[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21400.1

[Show Plain Result]


## Summary of Sequence Search
    1::187
  266::334     6e-05  39%  567 aa  FLIF_TREPA RecName: Full=Flagellar M-ring protein;
    1::187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDENKELQI
FLIF_TREPA      -------------------------------------------------------------KDRVRDLNI


                         .         .         *         .         .         .         .:140
query           KNTDIEISTEDKKIKKYIPLSKRQDKPDSALWLIKHHSLLKDSQIAKLVGITKASVTAIKNKSYWNYNNL
FLIF_TREPA      K-IEMDLSEKTSQTTKYLPIEIRQDNPDTP-W--------DDSQV--VPSVTSISETA---TTTWQGTGL


                         +         .         .         .         .         *         .:210
query           NPKDPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLIF_TREPA      NPEGP------------------------------------------