full=UDP-glucose 4-epimerase;       
    1::312

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MINRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQXXXXXXXXXXXXXXXXXAAAKVGG
FCL2_ARATH      MLEKSAKIFVAGHRGLVGSAIVRKLQDQGFTNLVLRTHSELDLTSQSDVESFFATEKPVYVILAAAKVGG
FCL1_ARATH      MSDKSAKIFVAGHRGLVGSAIVRKLQEQGFTNLVLKTHAELDLTRQADVESFFSQEKPVYVILAAAKVGG
FCL1_ORYSJ      LADKGGKVFVAGHRGLVGSAILRHLVSLGFTNVVVRTHAELDLTRQSDVEAFFAAELPRYVVLAAAKVGG
FCL_ECOLI       ------RVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGG
Y4AF_RHISN      ------RIWVAGHKGMVGSAIIRSLASED-CEVIVADRQKLDLTRQEEVEKFLLKEKPHAVIMAAAKVGG
FCL2_ORYSJ      --DKSAKVFIAGHRGMVGSAVHRKLDALGFTNVVVRTRAELDLACQXXXXXXXXXXLPRYVILAAAKVGG
NOLK_AZOC5      -MGKGKKLLITGGRGMVGRNLIACAARSGW-EIIAPTSVDLDLRNAEAVEQYIRRQLPDXXXXXXXXXXX
FCL_PONAB       ------RILVTGGSGLVGKAI-QKVVADGAEDWVFVSSKDADLTDAAQTRALLEKVRPTHVIHLAAMVGG
FCL_HUMAN       ------RILVTGGSGLVGKAI-QKVVADGAEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGG
FCL_CRIGR       ------RILVTGGSGLVGRAI-QKVVADGAEEWVFVSSKXXXXXXXXXXXXXFQKVQPTHVIHLAAMVGG
FCL_MOUSE       ------RILVTGGSGLVGRAI-QKVVADGAEEWVFVSSKXXXXXXXXXXXXXFQKVQPTHVIHLAAMVGG
FCL_DICDI       ----------------------------------------------------------------AARVGG
FCL_DROME       -----------------------------------AGSKDADLTNLAATQALFAREKPTHVIHLAAMVGG
GME_ARATH       --SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTERVMENCLKVTEGVDHVFNLAADMGG
GME1_ORYSJ      ------RISITGAGGFIGSHIARRLKSEGH-YIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCAADMGG
GME1_ORYSI      ------RISITGAGGFIGSHIARRLKSEGH-YIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCAADMGG
GME2_ORYSJ      ------RISITGAGGFIASHIARRLKSEGH-YIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCAADMGG
GALE_METJA      -------ILVTGGAGFIGSHIVDKLIENNYDVIILAEFVNADIRDKDLDEKINFKDVEVVIHQAAQNVRN
TGDS_MOUSE      ----------------------------------------------------------------------
TGDS_HUMAN      ----------------------------------------------------------------------
TGDS_BOVIN      ----------------------------------------------------------------------
CAPI_STAAU      ------KILITGTAGFIGSHLAKKLIKQGYSVSLKEDRNKVKLENYDDLSKVFVDEQPEVVVNLAAQ-AG
Y1055_METJA     ---------------------------------------------------------------------G
YCL2_ECO11      ----------------------------------------------------------------------
LPSL_RHIME      -----------------------------------------------------------------AAQAG
GALE_BACHD      ----------------------------------------------------------------------
RHM1_ARATH      ----------------------------------------------------------------------
GAE6_ARATH      -----------------------------------------------------------------AAQAG
GALE_CORGL      ----------------------------------------------------------------------
GAE4_ARATH      -----------------------------------------------------------------AAQAG
RHM3_ARATH      ----------------------------------------------------------------------
GAE3_ARATH      -----------------------------------------------------------------AAQAG
RHM2_ARATH      ----------------------------------------------------------------------
GAE2_ARATH      -----------------------------------------------------------------AAQAG
RFBS_SALTI      ----------------------------------------------------------------------
GAE1_ARATH      -----------------------------------------------------------------AAQAG
SPSJ_BACSU      ----------------------------------------------------------------------
GALE_CORDI      ----------------------------------------------------------------------
GAE5_ARATH      -----------------------------------------------------------------AAQAG
RFBJ_SALMU      ----------------------------------------------------------------------
TGDS_DICDI      ----------------------------------------------------------------------
HLDD_EDWI9      -------IIVTGGAGMIGSNIVKALNDKGYTDILVVDNLKLDITDKEDFIAGIVAGDDFGDIDAVFHEGA
GALE_LACCA      -------IAVLGGAGYIGSHTVKQLLAAGLDNLITGHRKAVD-PRARFYQGDIRDYHFLSQVFSQEKIDG
YTCB_BACSU      ----------------------------------------------------------------------
YHEB_SCHPO      ----------------------------------------------------------------------
GALE_YEREN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
FCL2_ARATH      IHANNTYPADFIGVNLQIQTNVIHSAYTHGVKKLLFLGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAI
FCL1_ARATH      IHANNTYPADFIGVNLQIQTNVIHSAYEHGVKKLLFLGSSCIYPKFAPQPIPESALLTASLEPTNEWYAI
FCL1_ORYSJ      IHANSTFPADFIAANLQIQTNVVDAALKCGVRKLLFLGSSCIYPKFAPQPIPENSLLSGPLEPTNEWYAV
FCL_ECOLI       IVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAI
Y4AF_RHISN      ILANDTMPADFIYQNLIMEANVIEGSFRSGVEKLLFLGSSCIYPKYAAQPIREEALLTGPLEPTNEWYAI
FCL2_ORYSJ      VHASSAAPAEYLTENLRITVNVVDAARRCGVRKLLVLASSTIYPADAPQPTPESALLTGPPAEGSEWYAI
NOLK_AZOC5      XXXXXXDPIHFLADNAAMALNVVMSSFRSEVVTLINLSSSCMYPACIEGPLKECDILRGPFEVTNEGYAL
FCL_PONAB       LFRNIKYNLDFWRKNVHINDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSY
FCL_HUMAN       LFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSY
FCL_CRIGR       LFRNIKYNLDFWRKNVHINDNVLHSAFEVGTRKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSY
FCL_MOUSE       LFRNIKYNLDFWRKNVHINDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSY
FCL_DICDI       LFSNMKYKVEFFRENIDINDNVLACCKEFNVVKCVSCLSTCIFPDKTTYPIDETMIHNGPPHPSNEGYAY
FCL_DROME       LFHXXXXXXXXXXXXXXXXXXVLQTAHEQGCVKVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNYGYSY
GME_ARATH       MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAAEPQDAYGL
GME1_ORYSJ      MGFIQSNHSVIMYNNTMISFNMLEAARINGVKRFFYASSACIYPEETNVSLKES---DAWPAEPQDAYGL
GME1_ORYSI      MGFIQSNHSVIMYNNTMISFNMLEAARINGVKRFFYASSACIYPEETNVSLKES---DAWPAEPQDAYGL
GME2_ORYSJ      MGFIQSNHSVIMYNNTMISFNMLEAARINGVKRFFYASSACIYPEDTVVSLKES---DAWPAEPQDAYGL
GALE_METJA      SVENPVYDGDI---NVLGTINILEMMRKYDIDKIVFASSGAVYGEPNYLPVDENHPINPL-----SPYGL
TGDS_MOUSE      ---------------------LVNAAYEAGVEKFIYVSTDEVYGGSLDQEFDE----SSPKQPTNP-YAS
TGDS_HUMAN      ---------------------LVSAAHEARVEKFIYVSTDEVYGGSLDKEFDE----SSPKQPTNP-YAS
TGDS_BOVIN      ---------------------LVSAAHEARVEKFIYVSTDEVYGGSLDKEFDE----SSPKQPTNP-YAS
CAPI_STAAU      VRYSIENPRTYIDSNIVGFMNILECSRHFNIQNLIYASSSSVYGANTSKP----FSTSDNIDHPLSLYAA
Y1055_METJA     VRYSLQNPWAYIKSNEMGTLNIFEFARRFDIEKVVYAXXXXVYGGNRKIPFSE----DDRVDKPISLYAS
YCL2_ECO11      VRYSLENPHAYADSNLTGFLNILEGCRHNKIQHLLYASSSSVYGLNRKMP----FSTDDSVDHPVSLYAA
LPSL_RHIME      VRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAE----ADRADEPMTLYAA
GALE_BACHD      ---SVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATYGEPVQIPIQE----SDPTIPTNP-YGE
RHM1_ARATH      -------------------------------------------------------------------YSA
GAE6_ARATH      VRYAMKNPQSYIASNIAGFVNLLEVAKAANPQPIVWASSSSVYGLNTENPFSEEH----RTDQPASLYAA
GALE_CORGL      -------------DNVVTALTLLDAMRAHGVNNLVFSSTAATYGEPDVVPITEDM----PTQPTN-AYGA
GAE4_ARATH      VRYAMENPSSYVHSNIAGFVNLLEICKSVNPQPIVWASSSSVYGLNTKVPFSE----KDKTDQPASLYAA
RHM3_ARATH      -------------------------------------------------------------------YSA
GAE3_ARATH      VRYAMENPSSYVHSNIAGFVNLLEVCKSANPQPIVWASSSSVYGLNTKVPFSE----KDRTDQPASLYAA
RHM2_ARATH      -------------------------------------------------------------------YSA
GAE2_ARATH      VRYAMENPGSYVHSNIAGFVNLLEVCKSANPQPIVWASSSSVYGLNTKVPFSE----KDRTDQPASLYAA
RFBS_SALTI      ------------------------------------------------------------LPPNTSLYAY
GAE1_ARATH      VRYALENPQSYVHSNIAGLVNLLEICKAANPQPIVWASSSSVYGLNEKVPFSE----SDRTDQPASLYAA
SPSJ_BACSU      ----------FITTNVMGTYRLAEAVLKGKAKKLIHISTDEVYGKADDPAFTETTPLS-----PNNPYSA
GALE_CORDI      ---------EYWQHNMVTTLALLDAMKRNNVRNIVFSSTAATYGEPETVPITE----DAPTHPTNP-YGA
GAE5_ARATH      VRYAMQNPGSYVNSNIAGFVNLLEVSKSANPQPIVWASSSSVYGLNSKVPFSE----KDRTDQPASLYAA
RFBJ_SALMU      ----------------------------------------------------------------------
TGDS_DICDI      ------------------------------------------------------------LNPTNP-YSA
HLDD_EDWI9      CSSTTEWDGKYVMDNYQYSKELLH---FCLERQIPFLYASSAATYGMTDKFVEDRHYEGPL----NVYGY
GALE_LACCA      IVHSMKDPLKYFDNNTGGMITLLEAMNQFGIKKIVFSSTAATYGEPKQVPIKET-----DPQVPTNPYGE
YTCB_BACSU      ----------YAAHNIQALQRLLEACREHSIQTFVFASTSSVYGEKQGKVSENTSL------SPLSPYGV
YHEB_SCHPO      -----------------------------------------------------------KLNPTSP-YAA
GALE_YEREN      ---------EYYQNNVVGSITLLEEMCLANVKKLIFSSSATVYGEPEFVPLTEKARIGG----TTNPYGT


                         +         .         .         .         .         *         .:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPAXXXXXXXXXXXXXNTVILWGNGKAK
FCL2_ARATH      AKIAGIKMCQAYRLQHQWDAISGMPTNLYGQNDNFHPENSHVLPALMRRFHEAKANNADEVVVWGSGSPL
FCL1_ARATH      AKIAGIKTCQAYRIQHGWDAISGMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVNGAEEVVVWGTGSPL
FCL1_ORYSJ      AKIAGIKMCQAYRIQHGFDAISAMPTNLYGPQDNFHPENSHVLPALIRRFHEAKASNAAEVVVWGTGSPL
FCL_ECOLI       AKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPM
Y4AF_RHISN      AKIAGIKLCQAYRKQYGANFISAMPTNLYGPRDKFDLNSSHVVPALIRKAHEAKIKDLGCLSIWGSGTPT
FCL2_ORYSJ      PKIAGIKMCQAVRAEYGLDAIAAAPNNLYGPRHPFPPEHSHVIPALIRRFHRAKLEGAGEVAVWGSGAAA
NOLK_AZOC5      AKTVGLKICEYIDKLPNFNYKTLIACNLYGVGDNFDPRRSHLLPAIIEKIHKASQCGSESVSIWGDGTAR
FCL_PONAB       VKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPG-LIHKVHLAKSSGSALTVWGTGKPR
FCL_HUMAN       AKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPG-LIHKVHLAKSSGSALTVWGTGNPR
FCL_CRIGR       AKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPHDNFNIEDGHVLPG-LIHKVHLAKSNGSALTVWGTGKPR
FCL_MOUSE       AKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPYDNFNIEDGHVLPG-LIHKVHLAKSSDSALTVWGTGKPR
FCL_DICDI       AKRMIDVLNRAYNEEYGCKFTSVIPTNIYGPHDNYHLTDGHVIPGLIHKTYLAMKNNQDLTIM-GTGKPL
FCL_DROME       AKRLIDVQNHAYHDKYGRVYTSVIPCNIFGPHDNYNPEVSHVIPGMIYRMHQLVTEKTDVFTVFGSGMPL
GME_ARATH       EKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
GME1_ORYSJ      EKLATEELCKHYTKDFGIECRVGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
GME1_ORYSI      EKLATEELCKHYTKDFGIECRVGRFHNIYGPFGTW-KGGREKAPAAFCRKAQTSTDRFE---MWGDGLQT
GME2_ORYSJ      EKLATEELCKHYTKDFGIECRVGRFHNIYGPFGTW-KGGREKAPAAFCRKALTSTDRFE---MWGDGLQT
GALE_METJA      SKYVGEEYIKLYNRLYGIEYAILRYSNVYG--ERQDPKGE----AGVISIFIDKMLKNQSPIIFGDGNQT
TGDS_MOUSE      SKAAAECFVQSYWERYKFPVVITRSSNVYGP---------HQYPERVIPKFISLLQHNRKCCIHGSGLQR
TGDS_HUMAN      SKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFI---------SLLQHNRKCCIHGSGLQT
TGDS_BOVIN      SKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFI---------SLLQHNRKCCIHGTGLQT
CAPI_STAAU      TKKSNELMAHTYSHLYNLPTTGLRFFTVYGPWGRPDMALFKFTKA---------IVNDQAIDVYNHGNMM
Y1055_METJA     TKRSNELMAHVYHHLYGIKMIGLRFFTVYGEYGRPDMAYFKFAK---------NILLGKEIEVYNYGNME
YCL2_ECO11      TKKANELMAHTYSHLYGLPATGLRFFTVYGPWGRPDMALFKFTKAMLEG---------KSIDVYNYGKMK
LPSL_RHIME      TKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRPDMALFKFVDAIHNG---------RPIDIYGEGRMS
GALE_BACHD      TKLAIEKMFHWCQEAYGLQYVCLRYFNAAGPNGRIGEDHSHLIP----IVLQVALGQRERVAIFGDGSCI
RHM1_ARATH      TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFI---------LLAMRGQVLPIHGDGSNV
GAE6_ARATH      TKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILHGKSIDIYRTQD------NQEVA
GALE_CORGL      TKLSIDYAITSYAAAFGLAATSLRYFNVAGAYGNIGENRTHLIPLVLQVATGHREKTFMFGDDWPDGTAV
GAE4_ARATH      TKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILKGKSISIFESAN------HGTVA
RHM3_ARATH      TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFI---------LLAMNGKPLPIHGDGSNV
GAE3_ARATH      TKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGKAISIFEGVN------HGTVA
RHM2_ARATH      TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKMIPKFI---------LLAMSGKPLPIHGDGSNV
GAE2_ARATH      TKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGKAISIFEGAN------HGTVA
RFBS_SALTI      TKQKANELAAAIIDKVCGKYIELKLEHFYGAFDGDDKFTSMVI----------RRCLSNQPVKLTSGLQQ
GAE1_ARATH      TKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRPDMAYFSFTRNILQGKPITIYRGKNRVDL------A
SPSJ_BACSU      SKASSDLLVLSYVKTHKLPAIITRCSNNYGPYQHSEK----MIPTIIRHAKQGLP-----VPLYGDGLQI
GALE_CORDI      TKLSIDYAITSYAHAYATSLRYFNVAGAYGLVGENREIETHLIPLVLQVALGHR----DKIFMFGDGTPI
GAE5_ARATH      TKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFF---------TKDILKGKTITVFDKGSVA
RFBJ_SALMU      -------------------------------------------------------------------RQK
TGDS_DICDI      SKAGAEHLVQSYYKSFKLPVIITRANNIYGPKQYPEKIIPKFI---------NLLLNNKKCTIHGTGKNT
HLDD_EDWI9      SKFLFDQYVRRILPHAKSQICGFRYFNVYGPREGHKGG----MASVAFHLNTQINNGEQPKLFEGSENFR
GALE_LACCA      SKLAMEKIMHWADVAYGLKFVALRYFNVAGAMPDGSIGEDHHPETHIVPIILQVAAGTRTGLIYGDGTNV
YTCB_BACSU      TKLTGEKLCHVYKQSFGIPIVILRFFTVYGPRQRPDMAFHRLI---------KQHLQQKPLTIFGDGQQS
YHEB_SCHPO      SKAAVDLIIQSYRYSYKISVTVIRANNVYGPRQYEEK----LIPMTLGKLKKFINQKSQKIMLHGDGLHK
GALE_YEREN      SKVMVEQILKDFSLAHPTALRYFNPVGAHGEDPNGKPNN--LLP----FITQVAIGKLSKLLVYGNGSGI


                         .         .         .         +         .         .         .:280
query           REVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNXXXXXXXXXXXPNGSPRKVM
FCL2_ARATH      REFLHVDDLADACVFLMDQYSGFEHVNVGSGVEVTIKELAELVKEVV--GFKGKLVWDTTKPDGTPRKLM
FCL1_ARATH      REFLHVDDLADACVFLLDRYSGLEHVNIGSGQEVTIRELAELVKEVV--GFEGKLGWDCTKPDGTPRKLM
FCL1_ORYSJ      REFLHVDDLADAVIFLMDHYSGLEHVNVGSGSEVTIKELAELVKEVV--GFQGKLVWDSSKPDGTPRKLM
FCL_ECOLI       REFLHVDDMAAASIHVMELAHEVWLINVGTGVDCTIRELAQTIAKVV--GYKGRVVFDASKPDGTPRKLL
Y4AF_RHISN      RDFLYSEDCSDALVFLLKHYSETEHINXXXXXXXXXXXLAHIVCRVV--GFKGDIVFDTSKPDGTPRKLL
FCL2_ORYSJ      REFTHVDDLAEAVVVLMERYSGEEHVNVGSGEEVTVRELAEAVRGVV--GYEGVVAWDAARPEGVARRVV
NOLK_AZOC5      REFMFAYDFAKIIIKALEPELIPSSMNVGVGKDLSVLEYYSLVARVI--GWSGEFVYDLNRPVGMRSKLM
FCL_PONAB       RQFIYSLDLAQLFIWVLREEVEPIILSVGEDDEVSIKEAAEAVVEAM-----------------------
FCL_HUMAN       RQFIYSLDLAQLFIWVLREEVEPIILSVGEEDEVSIKEAAEAVVEAM-----------------------
FCL_CRIGR       RQFIYSLDLARLFIWVLREEVEPIILSVGEEDEVSIKEAAEAVVEAM-----------------------
FCL_MOUSE       RQFIYSLDLARLFIWVLREEVEPIILSVGEEDEVSIKEAAEAVVEAM-----------------------
FCL_DICDI       RQFIYSYDLAKYFVWTLNNYEEMSPLILSVGEEDEI----------------------------------
FCL_DROME       RQFVYSRDLAELMIWVLRESVEPIILSADEVQEVTIFEVAQAVAK-------------------------
GME_ARATH       RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMN---EMAEMVLSFEEKKLPIHHIPGPEGVRGRNS
GME1_ORYSJ      RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMNEMAEIILSF---EDRELPIHHIPGPEGVRGRNS
GME1_ORYSI      RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMNEMAEIILSF---EDRELPIHHIPGPEGVRGRNS
GME2_ORYSJ      RSFTFIDECVEG-VLRLTKSDFREPVNIGSDEMVSMNEMAEI---VLSFENKQLPIHHIPGPEGVRGRNS
GALE_METJA      RDFVYVGDVAKANLMALNWKNE--IVNIGTGKETSVNELFDIIKHEI--GFRGEAIYDKPREGEVYRIYL
TGDS_MOUSE      RNFLYAADVVEAFLTVLTKGEPGEIYNIGTNFEMSVVQLAKELIQLIKSETESWVDYVSDRPHNDMRYPM
TGDS_HUMAN      RNFLYATDVVEAFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKSEMENWVDYVNDRPTNDMRYPM
TGDS_BOVIN      RNFLYATDVVEAFLTVLKKGKPGEIYNIGTNFEMSVLQLAKELIQLIKSEMENWVDYVDDRPTNDMRYPM
CAPI_STAAU      RDFTYVDDIVEAISRLVKK---------------------------------------------------
Y1055_METJA     RDFTYISDVVDGILRAIKKDFDYEIFNLGNSKPVKLMYFIELIEKYL--NXXXXXXFLPMQDGDVLRTYA
YCL2_ECO11      RDFTYIDDIAEAII--------------------------------------------------------
LPSL_RHIME      RDFTYIDDLVESIV--------------------------------------------------------
GALE_BACHD      RDYIHVMDLANAACEHLRKDGQSGSFNLGNGKGFSVKEVIEVCRQV------------------------
RHM1_ARATH      RSYLYCEDVAEAFEVVLHKGEVGHVYNIGTKKERRVNDVAKDICKLFNMDPEANIKFVDNRPFNDQRYFL
GAE6_ARATH      RDFTYIDDIVKGCVGALKKRGQAQLYNLGNTSPVPVG-RLVSILEGLLGTKAKKHLIKMPRNGDVPYTHA
GALE_CORGL      RDYIHILDLAKAHVLALESNEKHRIFNLGSGDGYSVKQVVEMCREV------------------------
GAE4_ARATH      RDFTYIDDIVKGCL--------------------------------------------------------
RHM3_ARATH      RSYLYCEDVAEAFEVVLHKGEVNHVYNIGTTRERRVIDVANDISKLFGIDPDSTIQYVENRPFNDQRYFL
GAE3_ARATH      RDFTYIDDIVKGCL--------------------------------------------------------
RHM2_ARATH      RSYLYCEDVAEAFEVVLHKGEIGHVYNVGTKRERRVIDVARDICKLFGKDPESSIQFVENRPFNDQRYFL
GAE2_ARATH      RDFTYIDDIVKGCL--------------------------------------------------------
RFBS_SALTI      RDFLYIKDLLTACIISNVNNFPKFSIEVGSGEAISIREYVDTVKNITKSNSIIEFGVVKERVNELMYSCA
GAE1_ARATH      RDFTYIDDIVKGCL--------------------------------------------------------
SPSJ_BACSU      RDWLFAEDHCRAIKLILEKGTDGEVYNIGGGNERTNKELASVILK-------------------------
GALE_CORDI      RDYIHIRDLADAHILALQSNVEHRIFNLGSGEGYSVKQVIDTCREV------------------------
GAE5_ARATH      RDFTYIDDIVKGCL--------------------------------------------------------
RFBJ_SALMU      RDFIYIDDVVSAYLKILKENAGHYDVEVGTGKSIELKEVFEIIKKETHSSSKINYGAVAMRDDEIMESHA
TGDS_DICDI      RNYLYIDDIVSAFDIILRKGEIGNVYNIGTDFEIS-----------------------------------
HLDD_EDWI9      RDFIYVGDVADVNLWFWENGVSG-IFNCGTGNAESFQ---------------------------------
GALE_LACCA      RDYVHVVDLADAHILALKNKSSAF--NIGSAHGFSNLEILNAARKV------------------------
YTCB_BACSU      RDFTYISDCVKGITAVLGK--PHLIVNIGGAERASVLKVVSLIEDI------------------------
YHEB_SCHPO      RKYLHIYDFINAILVWMKQGSEVYIFNIGSDDEIDNLSLVKFICKLSLKNLDYSKYITFVQDRNDSRYSL
GALE_YEREN      RDYIHVMDLAEGHLSTLINLTSGFRINLGTGVGYSVLHMIKEFERITGKN--IPFDIVSRRPGDIAECWA


                         .         *         .         .         .         .         +:350
query           DISLAKKYGWKSKMSLITSIRNTYKSFVRENF
FCL2_ARATH      DSSKLASLGWTPKISLKDGLSQTYEWYL----
FCL1_ARATH      DSSKLASLGWTPKVSLRDGLSQTYDWYLK---
FCL1_ORYSJ      DSSKIQEMGWKPKVPLKEGLVETYKWYV----
FCL_ECOLI       DVTRLHQLGWYHEISLEAGLASTYQWFL----
Y4AF_RHISN      SSERLVSMGWRPKTSLELGLAKSYESFV----
FCL2_ORYSJ      DSGRMRKLGWEPRVALRDGIQDLYRFYLR---
NOLK_AZOC5      DITHLTALGWVPERSLEGGIRSTYQYYITGN-
FCL_PONAB       --------------------------------
FCL_HUMAN       --------------------------------
FCL_CRIGR       --------------------------------
FCL_MOUSE       --------------------------------
FCL_DICDI       --------------------------------
FCL_DROME       --------------------------------
GME_ARATH       DNNLIKKLGWAPNMRLKEGLRITY--------
GME1_ORYSJ      DNTLIKKLGWAPTMKLKDGLRFTY--------
GME1_ORYSI      DNTLIKKLGWAPTMKLKDGLRFTY--------
GME2_ORYSJ      DNTLIKKLGWAPTMRLKDGLRITY--------
GALE_METJA      DIKKAESLGWKPEIDLKEGIK-----------
TGDS_MOUSE      KSEKIHSLGWKPKVPWEEGIKKTVE-WYRKNF
TGDS_HUMAN      KSEKIHGLGWRPKVPWKEGIKKTIE-WYRENF
TGDS_BOVIN      KSEKIHGLGWRPKVPWKEGIKKTIE-WYRENF
CAPI_STAAU      --------------------------------
Y1055_METJA     DLSKSEKLGYKPKVTI----------------
YCL2_ECO11      --------------------------------
LPSL_RHIME      --------------------------------
GALE_BACHD      --------------------------------
RHM1_ARATH      DDQKLKKLGWSERTTWEEGLKKT---------
GAE6_ARATH      NVSLAKDFGYKPTTDLAAGLRKFVKWYV----
GALE_CORGL      --------------------------------
GAE4_ARATH      --------------------------------
RHM3_ARATH      DDQKLKKLGWCERTNWEEGLRKT---------
GAE3_ARATH      --------------------------------
RHM2_ARATH      DDQKLKKLGWQERTNWEDGLKKT---------
GAE2_ARATH      --------------------------------
RFBS_SALTI      DIAELEKIGWKREFSLVDAL------------
GAE1_ARATH      --------------------------------
SPSJ_BACSU      --------------------------------
GALE_CORDI      --------------------------------
GAE5_ARATH      --------------------------------
RFBJ_SALMU      NTSFLTRLGWSAEFSIEKGVK-----------
TGDS_DICDI      --------------------------------
HLDD_EDWI9      --------------------------------
GALE_LACCA      --------------------------------
YTCB_BACSU      --------------------------------
YHEB_SCHPO      NYEKIKSLGWRPQIPLETGLR-----------
GALE_YEREN      SPELAHELGWYAKRTLVDMLQDAWK-------