[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21405.1

[Show Plain Result]


## Summary of Sequence Search
    1::336
    3::332     4e-87  48%  334 aa  ALF1_XYLFT RecName: Full=Probable fructose-bisphosphate aldolase
    3::332     3e-86  47%  334 aa  ALF1_XYLFA RecName: Full=Probable fructose-bisphosphate aldolase
    3::332     2e-84  47%  334 aa  ALF1_XANAC RecName: Full=Probable fructose-bisphosphate aldolase
   15::349     4e-78  47%  364 aa  ALDOB_DANRE RecName: Full=Fructose-bisphosphate aldolase B;        
   15::343     2e-77  48%  363 aa  ALDOC_RAT RecName: Full=Fructose-bisphosphate aldolase C;       
   15::343     1e-76  48%  363 aa  ALDOC_MOUSE RecName: Full=Fructose-bisphosphate aldolase C;        
   15::343     7e-76  47%  364 aa  ALDOB_RABIT RecName: Full=Fructose-bisphosphate aldolase B;        
   15::343     2e-75  48%  364 aa  ALF2_LAMJA RecName: Full=Fructose-bisphosphate aldolase, non-muscle
   16::343     2e-74  46%  364 aa  ALDOB_SHEEP RecName: Full=Fructose-bisphosphate aldolase B;        
    3::332     2e-74  43%  334 aa  ALF1_XANCP RecName: Full=Probable fructose-bisphosphate aldolase
   16::343     3e-74  46%  364 aa  ALDOB_BOVIN RecName: Full=Fructose-bisphosphate aldolase B;        
   11::337     5e-74  45%  357 aa  ALF_SPIOL RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic
   11::343     9e-74  44%  355 aa  ALF_MAIZE RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic
   15::343     9e-74  46%  364 aa  ALDOB_HUMAN RecName: Full=Fructose-bisphosphate aldolase B;        
   14::314     1e-73  48%  363 aa  ALF_SCHMA RecName: Full=Fructose-bisphosphate aldolase;       
   13::348     1e-73  44%  363 aa  ALF_ECHMU RecName: Full=Fructose-bisphosphate aldolase;       
   11::322     1e-73  47%  357 aa  ALF1_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic
   15::343     1e-73  45%  363 aa  ALF1_LAMJA RecName: Full=Fructose-bisphosphate aldolase, muscle
   15::343     1e-73  46%  364 aa  ALDOB_PONAB RecName: Full=Fructose-bisphosphate aldolase B;        
   11::337     3e-73  45%  358 aa  ALF_ORYSJ RecName: Full=Fructose-bisphosphate aldolase cytoplasmic
   15::343     4e-73  46%  364 aa  ALDOB_MOUSE RecName: Full=Fructose-bisphosphate aldolase B;        
   47::376     2e-72  45%  391 aa  ALFC3_ARATH RecName: Full=Probable fructose-bisphosphate aldolase
   11::338     4e-72  44%  359 aa  ALF2_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic
   15::343     4e-72  46%  363 aa  ALDOC_DANRE RecName: Full=Fructose-bisphosphate aldolase C;        
   19::346     8e-72  44%  366 aa  ALF2_CAEEL RecName: Full=Fructose-bisphosphate aldolase 2;       
   15::343     8e-72  46%  364 aa  ALDOB_RAT RecName: Full=Fructose-bisphosphate aldolase B;       
   16::343     1e-71  45%  364 aa  ALDOB_CHICK RecName: Full=Fructose-bisphosphate aldolase B;        
   15::343     2e-71  45%  363 aa  ALDOC_CARAU RecName: Full=Fructose-bisphosphate aldolase C;        
   21::343     3e-71  44%  369 aa  ALF_PLAFA RecName: Full=Fructose-bisphosphate aldolase;       
   21::343     3e-71  44%  369 aa  ALF_PLAF7 RecName: Full=Fructose-bisphosphate aldolase;       
    8::337     3e-71  44%  357 aa  ALF_DICDI RecName: Full=Fructose-bisphosphate aldolase;       
   11::338     1e-70  44%  358 aa  ALF_ARATH RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic
   24::355     2e-70  41%  372 aa  ALF_TRYBB RecName: Full=Fructose-bisphosphate aldolase, glycosomal;
   54::385     2e-70  43%  398 aa  ALFC2_ARATH RecName: Full=Probable fructose-bisphosphate aldolase
   10::332     3e-70  42%  358 aa  ALF2_PLABA RecName: Full=Fructose-bisphosphate aldolase 2;       
   11::338     4e-70  46%  359 aa  ALF_CICAR RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic
   15::343     4e-70  45%  364 aa  ALDOC_MACFA RecName: Full=Fructose-bisphosphate aldolase C;        
   15::343     4e-70  45%  364 aa  ALDOC_HUMAN RecName: Full=Fructose-bisphosphate aldolase C;        
   15::343     1e-69  45%  364 aa  ALDOC_PANTR RecName: Full=Fructose-bisphosphate aldolase C;        
   44::374     2e-69  43%  388 aa  ALFC_ORYSJ RecName: Full=Fructose-bisphosphate aldolase,
   15::344     2e-69  44%  364 aa  ALDOA_RAT RecName: Full=Fructose-bisphosphate aldolase A;       
   55::386     3e-69  42%  399 aa  ALFC1_ARATH RecName: Full=Probable fructose-bisphosphate aldolase
   12::343     5e-69  43%  356 aa  ALFC1_PEA RecName: Full=Fructose-bisphosphate aldolase 1,
    6::337     6e-69  43%  349 aa  ALFC2_PEA RecName: Full=Fructose-bisphosphate aldolase 2,
   15::349     8e-69  44%  364 aa  ALDOA_HUMAN RecName: Full=Fructose-bisphosphate aldolase A;        
   15::344     1e-68  43%  364 aa  ALDOA_MOUSE RecName: Full=Fructose-bisphosphate aldolase A;        
   15::349     1e-68  43%  364 aa  ALDOA_RABIT RecName: Full=Fructose-bisphosphate aldolase A;        
   15::349     2e-68  43%  364 aa  ALDOA_PONAB RecName: Full=Fructose-bisphosphate aldolase A;        
   15::349     3e-67  43%  364 aa  ALDOA_PANTR RecName: Full=Fructose-bisphosphate aldolase A;        
   15::346     5e-67  42%  366 aa  ALF1_CAEEL RecName: Full=Fructose-bisphosphate aldolase 1;       
   15::343     2e-66  43%  364 aa  ALDOB_SPAAU RecName: Full=Fructose-bisphosphate aldolase B;        
   15::342     9e-63  44%  361 aa  ALF_DROME RecName: Full=Fructose-bisphosphate aldolase;       
   52::380     1e-61  41%  394 aa  ALFC_SPIOL RecName: Full=Fructose-bisphosphate aldolase,
   33::359     3e-58  40%  374 aa  ALFC_CHLRE RecName: Full=Fructose-bisphosphate aldolase 1,
   10::338     3e-52  35%  338 aa  ALF_ENCCU RecName: Full=Fructose-bisphosphate aldolase;       
    1::116     1e-21  46%  137 aa  ALDOC_CHICK RecName: Full=Fructose-bisphosphate aldolase C;        
    1::95      9e-21  50%  101 aa  ALF_LYMST RecName: Full=Fructose-bisphosphate aldolase;       
    1::187     2e-10  33%  296 aa  ALF1_STAAT RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     2e-10  33%  296 aa  ALF1_STAAE RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     2e-10  33%  296 aa  ALF1_STAAC RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     2e-10  33%  296 aa  ALF1_STAA8 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     2e-10  33%  296 aa  ALF1_STAA3 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAAW RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAAS RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAAR RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAAN RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAAM RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAA9 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAA2 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     3e-10  33%  296 aa  ALF1_STAA1 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     4e-10  32%  296 aa  ALF1_STAAB RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     1e-09  32%  296 aa  ALF1_STAHJ RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::179     3e-09  32%  295 aa  ALF1_CLOB8 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     8e-09  31%  296 aa  ALF1_STAES RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::187     8e-09  31%  296 aa  ALF1_STAEQ RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::267     1e-08  31%  294 aa  ALF1_OCEIH RecName: Full=Fructose-bisphosphate aldolase class 1;   
    5::283     2e-08  30%  300 aa  ALF1_SYNY3 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::179     2e-08  30%  295 aa  ALF1_CLOAB RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::280     8e-08  33%  296 aa  ALF1_STACT RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::179     2e-07  29%  295 aa  ALF1_TREDE RecName: Full=Fructose-bisphosphate aldolase class 1;   
    5::179     5e-07  31%  295 aa  ALF1_FUSNN RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::179     7e-04  30%  293 aa  ALF1_PORGI RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::179     7e-04  30%  293 aa  ALF1_PORG3 RecName: Full=Fructose-bisphosphate aldolase class 1;   
    1::336

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSELNKIALKILSNGKGILAADESNGTMTKRLESVNVPSSPENRLLFRETLFSSSGMKDFIGGVILYDET
ALF1_XYLFT      IEQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDET
ALF1_XYLFA      IEQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDET
ALF1_XANAC      IEQLAETAQAMVAPGKGIIAIDESTSTIAKRFASVGIENIEENRRAYRELLLTTPKLSDYISGAILFDET
ALDOB_DANRE     --ELATIAERIVAPGKGILAADESTGTMAKRFQKINVENTEENRRSFRDLLFSDDSISESIGGVILFHET
ALDOC_RAT       --ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDVKKCIGGVIFFHET
ALDOC_MOUSE     --ELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDVKKCIGGVIFFHET
ALDOB_RABIT     --ELSDIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFTDNSINQSIGGVILFHET
ALF2_LAMJA      --ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDSVTKAIGGVIFYEET
ALDOB_SHEEP     ---LSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFTDSSVSQSIGGVILFHET
ALF1_XANCP      IEQLAETAQAMVAPGKGIIAIDESTSTIAKRFSGVGIENTEENRRAYRELLLTTPKLSDYISGAILFDET
ALDOB_BOVIN     ---LSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFTDSSVSQSIGGVILFHET
ALF_SPIOL       --ELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEET
ALF_MAIZE       --ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEET
ALDOB_HUMAN     --ELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSDSSINQSIGGVILFHET
ALF_SCHMA       -NDLRRIAQAICAPGKGILAADESTATMGKRLQQIGVENNEENRRLYRQLLFSADHLAENISGVILFEET
ALF_ECHMU       MKELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPFAKHISGVILFHET
ALF1_PEA        --ELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEET
ALF1_LAMJA      --ELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDSIKEHIGGIIFFHET
ALDOB_PONAB     --ELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSDSSINQSIGGVILFHET
ALF_ORYSJ       --ELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEET
ALDOB_MOUSE     --ELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFSDNSISQSIGGVILFHET
ALFC3_ARATH     --ELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEET
ALF2_PEA        --ELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLLQYLSGVILFEET
ALDOC_DANRE     --ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDCIGGVIFFHET
ALF2_CAEEL      --ELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPNLNQHISGVILYEET
ALDOB_RAT       --ELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFSDNSISQSIGGVILFHET
ALDOB_CHICK     ---LSDIAQRIVASGKGILAADESVGTMGNRLQRINVENTEENRRAFREILFSSASISKSIGGVILFHET
ALDOC_CARAU     --ELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFTADERMDCIGGVIFFHET
ALF_PLAFA       --ELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEET
ALF_PLAF7       --ELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEET
ALF_DICDI       --ELIATAKAIVAPGKGILAADESTNTIGARFKKIXXXXXXXXXXXXXXXXIGTNGVNEFIGGIILYEET
ALF_ARATH       --ELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEET
ALF_TRYBB       -AELIETAKKMTAPGKGLLAADESTGSCSKRFAGIGLSNTAEHRRQYRALMLECEGFEQYISGVILHDET
ALFC2_ARATH     --ELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEET
ALF2_PLABA      --ELAETAKKLVAAGKGILAADESTQTIKKRFDNIKIENTVQNRASYRDLLFGTKGLGKFISGAILFEET
ALF_CICAR       --ELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEET
ALDOC_MACFA     --ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDVKKCIGGVIFFHET
ALDOC_HUMAN     --ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDVKKCIGGVIFFHET
ALDOC_PANTR     --ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDVKKCIGGVIFFHET
ALFC_ORYSJ      --ELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEET
ALDOA_RAT       --ELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET
ALFC1_ARATH     --ELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEET
ALFC1_PEA       --ELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEET
ALFC2_PEA       --ELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEET
ALDOA_HUMAN     --ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET
ALDOA_MOUSE     --ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET
ALDOA_RABIT     --ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET
ALDOA_PONAB     --ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIGGVILFHET
ALDOA_PANTR     --ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIVGVILFHET
ALF1_CAEEL      --ELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGALNKYISGVIMFHET
ALDOB_SPAAU     --ELSDIAQRIVAPGKGILAADESTGTMGKRFQXXXXXXXXXXRRCFRDILFSTASIANCVGGIIFFHET
ALF_DROME       --ELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPLAENISGVILFHET
ALFC_SPIOL      --ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEET
ALFC_CHLRE      --ELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEET
ALF_ENCCU       ---LGMTAKKILENGKGILAADETPKTLGRRFEKLGITNTEENRRKFREILFSTKGIERYIGGVILNQET
ALDOC_CHICK     ----------------------------------------------------------------------
ALF_LYMST       ----------------------------------------------------------------------
ALF1_STAAT      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAE      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAC      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAA8      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAA3      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAW      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAS      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAR      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAN      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAM      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAA9      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAA2      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAA1      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAAB      ---MNKEQLEKMKNGKGFIAADQSGGSTPKALKEYGINESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAHJ      ---MNKEQLEKMTNGKGFIAADQSGGSTPKALKGVNEDEYSNDDEMFQRVVTSPSFSPDKILGAILFEQT
ALF1_CLOB8      ---MNENQMKRIHTGKGFIAADQSGGSTPKALLEYGIKESNEDEMFMRKRIIKSPAFTEYILGAILFEDT
ALF1_STAES      ---MNKEQLEKMTHGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_STAEQ      ---MNKEQLEKMTHGKGFIAADQSGGSTPKALKEYGVNESNEDEMMRTRVVTSPSFSPDKILGAILFEQT
ALF1_OCEIH      ---MNQKQLEQMKTSKGFIAADQSGGSTPKALAAYGIPEDSYNNEMRTRIITSKAFDSDSIIGAILFEQT
ALF1_SYNY3      --EPNQEQLKKMKSHPGFIAADQSGGSTPGALADYGIEPSGDDQMFMRTRIMTSPGFTDRILAAILFEDT
ALF1_CLOAB      ---MNETQMNRISKDKGFIAADQSGGSTPKALEMFNLVHEMRKRII-KSTAFNSK----YILGAILFENT
ALF1_STACT      ---MNQEQFDKIKNGKGFIAADQSGGSTPKALKDYGVE---ENEYSNDEEMFSPAFNGEKILGAILFEQT
ALF1_TREDE      ---MDKVKLERMKNDKGFIAADQSGGSTPKALAAYGVPESNEKEMFMRTRIITGKAFNNNILGAILFEQT
ALF1_FUSNN      --------LEKMRNGKGFIAADQSGGSTPKALKGVNENEYSNDKEMFRTRIIKSPAFNESILGAILFEQT
ALF1_PORGI      ---MNKEQLQQMRQAPGFVGADQSGGSTPKALKAYGIQSEEEMFDLIHQMITSPAFATGKIIGVILFERT
ALF1_PORG3      ---MNKEQLQQMRQAPGFVGADQSGGSTPKALKAYGIQSEEEMFDLIHQMITSPAFATGKIIGVILFERT


                         .         .         *         .         .         .         .:140
query           INQTSNLKQTIPELISESGAVPGIKVDTGAKILAGSHEEKITEGLDGLRERLKDYYKLGARFTKWRGVFN
ALF1_XYLFT      IRQSTKAGVPFPKYMAEHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVIN
ALF1_XYLFA      IRQSTKAGVPFPKYMADHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVIN
ALF1_XANAC      IRQKTKDGVPFAEYMTAHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYYTLGARFAKWRAVIN
ALDOB_DANRE     LYQKSDKGVLFPKVIKDKGIVVGIKVDKGTAGLAGTDGETTTQGLDGLSERCAQYKKDGCDFAKWRCVLK
ALDOC_RAT       LYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLK
ALDOC_MOUSE     LYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLK
ALDOB_RABIT     LYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLR
ALF2_LAMJA      LYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLK
ALDOB_SHEEP     LYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTNKETTVQGLDGLSERCAQYKKDGADFGKWRAVLK
ALF1_XANCP      IRQKTKDGVPFAKYMADHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYYTLGARFAKWRAVIN
ALDOB_BOVIN     LYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTNKETTVQGLDGLSERCAQYKKDGADFGKWRAVLK
ALF_SPIOL       LYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLK
ALF_MAIZE       LYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLK
ALDOB_HUMAN     LYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLR
ALF_SCHMA       LHQKSDDGKTLPTLLAERNIIPGIKVDKGVVPLAGTDNETTTQGLDDLASRCAEYWRLGCRFAKWRCVLK
ALF_ECHMU       VYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLK
ALF1_PEA        LYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLK
ALF1_LAMJA      MYQKTDGGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQGLDGLAERCAQYKKDGADFAKWRCVLK
ALDOB_PONAB     LYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLR
ALF_ORYSJ       LYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLK
ALDOB_MOUSE     LYQKDSQGNLFRNVLKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLR
ALFC3_ARATH     LYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVS
ALF2_PEA        LYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLK
ALDOC_DANRE     LYQNTDDGTNFAQLIKDRXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLK
ALF2_CAEEL      FHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERXXXXXXXXXXXXXWRCVLN
ALDOB_RAT       LYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLR
ALDOB_CHICK     LYQKDSSGKPFPAIIKEKGMVVGIKLDAGTAPLAGTNGETTIQGLDKLAERCAQYKKDGADFGKWRAVLK
ALDOC_CARAU     LYQKADDGTPFAKMIKDRXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLK
ALF_PLAFA       LFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLV
ALF_PLAF7       LFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLV
ALF_DICDI       LYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLK
ALF_ARATH       LYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFK
ALF_TRYBB       VYQKAKTGETFPQYLRRRGVVPGIKTDCGLELVEGAKGEQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYK
ALFC2_ARATH     LYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVS
ALF2_PLABA      LFQKNEAGVPLVNLLHDEGIIPGIKVDKGLVSIPCTDDEKSTQGLDGLAERCKEYYKAGARFAKWRAVLV
ALF_CICAR       LYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLK
ALDOC_MACFA     LYQKDDNGVPFVRTIQXXXXXXXXXXXXXXXPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALDOC_HUMAN     LYQKDDNGVPFVRTIQXXXXXXXXXXXXXXXPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALDOC_PANTR     LYQKDDNGVPFIRTILXXXXXXXXXXXXXXXPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALFC_ORYSJ      LYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVS
ALDOA_RAT       LYQKADDGRPFPQXXXXXXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALFC1_ARATH     LYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVS
ALFC1_PEA       LYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVS
ALFC2_PEA       LYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVS
ALDOA_HUMAN     LYQKADDGRPFPQXXXXXXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALDOA_MOUSE     LYQKADDGRPFPQXXXXXXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALDOA_RABIT     LYQKADDGRPFPQXXXXXXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALDOA_PONAB     LYQKADDGRPFPQXXXXXXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALDOA_PANTR     LYQKADDGRPFPQXXXXXXXXXXXXXXXXXXPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLK
ALF1_CAEEL      FYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHK
ALDOB_SPAAU     LYQKSSNGKLFPQXXXXXXXXXXXXXXXXTAPLMGTDKETTTQGLDGLSERCAQYKKDGCDFAKWRCVLK
ALF_DROME       LYQKADDGTPFAEXXXXXXXXXXXXVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLK
ALFC_SPIOL      LYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVS
ALFC_CHLRE      LYQSTASGKKFVDVMKEQNIVPGIKVDKGL-VPCPTPTMSWCMGLDGWTS-AAEYYKAGARFAKWRSV--
ALF_ENCCU       FEQTSG--SGVPLTXXXXXXXXXXXXXXXXXXXDYKEKEKISVGLEDLDLRCKSSAFKDATFAKWRSLFY
ALDOC_CHICK     ----------------------------------------------------------------------
ALF_LYMST       ----------------------------------------------------------------------
ALF1_STAAT      MDREVESKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDNLLDRANERHIFG---TKMRS--N
ALF1_STAAE      MDREVESKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDNLLDRANERHIFG---TKMRS--N
ALF1_STAAC      MDREVESKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDNLLDRANERHIFG---TKMRS--N
ALF1_STAA8      MDREVESKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDNLLDRANERHIFG---TKMRS--N
ALF1_STAA3      MDREVESKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDNLLDRANERHIFG---TKMRS--N
ALF1_STAAW      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAAS      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAAR      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAAN      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAAM      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAA9      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAA2      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAA1      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAAB      MDREVEGKYT-ADYLADKGVVPFLKVDKGAEEQNGVQLMKPIDNLDSLLDRANERHIFG---TKMRS--N
ALF1_STAHJ      MDREVEGKYT-GDYLADKGVVPFLKVDKGAEQQNGVQLMKPIDDLDDTLDRAVERHIFG---TKMRS--N
ALF1_CLOB8      MYRTIDNQYTPDYLWKEKNIVPFLKVDKGTEIENGVQLMKPISNLDDL---LKHAVEKNIFGTKMRSVIK
ALF1_STAES      MDREVEGKYT-GDYLADKGVVPFLKVDKGAEEKNGVQLMKPIDDLDETLDRANERHIFG---TKMRS--N
ALF1_STAEQ      MDREVEGKYT-GDYLADKGVVPFLKVDKGAEEKNGVQLMKPIDDLDATLNRANERHIFG---TKMRS--N
ALF1_OCEIH      MDREIEGMYTGDYLAEKKGIVPFLKVDKG--LAEETNGVQLMKPIDNLDETLRRANERNIFGTKMRSVI-
ALF1_SYNY3      MNREVDGEPTANYLWQNKQIVPILKVDKGAQEKDGSQLMKPIPQLDSLLMKAK---KKGIFGTKMRSFI-
ALF1_CLOAB      MYRTIDHKYTADYLWNEKNIVPFLKIDKGLSEL--ENGVQLMKPITNLDELLKAAIEKNIFGTKMRSFIK
ALF1_STACT      MDREVEGKYT-GSYLADKGIVPFLKVDKGAEEADGVQLMKPIPDLDKLLDRANERGIFG---TKMRS--N
ALF1_TREDE      MEREIEGMPTADFLWEKKKILPFLKVDKGADLKDGVQLMKPIPNLDAMLKHAVEKHIFG---TKMRSVI-
ALF1_FUSNN      MDSKIDGKYTADFLWEEKKVLPFLKIDKGLNDLDGVQTMKPNPTLADLLKRANERHIFG---TKMRSVI-
ALF1_PORGI      MRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEAGVQLMKPFPELGKLCEEAVGYHVFG---TKMRSVI-
ALF1_PORG3      MRGKIEGMPTADFLWEKRHIVPFLKVDKGLQDEAGVQLMKPFPELGKLCEEAVGYHVFG---TKMRSVI-


                         +         .         .         .         .         *         .:210
query           ISDKYPSKLSIHSNAHALARYSALVQECGMVPIVEPEVLMDGDHAAETCFNKTSEVIQKCFEELLLHKID
ALF1_XYLFT      IGDDIPSGMCIDANVHALARYAALCQEQGLVPMVEPEVIMDGNHDISAAYEVTEATLRSLFNALYEQNVV
ALF1_XYLFA      IGDDIPSGMCIDANVHALARYAALCQEQGLVPMVEPEVIMDGNHDISAAYEVTEATLRSLFNALYEQNVV
ALF1_XANAC      IGEDIPSGTCIEANSHALARYAALCQEQGLVPMVEPEVIMDGSHDIETCYEVTEATLRSLFGALYEQNVV
ALDOB_DANRE     ISDSCPSALGIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKQCQYATEKVLAAVYKALSDHHVY
ALDOC_RAT       ISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQFVTEKVLAAVYKALSDHHVY
ALDOC_MOUSE     ISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVY
ALDOB_RABIT     IADQCPSSLAIQENANTLARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVY
ALF2_LAMJA      ISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSDHHVY
ALDOB_SHEEP     IDNQCPSHLAIQENANTLARYASIYQQNGLVPIVEPEVIPDGSHDMEHCQYVTEKVLAAVYKALNDHHVY
ALF1_XANCP      IGEDIPSGTCIEXXXXXXXXXXXLCQEQGLVPMVEPEVIMDGDHDIETCYEVTEATLRSLFGALYEQNVV
ALDOB_BOVIN     IDNQCPSHLAIQENANTLARYASICQQNGLVPIVEPEVIPDGSHDMEHCQYVTEKVLAAVYKALNDHHVY
ALF_SPIOL       IGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVL
ALF_MAIZE       IGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVL
ALDOB_HUMAN     IADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVY
ALF_SCHMA       ISSHTPSYLAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLLTAQRVTEQVLAFVYKALADHHVY
ALF_ECHMU       ISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQVLSFVYKALADHHVY
ALF1_PEA        IGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAACYKALNDQHVL
ALF1_LAMJA      ISPNTPSRLSIVENANVLARYATICQQNGLVPIVEPEILPDGDHDLKTCQYITEKVLAATYKALSDHHVY
ALDOB_PONAB     IADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAAYKALNDHHVY
ALF_ORYSJ       IGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVL
ALDOB_MOUSE     IADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVLPDGDHDLEHCQYVSEKVLAAVYKALNDHHVY
ALFC3_ARATH     VPCG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAQNNVM
ALF2_PEA        IGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAATYKALSDHHVI
ALDOC_DANRE     ISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVY
ALF2_CAEEL      IGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVY
ALDOB_RAT       ISDQCPSSLAIQENANALARYASICQQNGLVPIVEPEVLPDGDHDLEHCQYVSEKVLAAVYKALNDHHVY
ALDOB_CHICK     ISSTTPSQLAIQENANTLARYASICQQNGLVPIVEPEVLPDGDHDLQRCQYVTEKVLAAVYKALNDHHVY
ALDOC_CARAU     ISETSPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAACYKALSDHHVY
ALF_PLAFA       IDTAKPTDLSIHETAWGLARYASICQQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVL
ALF_PLAF7       IDTAKPTDLSIHETAWGLARYASICQQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVL
ALF_DICDI       IAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKALNDHHIL
ALF_ARATH       IGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVL
ALF_TRYBB       IQNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHGVV
ALFC2_ARATH     IPNG-PSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTYDVAEKVWAEVFFYLAQNNVM
ALF2_PLABA      IDPAKPTDLSIQEVSWGLARYASICQQNKLVPIVEPEILADGAHTIEVCATVTQKVLASVFKALHDNGVL
ALF_CICAR       IGPNEPS-LSILSNAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAATYKALSDHHVL
ALDOC_MACFA     ISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVY
ALDOC_HUMAN     ISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVY
ALDOC_PANTR     ISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVY
ALFC_ORYSJ      IPNG-PSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAETFFYMAENNVM
ALDOA_RAT       IGEHTPSSLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVY
ALFC1_ARATH     IPNG-PSALAVKEAAWGLARYAAISQDSGLVPIVEPEIMLDGEHGIDRTYDVAEKVWAEVFFYLAQNNVM
ALFC1_PEA       IPNG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAEVFYYLAENNVQ
ALFC2_PEA       IPNG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAEVFYYLAENNVQ
ALDOA_HUMAN     IGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIY
ALDOA_MOUSE     IGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVY
ALDOA_RABIT     IGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIY
ALDOA_PONAB     IGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIY
ALDOA_PANTR     IGEHTPSALAIMENANVLARYASICQQNGIVPIAEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIY
ALF1_CAEEL      ISSTTPSVTALKEIASNLSRYASICQQNGLVPIVEPEILPDGEHCLARGQKITETVLSYVYHALNEHHVF
ALDOB_SPAAU     ISDGCPFALAIAENANVLARYASICQMNGLVPIVEPEILPDGDHDLQRCQYATEKVLAAVYKALSDHHVY
ALF_DROME       IGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVY
ALFC_SPIOL      IPNG-PSALAVKEAAWGLARYAAITQDNGLDPILEPEIMLDGEHGIDRTFRVAQQVWAEVFFNLAENNVL
ALFC_CHLRE      VSIPHGPSIMLPRLAYGLARYAAIAQNAGLVPIVEPEVLLDGEHDIDRCLEVQEAIWAETFKYMADNKVM
ALF_ENCCU       FYDGIPSEDCINENCSILAKYAIICQKNGLVPIVEPEVFLEGDYSMKRSYEVTRQILSTLMKYLNYELVY
ALDOC_CHICK     ----------------------------------------------------------------------
ALF_LYMST       ------------------------------------------------------------------HNMF
ALF1_STAAT      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAE      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAC      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAA8      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAA3      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAW      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAS      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAR      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAN      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAM      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAA9      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAA2      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAA1      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAAB      ILEL--NEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_STAHJ      ILEL--NEQGIKDVVEQQFEFAKKIIAKGLVPIIEPEVNINAKDKAE-----------------------
ALF1_CLOB8      EANAKGIKMLVNQQ----FEIGKQIVEAGLVPIIEPEV--------------------------------
ALF1_STAES      ILEL--NEQGIKDVVEQQFEFAKKIIAKGLVPIIEPEVNINAKDKSE-----------------------
ALF1_STAEQ      ILEL--NEQGIKDVVEQQFEFAKKIIAKGLVPIIEPEVNINAKDKSE-----------------------
ALF1_OCEIH      ---KQANPKAIKEVVDQQFDIGKKIIAAGLVPIIEPEVDI---HSPEK---------EKC-EDLLKAEIH
ALF1_SYNY3      ---KHANPAGIEAIVDQQFELAQQIIAAGLVPIIEPEVDI---HCSE-----------KAQAEALLKQAM
ALF1_CLOAB      EANSKGIKMVVDQQFELADK----IANQGLVPIIEPEV--------------------------------
ALF1_STACT      ILEN--NKEAIEKVVKQQFEVAKEIIAAGLVPIIEPEVNINA---------KDKEAIEANLAEAI--KAE
ALF1_TREDE      ---KEANPKGIKAVVDQQFELGIQIAKAGLVPIIEPEV--------------------------------
ALF1_FUSNN      ---KKASPAGIXXXXXXXXXXXXXXXXXGLIPIIEPEV--------------------------------
ALF1_PORGI      ---KQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEV--------------------------------
ALF1_PORG3      ---KQANEQGIRDIVEQQFQWGKEILSHGLVPILEPEV--------------------------------


                         .         .         .         +         .         .         .:280
query           LSGIILKPNMILAGTTSDKKISSEEVAKLTLKCLKENVPTDVPGIAFLSGGQTEVEATENLNLINKYNDT
ALF1_XYLFT      LEGTILKASMVIPGTDCEEQASIDEVAESTVMCLKSTVPAILPGIVFLSGGQTDAQSTAHLNAMNQFDPL
ALF1_XYLFA      LEGTILKASMVIPGTDCEEQASIDEVAESTVMCLKSTVPAILPGIVFLSGGQTDAQSTAHLNAMNQLDPL
ALF1_XANAC      LEGTILKASMVISGKSCEEQASIEEVAESTVMCLKSTVPAILPGIVFLSGGQTDEQSTAHLNEMHQLGNL
ALDOB_DANRE     LEGTLLKPNMVTAGHSCTKKYTPLEVAMATVTALRRTVPAAVPGICFLSGGQSEEEASLNLNAMNQLSHR
ALDOC_RAT       LEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCSPR
ALDOC_MOUSE     LEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPPR
ALDOB_RABIT     LEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPPK
ALF2_LAMJA      LEGSLLKPNMVTAGQASKIRCSPQEVAMATVTALRRTVPSAVPGITFLSGGQSEEDASLNLNAINQLPER
ALDOB_SHEEP     LEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPPK
ALF1_XANCP      LEGTILKASMVISGKGCXXXXXXXXXXXXTVMCLKSTVPAILPGIVFLSGGQTDEQSTAHLNEMHQLGNL
ALDOB_BOVIN     LEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPPK
ALF_SPIOL       LEGTSLKPNIVTPGSES-KKVTPEVIAEYTVRTLQRTVPQAVPGVMFLSGGQSEEEATLNLNAMNKLETK
ALF_MAIZE       LEGTLLKPNMVTPGSDS-KKVTPEVIAEYTVRTLQRTVPAAVPAVLFLSGGQSEEEATRNLNAMNKLSTK
ALDOB_HUMAN     LEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPPK
ALF_SCHMA       LEGTLLKPNMVTAGQACKKAYTPQENALATVRALQRTVPPAVPGITFLSGGQSELDATKNLNEINKIGPK
ALF_ECHMU       LEGTLLKPNMVTCGQSCTKKYSVEDNARATVEALQRTVPVAVPGVVFLSGGQSELDATRNLNAINKYGKK
ALF1_PEA        LEGTLLKPNMVTPGSDS-PKVSPEVIGEYTVNALRRTVPAAVPGIVFLSGGQSEEQATLNLNAMNKFDVV
ALF1_LAMJA      LEGTLLKPNMVTVGTAAPASTRPEQVAMATLTALRRTVPPAVPGITFLSGGQSEEDASIHLNAINKLHLI
ALDOB_PONAB     LEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPPK
ALF_ORYSJ       LEGTLLKPNMVTPGSDA-KKVSPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTK
ALDOB_MOUSE     LEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINRCPPR
ALFC3_ARATH     FEGILLKPSMVTPGAEHKNKASPETVADFTLTMLKRRVPPAVPGIMFLSGGQSEAEATLNLNAMNQ-SPN
ALF2_PEA        LEGTLLKPNMVTPGSDA-PKVAPEVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEEASVNLNAINQIKGK
ALDOC_DANRE     LEGTLLKPNMVTAGHSCPTKYSSEEIAMATVTALRRTVPPAVSGVTFLSGGQSEEEASVNLNSINNCPLA
ALF2_CAEEL      LEGTLLKPNMVTPGQSSASKASHEAIGLATVTALRRGVPAAVPGITFLSGGQSELDATANLNAINSVQGK
ALDOB_RAT       LEGTLLKPNMLTAGHACTKKYTPEQVAMATVTALHRTVPAAVPSICFLSGGMSEEDATLNLNAIYRCPPR
ALDOB_CHICK     LEGTLLKPNMVTAGHSCPKKYTPQDXXXXXXXXXXXXXXXXXPGICFLSGGQSEEEASLNLNAMNQSPPK
ALDOC_CARAU     LEGTLLKPNMVTAGHSCPTKFSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINNCPLT
ALF_PLAFA       LEGALLKPNMVTAGYECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPH
ALF_PLAF7       LEGALLKPNMVTAGYECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPH
ALF_DICDI       LEGALLKPNMVVNGTDCPIKATSEQIGKFTVRTLQRTVPPALTGVVFLSGGQTEIEATANLNAMNVLPNR
ALF_ARATH       LEGTLLKPNMVTPGSDS-PKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAMNKLDVL
ALF_TRYBB       WEGCLLKPNMVVPGAESGLKGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMASEYLNAMNNCPPR
ALFC2_ARATH     FEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRVPPAVPGIMFLSGGQSEVEATLNLNAMNQAPNP
ALF2_PLABA      LEGASLKPNMVTAGYDCTEKTKTDDIGFFTVRTLRRTVPPALPGVAFLSGGQSEEDASINLNSINVLGPH
ALF_CICAR       LEGTLLKPNMVTPGSDS-PKVAPEVVAEHTVRALQRTVPAAVPAVVFLSGGQSEEEATVNLNAINQVKGK
ALDOC_MACFA     LEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPPR
ALDOC_HUMAN     LEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPPR
ALDOC_PANTR     LEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPPR
ALFC_ORYSJ      FEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSGGQSEVEATQNLNAMNQ-GPN
ALDOA_RAT       LEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLL
ALFC1_ARATH     FEGILLKPSMVTPGAEATDRATPEQVASYTLKLLRNRIPPAVPGIMFLSGGQSELEATLNLNAMNQAPNP
ALFC1_PEA       FEGILLKPSMVTPGAESKDKASPTKVAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNK-SPN
ALFC2_PEA       FEGILLKPSMVTPGAESKDKASPTKVAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMNK-SPN
ALDOA_HUMAN     LEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLL
ALDOA_MOUSE     LEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLL
ALDOA_RABIT     LEGTLLKPNMVTPGHACTQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLL
ALDOA_PONAB     LEGTLLKPNMVTPGHACTQKFSHEEIVMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLL
ALDOA_PANTR     LEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLL
ALF1_CAEEL      LEGTLLKPNMVTSGQSTGEKPSNADIGLATVTALQRGVPSAVPGVVFLSGGQSEEDATLNLNAINQVSGK
ALDOB_SPAAU     LEGTLLKPNMVTPGHSCPKKFTPQEVAMATVTALRRTVPASVPGICFLSGGQSEEEASIHLNAINQVPHR
ALF_DROME       LEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLI
ALFC_SPIOL      LEGSSLKPSMVGPGALSARKGPPEQVADYPLKLLHRRRGPVVPGIMVLSGGQSEVEATLNLNAMNQ-SPN
ALFC_CHLRE      LQGILLKPAMVTPGADCKNKAGPAKVAEYTLKMLAARAP-PVPGIMFLSGGQSELESTLNLNAMNQ-SPN
ALF_ENCCU       IPGVLIKASYVTSGQLSNEKYTPKKVATFTLRALLSTIPCGIPGIVFLSGGHGSEDAIGFLNAINERGCR
ALDOC_CHICK     ----LLKPNMVTPGHSCPTKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINTCPLV
ALF_LYMST       LEGTLLKPNMVTAGQGCPKKYTPEDIARATVTALNRTVPAAVAGITFLSGGQSEEDATINLNAINQFPGR
ALF1_STAAT      ----------------------------------------------------------------------
ALF1_STAAE      ----------------------------------------------------------------------
ALF1_STAAC      ----------------------------------------------------------------------
ALF1_STAA8      ----------------------------------------------------------------------
ALF1_STAA3      ----------------------------------------------------------------------
ALF1_STAAW      ----------------------------------------------------------------------
ALF1_STAAS      ----------------------------------------------------------------------
ALF1_STAAR      ----------------------------------------------------------------------
ALF1_STAAN      ----------------------------------------------------------------------
ALF1_STAAM      ----------------------------------------------------------------------
ALF1_STAA9      ----------------------------------------------------------------------
ALF1_STAA2      ----------------------------------------------------------------------
ALF1_STAA1      ----------------------------------------------------------------------
ALF1_STAAB      ----------------------------------------------------------------------
ALF1_STAHJ      ----------------------------------------------------------------------
ALF1_CLOB8      ----------------------------------------------------------------------
ALF1_STAES      ----------------------------------------------------------------------
ALF1_STAEQ      ----------------------------------------------------------------------
ALF1_OCEIH      LNQLSEDENVMLKLTIPTKKNLYKELI---------DHPRVVRVVA-LSGGYSTDVANEKLK-------E
ALF1_SYNY3      LKHL----NQLPKGQWVMLKLTLPEQDNLYSNCIEH---ANVLRVVALSGGYSQAEANERLSR-NHGVIA
ALF1_CLOAB      ----------------------------------------------------------------------
ALF1_STACT      LDNLKKDQYVMLKLTIPTKVNAYSELIE----------HPQVIRVVALSGGYSRDEA----NKILKQNDG
ALF1_TREDE      ----------------------------------------------------------------------
ALF1_FUSNN      ----------------------------------------------------------------------
ALF1_PORGI      ----------------------------------------------------------------------
ALF1_PORG3      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NFIMTYSYGRALQQSALKFWSKDINNTSGTQKVFNHRANMCTLAAQGKWSKELEAK
ALF1_XYLFT      PWPLSFSYGRAMQQAALKLWSQDMGNFAKAQQVVYERAKENGLAALGKW-------
ALF1_XYLFA      PWPLSFSYGRAMQQAALKLWSQDMGNFAKAQQVVYERAKENGLAALGKW-------
ALF1_XANAC      PWPLSFSYGRAMQQAALKLWAKDMGNFAKAQQVIYERAKENGLAALGKW-------
ALDOB_DANRE     PWKLSFSYGRALQASALSAWKGQAANKKASQDAFVTRAKINSLASKGEYKPSGQA-
ALDOC_RAT       PWALTFSYGRALQASALSAWRGQRDNAGAATEEFIKRAEMNGLAAQGKY-------
ALDOC_MOUSE     PWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRY-------
ALDOB_RABIT     PWKLSFSYGRALQASALAAWGGKAENKKATQEAFMKRAVVNCQAAKGQY-------
ALF2_LAMJA      PWALSFSYGRALQASVLXXXXXXXXXXXXXXXEFEKRAAINGLAAQGKY-------
ALDOB_SHEEP     PWKLSFSYGRALQASALAAWGGKAENKKATQEAFMKRALANSQAAKGQY-------
ALF1_XANCP      PWPLSFSYGRAMQQAALKLWSKDMGNYAKAQQIIYERAKENGLAALGKW-------
ALDOB_BOVIN     PWKLSFSYGRALQASALAAWGGKAENKKTTQEAFMKRALANSQAAKGQY-------
ALF_SPIOL       KWTLSFSYGRALQQSTLKAWQGKEENVAKAQEVFLARAKGNSEATLGKY-------
ALF_MAIZE       KWSLSFSFGRALQASTLKAWAGKVENLEKARAAFLARCKANSEATLGTYKGDAAA-
ALDOB_HUMAN     PWKLSFSYGRALQXXXXXXXXXXXXNKEATQEAFMKRAMANCQAAKGQY-------
ALF_SCHMA       PWALTFSFGRALQASVLATW------------------------------------
ALF_ECHMU       PWALSFSFGRALQASAIAAWQGKPENVKAGQAEFLQLAKANGAASLGKFEGELK--
ALF1_PEA        KWTLSFSFGRALQQSTLKTWSGKKENVGKAQDVF----------------------
ALF1_LAMJA      KWALTFSYGRALQASVLKAWGGKKENLKAAQDELMRRAKINGQASKGEY-------
ALDOB_PONAB     PWKLSFSYGRALQXXXXXXXXXXXXNKEATQEAFMKRAVANHQAAKGQY-------
ALF_ORYSJ       KWSLSFSFGRALQQSTLKAWSGKAENIEKARAAFLTRCKANSEATLGTY-------
ALDOB_MOUSE     PWKLSFSYGRALQXXXXXXXXXXXXXXXXTQEAFMKRAMANCQAAQGQY-------
ALFC3_ARATH     PWHVSFSYARALQNSVLRTWQGKPEKIEASQKALLVRAKANSLAQLGKYSAEGE--
ALF2_PEA        KWTLSFSFGRALQQSTLKAWGGKTENVKAAQDALLTRAKANSEATLGTY-------
ALDOC_DANRE     KWPLTFSYGRALQASALSAWRGAKSNEKAATEEFIKRAEANGLAAQGKY-------
ALF2_CAEEL      PWKLTFSYGRALQASVLKAWGGKDENIAAAQKTLLHRSKANGDASLGKY-------
ALDOB_RAT       PWKLSFSYGRALQXXXXXXXXXXXXXXXXTQEAFMKRAVANCQAAQGQY-------
ALDOB_CHICK     PWKLTFSYGRALQASALAAWLGKSENKKAAQEAFCKRAQINSLACRGQY-------
ALDOC_CARAU     KWALTFSYGRALQASALSAWRGVKENEKAATEEFLKRAEANGLAAQGKY-------
ALF_PLAFA       PWALTFSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSL-------------
ALF_PLAF7       PWALTFSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSL-------------
ALF_DICDI       PWALSFSYGRALQASVISTWKGESANVEAARKVYLHRAKCNSLAQLGKY-------
ALF_ARATH       KWTLTFSFGGALQQSAIKAWAGKPENVAKAQAKFLTRCKANKDATLGKYT------
ALF_TRYBB       PWKLTFSYARALQSSAIKRWGGKESGVEAGRRAFMHRAKMNSLAQLGKYNR-----
ALFC2_ARATH     -WHVSFSYARALQNTCLKTWGGRPENVNAAQTTLLARAKANSLAQLGKYTGEGESE
ALF2_PLABA      PWALTFSYGRALQASVLNTWQGKKENVAKARRVLLQRAEANSL-------------
ALF_CICAR       KWTLSFSFGRALQQSTLKAWSGKEENVKNAQDALLTRAKANSEATLGTY-------
ALDOC_MACFA     PWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKY-------
ALDOC_HUMAN     PWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKY-------
ALDOC_PANTR     PWALTFSYGRALQASALNAWRGQRDNAEAATEEFIKRAEVNGLAAQGKY-------
ALFC_ORYSJ      PWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKANSLAQLGKYTSDGEA-
ALDOA_RAT       KWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYT------
ALFC1_ARATH     -WHVSFSYARALQNTCLKTWGGKEENVKAAQDILLARAKANSLAQLGKYTGEGESE
ALFC1_PEA       PWHVSFSYARALQNTALKTWGGLPENVKAAQEALLFRAKSNSLAQLGKYYGDGESE
ALFC2_PEA       PWHVSFSYARALQNTALKTWGGLPENVKAAQEALLFRAKSNSLAQLGKYIGDGESE
ALDOA_HUMAN     KWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQA-
ALDOA_MOUSE     KWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYT------
ALDOA_RABIT     KWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQA-
ALDOA_PONAB     KWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQA-
ALDOA_PANTR     KWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQA-
ALF1_CAEEL      KWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHRAQVNSLASVGKYT------
ALDOB_SPAAU     PWKLTFSYGRALQASALAAWQGKDANKAATQQVFVTRAKINGLASKGEY-------
ALF_DROME       RWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKY-------
ALFC_SPIOL      PWHVSFSYARALQNTCLKTWVEGQENVKAQDFAC---AKSNSLAQLGKYTGEGESE
ALFC_CHLRE      PWHVSFSYARALTNTVLKTWQASPRTVQAPRLAAQARAN--SDAQQGKYDATTEGK
ALF_ENCCU       TWSLSFSFARALTDGVLETWRGDDSNIEEAQKILLETSFKACRGAEGKWDQE----
ALDOC_CHICK     RWALTFSYGRALQASALSAWRGQRDNANAATEEFVKRAEVNGLAALGKY-------
ALF_LYMST       KWPLTFSYGRALQASVLKAW------------------------------------
ALF1_STAAT      --------------------------------------------------------
ALF1_STAAE      --------------------------------------------------------
ALF1_STAAC      --------------------------------------------------------
ALF1_STAA8      --------------------------------------------------------
ALF1_STAA3      --------------------------------------------------------
ALF1_STAAW      --------------------------------------------------------
ALF1_STAAS      --------------------------------------------------------
ALF1_STAAR      --------------------------------------------------------
ALF1_STAAN      --------------------------------------------------------
ALF1_STAAM      --------------------------------------------------------
ALF1_STAA9      --------------------------------------------------------
ALF1_STAA2      --------------------------------------------------------
ALF1_STAA1      --------------------------------------------------------
ALF1_STAAB      --------------------------------------------------------
ALF1_STAHJ      --------------------------------------------------------
ALF1_CLOB8      --------------------------------------------------------
ALF1_STAES      --------------------------------------------------------
ALF1_STAEQ      --------------------------------------------------------
ALF1_OCEIH      NNGLIASFSRALSQ------------------------------------------
ALF1_SYNY3      SFSRALTEGLTAQQTDAEF-------------------------------------
ALF1_CLOAB      --------------------------------------------------------
ALF1_STACT      ---LIASFSRALQQSDAEFNEK----------------------------------
ALF1_TREDE      --------------------------------------------------------
ALF1_FUSNN      --------------------------------------------------------
ALF1_PORGI      --------------------------------------------------------
ALF1_PORG3      --------------------------------------------------------