[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21413.1

[Show Plain Result]


## Summary of Sequence Search
    1::241
    1::241     e-116 100%  241 aa  Y592_PELUB RecName: Full=UPF0082 protein SAR11_0592;
    1::235     4e-59  49%  248 aa  Y2795_RHISN RecName: Full=UPF0082 protein NGR_c27950;
    1::241     6e-59  47%  248 aa  Y2114_PARL1 RecName: Full=UPF0082 protein Plav_2114;
    1::235     4e-58  49%  248 aa  Y2641_SINMW RecName: Full=UPF0082 protein Smed_2641;
    1::235     6e-58  48%  248 aa  Y2753_RHIME RecName: Full=UPF0082 protein R02753;
    1::235     8e-58  49%  248 aa  Y3631_AGRVS RecName: Full=UPF0082 protein Avi_3631;
    1::235     1e-57  47%  248 aa  Y2729_NITWN RecName: Full=UPF0082 protein Nwi_2729;
    1::235     3e-57  49%  248 aa  Y3727_AGRT5 RecName: Full=UPF0082 protein Atu3727;
    1::237     3e-57  47%  248 aa  Y2308_RHOS1 RecName: Full=UPF0082 protein Rsph17029_2308;
    1::237     3e-57  47%  248 aa  Y2261_RHOS4 RecName: Full=UPF0082 protein RHOS4_22610;
    1::237     3e-57  47%  248 aa  Y163_BARBK RecName: Full=UPF0082 protein BARBAKC583_0163;
    1::237     5e-57  47%  248 aa  Y577_RHOS5 RecName: Full=UPF0082 protein Rsph17025_0577;
    1::235     7e-57  47%  249 aa  Y3945_RHILO RecName: Full=UPF0082 protein mll3945;
    1::237     9e-57  47%  248 aa  Y2012_RHOSK RecName: Full=UPF0082 protein RSKD131_2012;
    1::235     1e-56  47%  248 aa  Y4273_RHOP2 RecName: Full=UPF0082 protein RPB_4273;
    1::235     6e-56  46%  248 aa  Y4807_RHOPB RecName: Full=UPF0082 protein RPC_4807;
    1::248     8e-56  46%  254 aa  Y419_NOVAD RecName: Full=UPF0082 protein Saro_0419;
    1::237     8e-56  46%  248 aa  Y2363_BART1 RecName: Full=UPF0082 protein BT_2363;
    1::237     8e-56  46%  248 aa  Y1481_BARHE RecName: Full=UPF0082 protein BH14810;
    1::235     1e-55  47%  248 aa  Y4171_RHOPS RecName: Full=UPF0082 protein RPD_4171;
    1::235     1e-55  47%  248 aa  Y3692_BRUSI RecName: Full=UPF0082 protein BSUIS_B1192;
    1::235     1e-55  47%  248 aa  Y321_BRUME RecName: Full=UPF0082 protein BMEI0321;
    1::235     1e-55  47%  248 aa  Y1769_BRUMB RecName: Full=UPF0082 protein BMEA_A1769;
    1::235     1e-55  47%  248 aa  Y1755_BRUC2 RecName: Full=UPF0082 protein BCAN_A1755;
    1::235     1e-55  47%  248 aa  Y1729_BRUA2 RecName: Full=UPF0082 protein BAB1_1729;
    1::235     1e-55  47%  248 aa  Y1717_BRUSU RecName: Full=UPF0082 protein BR1717;
    1::235     1e-55  47%  248 aa  Y1702_BRUAB RecName: Full=UPF0082 protein BruAb1_1702;
    1::235     1e-55  47%  248 aa  Y1660_BRUO2 RecName: Full=UPF0082 protein BOV_1660;
    1::235     2e-55  47%  248 aa  Y1200_OCHA4 RecName: Full=UPF0082 protein Oant_1200;
    1::235     5e-55  46%  246 aa  Y1072_SILPO RecName: Full=UPF0082 protein SPO1072;
    1::240     7e-55  45%  248 aa  Y4771_RHOP5 RecName: Full=UPF0082 protein RPE_4771;
    1::235     7e-55  43%  249 aa  Y153_ZYMMO RecName: Full=UPF0082 protein ZMO0153;
    1::237     7e-55  46%  248 aa  Y1179_BARQU RecName: Full=UPF0082 protein BQ11790;
    1::235     1e-54  46%  248 aa  Y3475_RHIEC RecName: Full=UPF0082 protein RHE_CH03475;
    1::235     2e-54  46%  248 aa  Y3714_RHIE6 RecName: Full=UPF0082 protein RHECIAT_CH0003714;
    1::235     2e-54  45%  246 aa  Y2018_ROSDO RecName: Full=UPF0082 protein RD1_2018;
    1::235     3e-54  46%  248 aa  Y3214_RHILW RecName: Full=UPF0082 protein Rleg2_3214;
    1::235     4e-54  51%  247 aa  Y2142_SPHWW RecName: Full=UPF0082 protein Swit_2142;
    1::235     6e-54  46%  246 aa  Y2762_DINSH RecName: Full=UPF0082 protein Dshi_2762;
    1::235     7e-54  46%  248 aa  Y3983_RHIL3 RecName: Full=UPF0082 protein RL3983;
    1::235     9e-54  50%  248 aa  Y1534_BRAJA RecName: Full=UPF0082 protein blr1534;
    1::235     3e-53  44%  246 aa  Y1893_SILST RecName: Full=UPF0082 protein TM1040_1893;
    1::237     5e-53  44%  246 aa  Y1905_PARDP RecName: Full=UPF0082 protein Pden_1905;
    1::247     6e-53  44%  255 aa  Y3380_JANSC RecName: Full=UPF0082 protein Jann_3380;
    1::246     1e-52  45%  253 aa  Y2433_MARMM RecName: Full=UPF0082 protein Mmar10_2433;
    1::240     2e-52  43%  248 aa  Y1143_BRASO RecName: Full=UPF0082 protein BRADO1143;
    1::235     5e-52  44%  249 aa  Y3192_MESSB RecName: Full=UPF0082 protein Meso_3192;
    1::235     7e-52  46%  248 aa  Y3068_PHEZH RecName: Full=UPF0082 protein PHZ_c3068;
    1::235     7e-52  44%  248 aa  Y1287_RHOPT RecName: Full=UPF0082 protein Rpal_1287;
    1::235     7e-52  44%  248 aa  Y1097_RHOPA RecName: Full=UPF0082 protein RPA1097;
    1::240     2e-51  47%  248 aa  Y6910_BRASB RecName: Full=UPF0082 protein BBta_6910;
    1::237     2e-50  44%  247 aa  Y2673_PELPD RecName: Full=UPF0082 protein Ppro_2673;
    1::242     3e-50  41%  249 aa  Y1679_GLUOX RecName: Full=UPF0082 protein GOX1679;
    1::211     2e-49  46%  248 aa  Y510_AZOC5 RecName: Full=UPF0082 protein AZC_0510;
    1::235     3e-49  48%  248 aa  Y922_METPB RecName: Full=UPF0082 protein Mpop_0922;
    1::235     4e-49  43%  248 aa  Y7401_METNO RecName: Full=UPF0082 protein Mnod_7401;
    1::242     4e-49  42%  246 aa  Y371_DESOH RecName: Full=UPF0082 protein Dole_0371;
    1::235     7e-49  43%  248 aa  Y7305_OLICO RecName: Full=UPF0082 protein OCAR_7305;
    1::235     1e-48  43%  248 aa  Y946_METC4 RecName: Full=UPF0082 protein Mchl_0946;
    1::209     1e-48  47%  250 aa  Y1808_RHOCS RecName: Full=UPF0082 protein RC1_1808;
    1::213     2e-48  46%  249 aa  Y1575_AQUAE RecName: Full=UPF0082 protein aq_1575;
    1::235     3e-48  43%  248 aa  Y3553_METRJ RecName: Full=UPF0082 protein Mrad2831_3553;
    1::240     8e-48  45%  246 aa  Y2524_GEOSW RecName: Full=UPF0082 protein GWCH70_2524;
    1::235     4e-47  42%  248 aa  Y345_BEII9 RecName: Full=UPF0082 protein Bind_0345;
    1::236     1e-46  40%  247 aa  Y400_DESAH RecName: Full=UPF0082 protein HRM2_04000;
    1::242     1e-46  40%  249 aa  Y1097_GRABC RecName: Full=UPF0082 protein GbCGDNIH1_1097;
    1::240     2e-46  43%  245 aa  Y709_ANOFW RecName: Full=UPF0082 protein Aflv_0709;
    1::245     2e-46  42%  250 aa  Y1800_NATTJ RecName: Full=UPF0082 protein Nther_1800;
    1::242     2e-46  40%  247 aa  Y2958_DESAA RecName: Full=UPF0082 protein Dalk_2958;
    1::235     2e-46  41%  248 aa  Y2305_METSB RecName: Full=UPF0082 protein Msil_2305;
    1::238     2e-46  42%  252 aa  Y161_HYPNA RecName: Full=UPF0082 protein HNE_0161;
    1::207     3e-46  49%  256 aa  Y3240_RICB8 RecName: Full=UPF0082 protein A1I_03240;
    1::214     6e-46  44%  243 aa  Y677_LACDA RecName: Full=UPF0082 protein Ldb0677;
    1::214     6e-46  44%  243 aa  Y609_LACDB RecName: Full=UPF0082 protein LBUL_0609;
    1::239     7e-46  49%  251 aa  Y3352_CAUCN RecName: Full=UPF0082 protein CCNA_03352;
    1::239     7e-46  49%  251 aa  Y3243_CAUCR RecName: Full=UPF0082 protein CC_3243;
    1::238     7e-46  41%  248 aa  Y2125_ACIBL RecName: Full=UPF0082 protein Acid345_2125;
    1::209     7e-46  43%  249 aa  Y1661_FUSNN RecName: Full=UPF0082 protein FN1661;
    1::210     9e-46  46%  252 aa  Y799_RICFE RecName: Full=UPF0082 protein RF_0799;
    1::207     9e-46  49%  253 aa  Y568_RICBR RecName: Full=UPF0082 protein RBE_0568;
    1::237     9e-46  42%  247 aa  Y1487_TREDE RecName: Full=UPF0082 protein TDE_1487;
    1::240     1e-45  39%  251 aa  Y685_SULSY RecName: Full=UPF0082 protein SYO3AOP1_0685;
    1::239     2e-45  39%  249 aa  Y651_METI4 RecName: Full=UPF0082 protein Minf_0651;
    1::236     3e-45  41%  241 aa  Y2522_RALEJ RecName: Full=UPF0082 protein Reut_A2522;
    1::208     4e-45  43%  248 aa  Y337_SPHAL RecName: Full=UPF0082 protein Sala_0337;
    1::215     4e-45  42%  243 aa  Y1186_LACCB RecName: Full=UPF0082 protein LCABL_11860;
    1::239     4e-45  40%  250 aa  Y1151_ELUMP RecName: Full=UPF0082 protein Emin_1151;
    1::236     4e-45  39%  249 aa  Y1086_RHORT RecName: Full=UPF0082 protein Rru_A1086;
    1::215     4e-45  42%  243 aa  Y1022_LACC3 RecName: Full=UPF0082 protein LSEI_1022;
    1::236     5e-45  41%  241 aa  Y859_CUPTR RecName: Full=UPF0082 protein RALTA_A0859;
    1::240     6e-45  40%  251 aa  Y1868_THEYD RecName: Full=UPF0082 protein THEYE_A1868;
    1::208     8e-45  49%  253 aa  Y681_RICCN RecName: Full=UPF0082 protein RC0681;
    1::238     8e-45  42%  243 aa  Y2215_THIDA RecName: Full=UPF0082 protein Tbd_2215;
    1::239     1e-44  40%  248 aa  Y979_FRATF RecName: Full=UPF0082 protein FTA_0979;
    1::239     1e-44  40%  248 aa  Y929_FRATH RecName: Full=UPF0082 protein FTL_0929;
    1::239     1e-44  40%  248 aa  Y908_FRATO RecName: Full=UPF0082 protein FTH_0908;
    1::240     1e-44  45%  247 aa  Y2524_GEOTN RecName: Full=UPF0082 protein GTNG_2524;
    1::239     1e-44  46%  248 aa  Y137_NITOC RecName: Full=UPF0082 protein Noc_0137;
    1::236     1e-44  42%  241 aa  Y916_RALEH RecName: Full=UPF0082 protein H16_A0916;
    1::243     1e-44  47%  252 aa  Y4175_RICAH RecName: Full=UPF0082 protein A1C_04175;
    1::239     1e-44  40%  248 aa  Y1073_FRATW RecName: Full=UPF0082 protein FTW_1073;
    1::207     2e-44  46%  252 aa  Y442_RICTY RecName: Full=UPF0082 protein RT0442;
    1::214     2e-44  43%  250 aa  Y2908_DESPS RecName: Full=UPF0082 protein DP2908;
    1::239     2e-44  40%  248 aa  Y1028_FRATN RecName: Full=UPF0082 protein FTN_1028;
    1::237     2e-44  40%  242 aa  Y964_CALS8 RecName: Full=UPF0082 protein Csac_0964;
    1::240     2e-44  43%  246 aa  Y943_CLOBA RecName: Full=UPF0082 protein CLH_0943;
    1::239     2e-44  41%  242 aa  Y422_LACS1 RecName: Full=UPF0082 protein LSL_0422;
    1::235     2e-44  41%  243 aa  Y1307_LACSS RecName: Full=UPF0082 protein LSA1307;
    1::242     2e-44  45%  248 aa  Y1220_METCA RecName: Full=UPF0082 protein MCA1220;
    1::240     2e-44  43%  246 aa  Y1008_CLOBB RecName: Full=UPF0082 protein CLL_A1008;
    1::214     3e-44  43%  243 aa  Y904_LACJO RecName: Full=UPF0082 protein LJ_0904;
    1::239     3e-44  39%  248 aa  Y655_FRATT RecName: Full=UPF0082 protein FTT0655;
    1::239     3e-44  39%  248 aa  Y655_FRAT1 RecName: Full=UPF0082 protein FTF0655;
    1::240     3e-44  44%  246 aa  Y2594_GEOKA RecName: Full=UPF0082 protein GK2594;
    1::214     3e-44  43%  243 aa  Y1276_LACGA RecName: Full=UPF0082 protein LGAS_1276;
    1::215     3e-44  44%  245 aa  Y1240_PEDPA RecName: Full=UPF0082 protein PEPE_1240;
    1::138     4e-44  61%  245 aa  Y474_TREPS RecName: Full=UPF0082 protein TPASS_0474;
    1::138     4e-44  61%  245 aa  Y474_TREPA RecName: Full=UPF0082 protein TP_0474;
    1::239     4e-44  39%  248 aa  Y1203_FRATM RecName: Full=UPF0082 protein FTM_1203;
    1::239     7e-44  41%  251 aa  Y780_CAUSK RecName: Full=UPF0082 protein Caul_0780;
    1::237     7e-44  42%  247 aa  Y743_GEOMG RecName: Full=UPF0082 protein Gmet_0743;
    1::239     7e-44  47%  245 aa  Y4222_CLOB8 RecName: Full=UPF0082 protein Cbei_4222;
    1::236     7e-44  41%  242 aa  Y2379_BURVG RecName: Full=UPF0082 protein Bcep1808_2379;
    1::245     7e-44  42%  255 aa  Y1757_HELMI RecName: Full=UPF0082 protein Helmi_17570;
    1::240     9e-44  39%  247 aa  Y902_EUBE2 RecName: Full=UPF0082 protein EUBELI_00902;
    1::236     9e-44  42%  241 aa  Y785_RALME RecName: Full=UPF0082 protein Rmet_0785;
    1::208     1e-43  46%  253 aa  Y717_RICAE RecName: Full=UPF0082 protein RAF_ORF0717;
    1::236     1e-43  41%  247 aa  Y710_MANSM RecName: Full=UPF0082 protein MS0710;
    1::236     2e-43  40%  242 aa  Y733_LACAC RecName: Full=UPF0082 protein LBA0733;
    1::214     2e-43  44%  255 aa  Y2775_CYAP7 RecName: Full=UPF0082 protein PCC7424_2775;
    1::238     2e-43  41%  250 aa  Y079_PERMH RecName: Full=UPF0082 protein PERMA_0079;
    1::235     2e-43  45%  248 aa  Y6579_METS4 RecName: Full=UPF0082 protein M446_6579;
    1::236     2e-43  41%  242 aa  Y2210_BURA4 RecName: Full=UPF0082 protein BamMC406_2210;
    1::236     2e-43  41%  241 aa  Y2190_RALSO RecName: Full=UPF0082 protein RSc2190;
    1::239     2e-43  39%  248 aa  Y1570_FRAP2 RecName: Full=UPF0082 protein Fphi_1565;
    1::242     2e-43  39%  246 aa  Y1449_THEPX RecName: Full=UPF0082 protein Teth514_1449;
    1::213     2e-43  47%  249 aa  Y1378_ORITI RecName: Full=UPF0082 protein OTT_1378;
    1::242     2e-43  39%  246 aa  Y1009_THEP3 RecName: Full=UPF0082 protein Teth39_1009;
    1::236     3e-43  40%  242 aa  Y777_LACH4 RecName: Full=UPF0082 protein lhv_0777;
    1::236     3e-43  41%  247 aa  Y1803_ACTSZ RecName: Full=UPF0082 protein Asuc_1803;
    1::238     3e-43  38%  248 aa  Y2886_DESAD RecName: Full=UPF0082 protein Desal_2886;
    1::237     3e-43  38%  251 aa  Y1344_BIFA0 RecName: Full=UPF0082 protein BLA_1344;
    1::237     4e-43  38%  251 aa  Y726_BIFLO RecName: Full=UPF0082 protein BL0726;
    1::238     4e-43  37%  250 aa  Y538_CHLPD RecName: Full=UPF0082 protein Cpha266_0538;
    1::237     4e-43  38%  251 aa  Y450_BIFLD RecName: Full=UPF0082 protein BLD_0450;
    1::240     4e-43  40%  248 aa  Y2335_PELCD RecName: Full=UPF0082 protein Pcar_2335;
    1::236     4e-43  41%  242 aa  Y2332_BURCM RecName: Full=UPF0082 protein Bamb_2332;
    1::237     4e-43  42%  247 aa  Y2326_GEOSF RecName: Full=UPF0082 protein Geob_2326;
    1::240     4e-43  38%  250 aa  Y060_ACIF5 RecName: Full=UPF0082 protein Lferr_0060;
    1::240     4e-43  38%  250 aa  Y059_ACIF2 RecName: Full=UPF0082 protein AFE_0059;
    1::235     6e-43  41%  246 aa  Y596_HAEDU RecName: Full=UPF0082 protein HD_0596;
    1::235     6e-43  41%  240 aa  Y2722_NITMU RecName: Full=UPF0082 protein Nmul_A2722;
    1::236     7e-43  38%  239 aa  Y618_POLSQ RecName: Full=UPF0082 protein Pnuc_0618;
    1::211     7e-43  46%  253 aa  Y5505_RICPU RecName: Full=UPF0082 protein RPR_05505;
    1::240     1e-42  37%  250 aa  Y496_PROA2 RecName: Full=UPF0082 protein Paes_0496;
    1::239     1e-42  39%  244 aa  Y446_COXB2 RecName: Full=UPF0082 protein CbuG_0446;
    1::239     1e-42  39%  244 aa  Y422_COXBN RecName: Full=UPF0082 protein CBUD_0422;
    1::239     1e-42  45%  251 aa  Y421_DEHSB RecName: Full=UPF0082 protein DehaBAV1_0421;
    1::239     1e-42  45%  251 aa  Y400_DEHSC RecName: Full=UPF0082 protein cbdbA400;
    1::214     1e-42  44%  255 aa  Y2028_CYAP8 RecName: Full=UPF0082 protein PCC8801_2028;
    1::239     1e-42  39%  244 aa  Y1793_COXB1 RecName: Full=UPF0082 protein CbuK_1793;
    1::239     1e-42  39%  244 aa  Y1752_COXBR RecName: Full=UPF0082 protein COXBURSA331_A1752;
    1::239     1e-42  39%  244 aa  Y1566_COXBU RecName: Full=UPF0082 protein CBU_1566;
    1::236     1e-42  40%  243 aa  Y025_BORBZ RecName: Full=UPF0082 protein BbuZS7_0025;
    1::236     1e-42  40%  243 aa  Y025_BORBU RecName: Full=UPF0082 protein BB_0025;
    1::236     1e-42  41%  242 aa  Y2348_BURCJ RecName: Full=UPF0082 protein BceJ2315_23480;
    1::236     1e-42  41%  242 aa  Y2317_BURCC RecName: Full=UPF0082 protein Bcenmc03_2317;
    1::236     1e-42  41%  242 aa  Y2294_BURCH RecName: Full=UPF0082 protein Bcen2424_2294;
    1::236     1e-42  41%  242 aa  Y1682_BURCA RecName: Full=UPF0082 protein Bcen_1682;
    1::214     2e-42  42%  249 aa  Y996_SYNFM RecName: Full=UPF0082 protein Sfum_0996;
    1::237     2e-42  42%  247 aa  Y933_GEOSM RecName: Full=UPF0082 protein GM21_0933;
    1::240     2e-42  37%  246 aa  Y2215_CLOTE RecName: Full=UPF0082 protein CTC_02215;
    1::204     2e-42  42%  248 aa  Y181_CLOCE RecName: Full=UPF0082 protein Ccel_0181;
    1::205     2e-42  44%  242 aa  Y663_ENTFA RecName: Full=UPF0082 protein EF_0663;
    1::236     2e-42  41%  242 aa  Y5621_BURS3 RecName: Full=UPF0082 protein Bcep18194_A5621;
    1::239     2e-42  41%  245 aa  Y2210_CLOP1 RecName: Full=UPF0082 protein CPF_2210;
    1::239     2e-42  41%  245 aa  Y1954_CLOPE RecName: Full=UPF0082 protein CPE1954;AltName:
    1::239     2e-42  41%  245 aa  Y1922_CLOPS RecName: Full=UPF0082 protein CPR_1922;
    1::204     3e-42  48%  246 aa  YU82_CLOHI RecName: Full=UPF0082 protein ORF2U;
    1::236     3e-42  41%  241 aa  Y544_JANMA RecName: Full=UPF0082 protein mma_0544;
    1::237     3e-42  42%  247 aa  Y3313_GEOBB RecName: Full=UPF0082 protein Gbem_3313;
    1::236     3e-42  39%  247 aa  Y1817_PECCP RecName: Full=UPF0082 protein PC1_1817;
    1::238     3e-42  37%  250 aa  Y1432_PROVI RecName: Full=UPF0082 protein Cvib_1432;
    1::241     3e-42  43%  253 aa  Y1235_HALOH RecName: Full=UPF0082 protein Hore_12350;
    1::236     3e-42  39%  243 aa  Y025_BORGA RecName: Full=UPF0082 protein BG0025;
    1::236     3e-42  40%  243 aa  Y024_BORAP RecName: Full=UPF0082 protein BAPKO_0024;
    1::237     4e-42  39%  243 aa  Y816_ANATD RecName: Full=UPF0082 protein Athe_0816;
    1::236     4e-42  39%  247 aa  Y2494_ERWCT RecName: Full=UPF0082 protein ECA2494;
    1::241     5e-42  39%  254 aa  Y869_HAMD5 RecName: Full=UPF0082 protein HDEF_0869;
    1::235     5e-42  39%  241 aa  Y281_NITEC RecName: Full=UPF0082 protein Neut_0281;
    1::239     5e-42  43%  249 aa  Y1505_DICT6 RecName: Full=UPF0082 protein DICTH_1505;
    1::237     5e-42  41%  247 aa  Y1416_GEOUR RecName: Full=UPF0082 protein Gura_1416;
    1::218     6e-42  43%  256 aa  Y894_CYAA5 RecName: Full=UPF0082 protein cce_0894;
    1::207     6e-42  45%  252 aa  Y455_RICPR RecName: Full=UPF0082 protein RP455;
    1::235     8e-42  40%  246 aa  Y980_PASMU RecName: Full=UPF0082 protein PM0980;
    1::211     8e-42  44%  253 aa  Y4400_RICRS RecName: Full=UPF0082 protein A1G_04400;
    1::213     8e-42  46%  249 aa  Y251_ORITB RecName: Full=UPF0082 protein OTBS_0251;
    1::188     8e-42  48%  241 aa  Y2388_RALPJ RecName: Full=UPF0082 protein Rpic_2388;
    1::237     1e-41  42%  241 aa  Y1535_LISMO RecName: Full=UPF0082 protein lmo1535;
    1::236     1e-41  39%  243 aa  Y025_BORHD RecName: Full=UPF0082 protein BH0025;
    1::235     1e-41  41%  246 aa  Y508_HAES1 RecName: Full=UPF0082 protein HS_0508;
    1::240     1e-41  43%  249 aa  Y3062_XANP2 RecName: Full=UPF0082 protein Xaut_3062;
    1::235     1e-41  41%  246 aa  Y1763_HAES2 RecName: Full=UPF0082 protein HSM_1763;
    1::237     1e-41  40%  247 aa  Y056_LEPBP RecName: Full=UPF0082 protein LEPBI_I0056;
    1::237     1e-41  40%  247 aa  Y056_LEPBA RecName: Full=UPF0082 protein LBF_0056;
    1::210     2e-41  40%  249 aa  Y501_HYDS0 RecName: Full=UPF0082 protein HY04AAS1_0501;
    1::236     2e-41  41%  248 aa  Y1214_PSEPK RecName: Full=UPF0082 protein PP_1214;
    1::239     4e-41  39%  243 aa  Y3099_BORPD RecName: Full=UPF0082 protein Bpet3099;
    1::244     4e-41  39%  244 aa  Y1910_MYCMO RecName: Full=UPF0082 protein MMOB1910;
    1::236     4e-41  38%  248 aa  Y1596_EDWI9 RecName: Full=UPF0082 protein NT01EI_1596;
    1::245     4e-41  38%  252 aa  Y1228_ANAVT RecName: Full=UPF0082 protein Ava_1228;
    1::241     5e-41  39%  252 aa  Y5651_NOSP7 RecName: Full=UPF0082 protein Npun_R5651;
    1::237     5e-41  42%  241 aa  Y1554_LISMF RecName: Full=UPF0082 protein LMOf2365_1554;
    1::241     5e-41  43%  249 aa  Y1088_IDILO RecName: Full=UPF0082 protein IL1088;
    1::236     7e-41  42%  241 aa  Y210_NITEU RecName: Full=UPF0082 protein NE0210;
    1::242     7e-41  36%  251 aa  Y1663_CORGL RecName: Full=UPF0082 protein Cgl1663/cg1872;
    1::235     7e-41  40%  246 aa  Y1210_ACTP7 RecName: Full=UPF0082 protein APP7_1210;
    1::235     7e-41  40%  246 aa  Y1151_ACTP2 RecName: Full=UPF0082 protein APL_1151;
    1::212     9e-41  42%  251 aa  Y444_DEHE1 RecName: Full=UPF0082 protein DET0444;
    1::242     9e-41  39%  246 aa  Y2620_WOLWR RecName: Full=UPF0082 protein WRi_002620;
    1::214     9e-41  40%  242 aa  Y2507_CLOPH RecName: Full=UPF0082 protein Cphy_2507;
    1::235     9e-41  39%  246 aa  Y1171_ACTPJ RecName: Full=UPF0082 protein APJL_1171;
    1::237     9e-41  37%  251 aa  Y1155_BIFLI RecName: Full=UPF0082 protein Blon_1155;
    1::240     1e-40  37%  241 aa  Y624_MYCPU RecName: Full=UPF0082 protein MYPU_6240;
    1::236     1e-40  38%  247 aa  Y2779_SERP5 RecName: Full=UPF0082 protein Spro_2779;
    1::242     1e-40  36%  251 aa  Y1708_CORGB RecName: Full=UPF0082 protein cgR_1708;
    1::236     1e-40  39%  251 aa  Y1113_PROMH RecName: Full=UPF0082 protein PMI1113;
    1::235     2e-40  40%  246 aa  Y943_HAEPS RecName: Full=UPF0082 protein HAPS_0943;
    1::212     2e-40  39%  241 aa  Y893_FINM2 RecName: Full=UPF0082 protein FMG_0893;
    1::235     2e-40  40%  248 aa  Y4926_HAHCH RecName: Full=UPF0082 protein HCH_04926;
    1::245     2e-40  38%  252 aa  Y4276_ANASP RecName: Full=UPF0082 protein all4276;
    1::235     2e-40  38%  248 aa  Y3525_NITHX RecName: Full=UPF0082 protein Nham_3525;
    1::238     2e-40  37%  251 aa  Y2138_FRAAA RecName: Full=UPF0082 protein FRAAL2138;
    1::237     2e-40  38%  248 aa  Y905_COPPD RecName: Full=UPF0082 protein COPRO5265_0905;
    1::244     2e-40  37%  251 aa  Y1368_FRASC RecName: Full=UPF0082 protein Francci3_1368;
    1::242     2e-40  37%  243 aa  Y1135_THETN RecName: Full=UPF0082 protein TTE1135;
    1::242     3e-40  39%  246 aa  Y484_WOLPM RecName: Full=UPF0082 protein WD_0484;
    1::240     3e-40  38%  246 aa  Y3338_CLOB6 RecName: Full=UPF0082 protein CLJ_B3338;
    1::240     3e-40  38%  246 aa  Y3132_CLOBL RecName: Full=UPF0082 protein CLI_3132;
    1::240     3e-40  38%  246 aa  Y2466_CLOBM RecName: Full=UPF0082 protein CLK_2466;
    1::239     3e-40  36%  251 aa  Y1421_CORA7 RecName: Full=UPF0082 protein cauri_1421;
    1::235     3e-40  37%  247 aa  YEEN_SALAR RecName: Full=UPF0082 protein yeeN;
    1::237     3e-40  38%  248 aa  Y5948_SOLUE RecName: Full=UPF0082 protein Acid_5948;
    1::239     3e-40  43%  246 aa  Y5500_RHOBA RecName: Full=UPF0082 protein RB5500;
    1::240     3e-40  38%  246 aa  Y3478_CLOBJ RecName: Full=UPF0082 protein CLM_3478;
    1::239     3e-40  39%  243 aa  Y2422_BORPA RecName: Full=UPF0082 protein BPP2422;
    1::239     3e-40  39%  243 aa  Y2308_BORPE RecName: Full=UPF0082 protein BP2308;
    1::239     3e-40  38%  243 aa  Y2207_BORA1 RecName: Full=UPF0082 protein BAV2207;
    1::239     3e-40  39%  243 aa  Y1871_BORBR RecName: Full=UPF0082 protein BB1871;
    1::239     3e-40  39%  250 aa  Y1318_RUBXD RecName: Full=UPF0082 protein Rxyl_1318;
    1::235     5e-40  37%  246 aa  YEBC_ECOUT RecName: Full=UPF0082 protein yebC;
    1::235     5e-40  37%  246 aa  YEBC_ECOL6 RecName: Full=UPF0082 protein yebC;
    1::235     5e-40  37%  246 aa  YEBC_ECOL5 RecName: Full=UPF0082 protein yebC;
    1::235     5e-40  37%  246 aa  YEBC_ECO57 RecName: Full=UPF0082 protein yebC;
    1::214     5e-40  41%  249 aa  Y543_LEPBJ RecName: Full=UPF0082 protein LBJ_0543;
    1::238     5e-40  36%  250 aa  Y542_CHLPB RecName: Full=UPF0082 protein Cphamn1_0542;
    1::243     5e-40  37%  251 aa  Y525_CHLP8 RecName: Full=UPF0082 protein Cpar_0525;
    1::244     5e-40  37%  251 aa  Y5147_FRASN RecName: Full=UPF0082 protein Franean1_5147;
    1::240     5e-40  37%  246 aa  Y3102_CLOB1 RecName: Full=UPF0082 protein CLB_3102;
    1::240     5e-40  37%  246 aa  Y3073_CLOBH RecName: Full=UPF0082 protein CBO3073/CLC_2975;
    1::214     5e-40  41%  249 aa  Y2537_LEPBL RecName: Full=UPF0082 protein LBL_2537;
    1::235     6e-40  36%  246 aa  YEBC_SHISS RecName: Full=UPF0082 protein yebC;
    1::235     6e-40  36%  246 aa  YEBC_SHIFL RecName: Full=UPF0082 protein yebC;
    1::235     6e-40  36%  246 aa  YEBC_SHIBS RecName: Full=UPF0082 protein yebC;
    1::235     6e-40  36%  246 aa  YEBC_SALCH RecName: Full=UPF0082 protein yebC;
    1::235     6e-40  36%  246 aa  YEBC_ECOLI RecName: Full=UPF0082 protein yebC;
    1::138     6e-40  53%  250 aa  Y479_MAGSM RecName: Full=UPF0082 protein Mmc1_0479;
    1::235     6e-40  37%  246 aa  Y1378_ENTS8 RecName: Full=UPF0082 protein ESA_01378;
    1::176     8e-40  46%  242 aa  Y561_HERAR RecName: Full=UPF0082 protein HEAR0561;
    1::236     8e-40  39%  241 aa  Y2347_LARHH RecName: Full=UPF0082 protein LHK_02347;
    1::168     8e-40  47%  249 aa  Y2237_THISH RecName: Full=UPF0082 protein Tgr7_2237;
    1::236     8e-40  40%  247 aa  Y2109_PHOLL RecName: Full=UPF0082 protein plu2109;
    1::188     8e-40  44%  243 aa  Y1967_POLSJ RecName: Full=UPF0082 protein Bpro_1967;
    1::235     1e-39  36%  246 aa  YEBC_SHIDS RecName: Full=UPF0082 protein yebC;
    1::235     1e-39  36%  246 aa  YEBC_SALTY RecName: Full=UPF0082 protein yebC;
    1::235     1e-39  36%  246 aa  YEBC_SALTI RecName: Full=UPF0082 protein yebC;
    1::235     1e-39  36%  246 aa  YEBC_SALPA RecName: Full=UPF0082 protein yebC;
    1::235     1e-39  37%  246 aa  Y1097_CITK8 RecName: Full=UPF0082 protein CKO_01097;
    1::236     1e-39  38%  247 aa  Y2424_YERPG RecName: Full=UPF0082 protein YpAngola_A2424;
    1::236     1e-39  38%  247 aa  Y2395_YERE8 RecName: Full=UPF0082 protein YE2395;
    1::236     1e-39  38%  247 aa  Y2097_YERPB RecName: Full=UPF0082 protein YPTS_2097;
    1::236     1e-39  38%  247 aa  Y2055_YERPE RecName: Full=UPF0082 protein YPO2055/y2255/YP_1898;
    1::236     1e-39  38%  247 aa  Y2038_YERPS RecName: Full=UPF0082 protein YPTB2038;
    1::236     1e-39  38%  247 aa  Y2033_YERP3 RecName: Full=UPF0082 protein YpsIP31758_2033;
    1::236     1e-39  38%  247 aa  Y1532_YERPN RecName: Full=UPF0082 protein YPN_1532;
    1::239     1e-39  37%  244 aa  Y1525_CARHZ RecName: Full=UPF0082 protein CHY_1525;
    1::236     1e-39  38%  247 aa  Y1437_YERPA RecName: Full=UPF0082 protein YPA_1437;
    1::236     1e-39  38%  247 aa  Y1067_YERPP RecName: Full=UPF0082 protein YPDSF_1067;
    1::236     2e-39  38%  247 aa  Y2146_YERPY RecName: Full=UPF0082 protein YPK_2146;
    1::239     2e-39  34%  250 aa  Y6832_STRAW RecName: Full=UPF0082 protein SAV_6832;
    1::218     2e-39  40%  245 aa  Y480_ANAPZ RecName: Full=UPF0082 protein APH_0480;
    1::235     2e-39  36%  246 aa  Y2343_KLEP7 RecName: Full=UPF0082 protein KPN78578_23430;
    1::240     2e-39  36%  252 aa  Y1989_BEUC1 RecName: Full=UPF0082 protein Bcav_1989;
    1::235     2e-39  36%  246 aa  Y1906_KLEP3 RecName: Full=UPF0082 protein KPK_1906;
    1::236     2e-39  38%  247 aa  Y1113_PHOPR RecName: Full=UPF0082 protein PBPRA1113;
    1::213     3e-39  48%  240 aa  Y2909_BACLD RecName: Full=UPF0082 protein BLi02909/BL01150;
    1::242     4e-39  35%  251 aa  Y2034_ARTCA RecName: Full=UPF0082 protein Achl_2034;
    1::239     5e-39  38%  244 aa  Y624_AMOA5 RecName: Full=UPF0082 protein Aasi_0624;
    1::236     5e-39  40%  241 aa  Y2072_AZOSE RecName: Full=UPF0082 protein AZOSEA20720;
    1::209     5e-39  37%  248 aa  Y1471_OPITP RecName: Full=UPF0082 protein Oter_1471;
    1::239     5e-39  35%  251 aa  Y1057_CORJK RecName: Full=UPF0082 protein jk1057;
    1::211     7e-39  41%  240 aa  Y768_OENOB RecName: Full=UPF0082 protein OEOE_0768;
    1::219     7e-39  40%  250 aa  Y694_ANAMM RecName: Full=UPF0082 protein AM694;
    1::236     7e-39  35%  245 aa  Y1328_PARUW RecName: Full=UPF0082 protein pc1328;
    1::238     7e-39  37%  247 aa  Y1249_LEGPL RecName: Full=UPF0082 protein lpl1249;
    1::213     9e-39  42%  254 aa  Y4347_CYAP4 RecName: Full=UPF0082 protein Cyan7425_4347;
    1::241     9e-39  42%  249 aa  Y1479_PSYCK RecName: Full=UPF0082 protein Pcryo_1479;
    1::238     1e-38  38%  247 aa  Y1286_LEGPH RecName: Full=UPF0082 protein lpg1286;
    1::213     1e-38  40%  238 aa  Y838_CHLFF RecName: Full=UPF0082 protein CF0838;
    1::238     1e-38  37%  247 aa  Y711_LEGPC RecName: Full=UPF0082 protein LPC_0711;
    1::236     1e-38  41%  241 aa  Y574_AZOSB RecName: Full=UPF0082 protein azo0574;
    1::241     1e-38  35%  242 aa  Y472_MYCH2 RecName: Full=UPF0082 protein mhp472;
    1::238     1e-38  37%  247 aa  Y1249_LEGPA RecName: Full=UPF0082 protein lpp1249;
    1::241     2e-38  42%  249 aa  Y938_PSYA2 RecName: Full=UPF0082 protein Psyc_0938;
    1::239     2e-38  34%  250 aa  Y6014_STRGG RecName: Full=UPF0082 protein SGR_6014;
    1::236     2e-38  40%  248 aa  Y4410_PSEPF RecName: Full=UPF0082 protein Pfl01_4410;
    1::205     2e-38  41%  241 aa  Y2355_METFK RecName: Full=UPF0082 protein Mfla_2355;
    1::240     2e-38  42%  242 aa  Y2253_LACPL RecName: Full=UPF0082 protein lp_2253;
    1::138     2e-38  53%  242 aa  Y1902_NEIMA RecName: Full=UPF0082 protein NMA1902;
    1::138     2e-38  53%  242 aa  Y1648_NEIMB RecName: Full=UPF0082 protein NMB1648;
    1::138     2e-38  53%  242 aa  Y1563_NEIMF RecName: Full=UPF0082 protein NMC1563;
    1::138     2e-38  53%  242 aa  Y1508_NEIG2 RecName: Full=UPF0082 protein NGK_1508;
    1::236     2e-38  37%  247 aa  Y1487_ERWT9 RecName: Full=UPF0082 protein ETA_14870;
    1::138     2e-38  53%  242 aa  Y1291_NEIG1 RecName: Full=UPF0082 protein NGO1291;
    1::240     2e-38  35%  246 aa  Y1819_CLONN RecName: Full=UPF0082 protein NT01CX_1819;
    1::208     3e-38  40%  251 aa  Y709_AKKM8 RecName: Full=UPF0082 protein Amuc_0709;
    1::215     3e-38  43%  247 aa  Y541_LACF3 RecName: Full=UPF0082 protein LAF_0541;
    1::172     3e-38  46%  246 aa  Y521_ACIC5 RecName: Full=UPF0082 protein ACP_0521;
    4::236     3e-38  37%  239 aa  Y2866_ENTFA RecName: Full=UPF0082 protein EF_2866;
    1::235     3e-38  36%  246 aa  Y2432_ENT38 RecName: Full=UPF0082 protein Ent638_2432;
    1::237     3e-38  36%  238 aa  Y166_CHLAB RecName: Full=UPF0082 protein CAB166;
    1::236     3e-38  37%  247 aa  Y1259_SODGM RecName: Full=UPF0082 protein SG1259;
    1::241     4e-38  35%  242 aa  Y474_MYCH7 RecName: Full=UPF0082 protein MHP7448_0474;
    1::235     4e-38  42%  246 aa  Y4390_HAEIG RecName: Full=UPF0082 protein CGSHiGG_04390;
    1::235     4e-38  42%  246 aa  Y433_HAEI8 RecName: Full=UPF0082 protein NTHI0433;
    1::235     4e-38  42%  246 aa  Y315_HAEIN RecName: Full=UPF0082 protein HI0315;
    1::235     4e-38  42%  246 aa  Y1480_HAEIE RecName: Full=UPF0082 protein CGSHiEE_01480;
    1::139     4e-38  55%  244 aa  Y025_BORT9 RecName: Full=UPF0082 protein BT0025;
    1::239     6e-38  40%  250 aa  Y739_SYNAS RecName: Full=UPF0082 protein SYNAS_07390;
    1::236     6e-38  37%  253 aa  Y454_THEP1 RecName: Full=UPF0082 protein Tpet_0454;
    1::238     6e-38  37%  242 aa  Y2075_CLOTH RecName: Full=UPF0082 protein Cthe_2075;
    1::242     6e-38  35%  252 aa  Y1776_COREF RecName: Full=UPF0082 protein CE1776;
    1::241     7e-38  35%  242 aa  Y471_MYCHJ RecName: Full=UPF0082 protein MHJ_0471;
    1::238     7e-38  37%  244 aa  Y1179_DICNV RecName: Full=UPF0082 protein DNO_1179;
    1::235     9e-38  36%  244 aa  Y3085_DESMR RecName: Full=UPF0082 protein DMR_30850;
    1::237     9e-38  35%  251 aa  Y2002_RENSM RecName: Full=UPF0082 protein RSal33209_2002;
    1::241     9e-38  36%  250 aa  Y1640_SYNP2 RecName: Full=UPF0082 protein SYNPCC7002_A1640;
    1::237     9e-38  43%  249 aa  Y1350_SYNJB RecName: Full=UPF0082 protein CYB_1350;
    1::236     1e-37  39%  248 aa  Y4766_PSEF5 RecName: Full=UPF0082 protein PFL_4766;
    1::138     1e-37  53%  248 aa  Y4544_PSEA7 RecName: Full=UPF0082 protein PSPA7_4544;
    1::237     1e-37  40%  241 aa  Y1570_LISIN RecName: Full=UPF0082 protein lin1570;
    1::236     1e-37  40%  243 aa  Y030_BORDL RecName: Full=UPF0082 protein BDU_30;
    1::236     1e-37  40%  243 aa  Y029_BORRA RecName: Full=UPF0082 protein BRE_29;
    1::215     2e-37  41%  240 aa  YRBC_BACSU RecName: Full=UPF0082 protein yrbC;
    1::219     2e-37  39%  249 aa  Y377_EHRRW RecName: Full=UPF0082 protein Erum3660/ERWE_CDS_03770;
    1::219     2e-37  39%  249 aa  Y372_EHRRG RecName: Full=UPF0082 protein ERGA_CDS_03720;
    1::210     2e-37  40%  251 aa  Y2507_GLOVI RecName: Full=UPF0082 protein glr2507;
    1::237     2e-37  36%  251 aa  Y2300_ARTAT RecName: Full=UPF0082 protein AAur_2300;
    1::237     2e-37  40%  249 aa  Y2259_SYNJA RecName: Full=UPF0082 protein CYA_2259;
    1::138     2e-37  53%  246 aa  Y1522_AERHH RecName: Full=UPF0082 protein AHA_1522;
    1::239     2e-37  33%  250 aa  Y1521_STRCO RecName: Full=UPF0082 protein SCO1521;
    1::236     2e-37  38%  242 aa  Y1301_BURPP RecName: Full=UPF0082 protein Bphyt_1301;
    1::236     2e-37  37%  251 aa  Y807_PETMO RecName: Full=UPF0082 protein Pmob_0807;
    1::240     2e-37  37%  246 aa  Y2295_CLOAB RecName: Full=UPF0082 protein CA_C2295;
    1::138     3e-37  53%  248 aa  Y964_PSEAE RecName: Full=UPF0082 protein PA0964;
    1::221     3e-37  40%  248 aa  Y704_EHRCR RecName: Full=UPF0082 protein ECH_0704;
    1::138     3e-37  53%  248 aa  Y5181_PSEAB RecName: Full=UPF0082 protein PA14_51810;
    1::238     3e-37  35%  250 aa  Y475_CHLL2 RecName: Full=UPF0082 protein Clim_0475;
    1::138     3e-37  53%  248 aa  Y4350_PSEA8 RecName: Full=UPF0082 protein PLES_43501;
    4::239     3e-37  34%  239 aa  Y385_LISMF RecName: Full=UPF0082 protein LMOf2365_0385;
    1::213     3e-37  40%  238 aa  Y169_CHLCV RecName: Full=UPF0082 protein CCA_00169;
    1::243     3e-37  35%  247 aa  Y1533_BRAHW RecName: Full=UPF0082 protein BHWA1_01533;
    1::242     3e-37  36%  248 aa  Y1013_PSYWF RecName: Full=UPF0082 protein PsycPRwf_1013;
    1::237     4e-37  39%  247 aa  Y1245_GEOLS RecName: Full=UPF0082 protein Glov_1245;
    1::238     5e-37  35%  255 aa  Y715_CLAMS RecName: Full=UPF0082 protein CMS0715;
    1::243     5e-37  35%  250 aa  Y657_PELPB RecName: Full=UPF0082 protein Ppha_0657;
    1::242     5e-37  35%  251 aa  Y2304_ARTS2 RecName: Full=UPF0082 protein Arth_2304;
    1::236     5e-37  37%  242 aa  Y1185_BURXL RecName: Full=UPF0082 protein Bxeno_A1185;
    1::238     6e-37  37%  245 aa  Y536_DESDA RecName: Full=UPF0082 protein Ddes_0536;
    4::236     6e-37  36%  239 aa  Y3259_BACHD RecName: Full=UPF0082 protein BH3259;
    1::252     6e-37  35%  259 aa  Y2383_NOCSJ RecName: Full=UPF0082 protein Noca_2383;
    6::235     8e-37  38%  239 aa  Y795_CLOD6 RecName: Full=UPF0082 protein CD0795;
    1::138     8e-37  55%  249 aa  Y720_LEPIN RecName: Full=UPF0082 protein LA_0720;
    1::221     8e-37  40%  248 aa  Y351_EHRCJ RecName: Full=UPF0082 protein Ecaj_0351;
    1::138     8e-37  55%  249 aa  Y2886_LEPIC RecName: Full=UPF0082 protein LIC_12886;
    1::237     8e-37  35%  248 aa  Y2325_DESDG RecName: Full=UPF0082 protein Dde_2325;
    1::242     8e-37  37%  250 aa  Y175_THEEB RecName: Full=UPF0082 protein tll0175;
    1::242     1e-36  34%  250 aa  Y6870_RHOOB RecName: Full=UPF0082 protein ROP_68700;
    1::235     1e-36  38%  244 aa  Y2548_DEIRA RecName: Full=UPF0082 protein DR_2548;
    1::139     1e-36  54%  252 aa  Y2520_RICCK RecName: Full=UPF0082 protein A1E_02520;
    1::138     1e-36  52%  249 aa  Y1845_CHRSD RecName: Full=UPF0082 protein Csal_1845;
    1::238     1e-36  35%  255 aa  Y1817_CLAM3 RecName: Full=UPF0082 protein CMM_1817;
    1::138     1e-36  53%  246 aa  Y1214_WOLPP RecName: Full=UPF0082 protein WP1214;
    1::243     1e-36  35%  251 aa  Y462_UNCTG RecName: Full=UPF0082 protein TGRD_462;
    1::138     1e-36  52%  241 aa  Y3123_CHRVO RecName: Full=UPF0082 protein CV_3123;
    1::243     1e-36  35%  243 aa  Y2038_OCEIH RecName: Full=UPF0082 protein OB2038;
    1::243     1e-36  35%  250 aa  Y165_CHLCH RecName: Full=UPF0082 protein Cag_0165;
    1::240     2e-36  37%  247 aa  Y750_ALCBS RecName: Full=UPF0082 protein ABO_0750;
    1::239     2e-36  33%  249 aa  Y1779_SALAI RecName: Full=UPF0082 protein Sare_1779;
    1::242     2e-36  33%  250 aa  Y6891_RHOSR RecName: Full=UPF0082 protein RHA1_ro06891;
    4::239     2e-36  37%  239 aa  Y388_LISIN RecName: Full=UPF0082 protein lin0388;
    4::239     2e-36  37%  239 aa  Y369_LISMO RecName: Full=UPF0082 protein lmo0369;
    1::243     2e-36  34%  251 aa  Y2940_MYCS2 RecName: Full=UPF0082 protein MSMEG_2940;
    1::242     3e-36  33%  251 aa  Y2888_MYCA9 RecName: Full=UPF0082 protein MAB_2888c;
    1::236     3e-36  37%  242 aa  Y2280_BURM1 RecName: Full=UPF0082 protein Bmul_0984/BMULJ_02280;
    1::239     4e-36  33%  250 aa  Y2018_SACEN RecName: Full=UPF0082 protein SACE_2018;
    1::251     5e-36  35%  264 aa  Y1157_PROAC RecName: Full=UPF0082 protein PPA1157;
    1::242     7e-36  42%  247 aa  Y635_GEMAT RecName: Full=UPF0082 protein GAU_0635;
    1::138     7e-36  52%  248 aa  Y2432_SHEON RecName: Full=UPF0082 protein SO_2432;
   11::235     7e-36  41%  240 aa  Y1778_ALKOO RecName: Full=UPF0082 protein Clos_1778;
    1::240     7e-36  41%  248 aa  Y1132_THERP RecName: Full=UPF0082 protein trd_1132;
    1::237     7e-36  37%  247 aa  Y1074_GEOSL RecName: Full=UPF0082 protein GSU1074;
    4::236     9e-36  36%  239 aa  Y754_BACLD RecName: Full=UPF0082 protein BLi00754/BL02339;
    1::138     9e-36  50%  242 aa  Y1961_EUBR3 RecName: Full=UPF0082 protein EUBREC_1961;
    1::236     1e-35  37%  242 aa  Y3092_BURM9 RecName: Full=UPF0082 protein BMA10229_A0792;
    1::236     1e-35  37%  242 aa  Y2875_BURMS RecName: Full=UPF0082 protein BMASAVP1_A1075;
    1::236     1e-35  37%  242 aa  Y2858_BURM7 RecName: Full=UPF0082 protein BMA10247_0358;
    1::236     1e-35  37%  242 aa  Y1884_BURMA RecName: Full=UPF0082 protein BMA1884;
    1::236     1e-35  37%  242 aa  Y1385_BURP1 RecName: Full=UPF0082 protein BURPS1710b_1385;
    1::236     1e-35  37%  242 aa  Y1240_BURP0 RecName: Full=UPF0082 protein BURPS1106A_1240;
    1::236     1e-35  37%  242 aa  Y1231_BURP6 RecName: Full=UPF0082 protein BURPS668_1231;
    1::236     1e-35  37%  242 aa  Y1165_BURPS RecName: Full=UPF0082 protein BPSL1165;
    1::238     2e-35  35%  238 aa  Y573_CHLPN RecName: Full=UPF0082 protein
    1::239     2e-35  34%  251 aa  Y3702_NOCFA RecName: Full=UPF0082 protein NFA_37020;
    1::242     2e-35  34%  250 aa  Y2922_RHOE4 RecName: Full=UPF0082 protein RER_29220;
    1::138     2e-35  50%  247 aa  Y2714_TOLAT RecName: Full=UPF0082 protein Tola_2714;
    1::138     2e-35  50%  250 aa  Y1643_PELLD RecName: Full=UPF0082 protein Plut_1643;
    1::242     2e-35  33%  250 aa  Y1378_CORDI RecName: Full=UPF0082 protein DIP1378;
    1::240     2e-35  35%  246 aa  Y1467_CLOBK RecName: Full=UPF0082 protein CLD_1467;
    1::242     2e-35  33%  250 aa  Y1032_CORK4 RecName: Full=UPF0082 protein ckrop_1032;
    2::139     3e-35  52%  253 aa  Y989_SYNY3 RecName: Full=UPF0082 protein slr0989;
    1::237     3e-35  34%  249 aa  Y2096_THEFY RecName: Full=UPF0082 protein Tfu_2096;
    1::189     3e-35  38%  249 aa  Y1792_SALTO RecName: Full=UPF0082 protein Strop_1792;
    1::243     3e-35  32%  250 aa  Y1786_CHLT3 RecName: Full=UPF0082 protein Ctha_1786;
    1::237     3e-35  34%  252 aa  Y985_THEM4 RecName: Full=UPF0082 protein Tmel_0985;
    1::239     3e-35  33%  251 aa  Y2635_MYCBO RecName: Full=UPF0082 protein Mb2635c;
    1::239     3e-35  33%  251 aa  Y2631_MYCTA RecName: Full=UPF0082 protein MRA_2631;
    1::239     3e-35  33%  251 aa  Y2628_MYCBP RecName: Full=UPF0082 protein BCG_2628c;
    1::239     3e-35  33%  251 aa  Y2622_MYCBT RecName: Full=UPF0082 protein JTY_2622;
    1::239     3e-35  33%  251 aa  Y2603_MYCTU RecName: Full=UPF0082 protein Rv2603c/MT2678;
    1::239     3e-35  39%  249 aa  Y1615_DICTD RecName: Full=UPF0082 protein Dtur_1615;
    1::242     3e-35  34%  248 aa  Y1346_ACIC1 RecName: Full=UPF0082 protein Acel_1346;
    1::243     4e-35  37%  251 aa  Y2570_MYCVP RecName: Full=UPF0082 protein Mvan_2570;
    1::137     4e-35  49%  245 aa  Y1199_LACBA RecName: Full=UPF0082 protein LVIS_1199;
    4::236     6e-35  34%  239 aa  Y743_BACP2 RecName: Full=UPF0082 protein BPUM_0743;
    1::236     6e-35  34%  237 aa  Y560_NITSB RecName: Full=UPF0082 protein NIS_0560;
    1::243     6e-35  34%  243 aa  Y1024_PELTS RecName: Full=UPF0082 protein PTH_1024;
    1::236     6e-35  36%  242 aa  Y1015_BURTA RecName: Full=UPF0082 protein BTH_I1015;
    1::245     7e-35  33%  253 aa  Y3057_KINRD RecName: Full=UPF0082 protein Krad_3057;
    1::245     7e-35  34%  245 aa  Y271_MYCA5 RecName: Full=UPF0082 protein MARTH_orf271;
    1::239     7e-35  36%  252 aa  Y1704_MOOTA RecName: Full=UPF0082 protein Moth_1704;
    4::238     1e-34  33%  238 aa  Y2054_STAS1 RecName: Full=UPF0082 protein SSP2054;
    1::138     1e-34  52%  249 aa  Y670_WOLTR RecName: Full=UPF0082 protein Wbm0670;
    1::138     1e-34  50%  246 aa  Y2843_AERS4 RecName: Full=UPF0082 protein ASA_2843;
    4::236     1e-34  33%  238 aa  Y1956_BACSK RecName: Full=UPF0082 protein ABC1956;
    1::238     1e-34  35%  242 aa  Y1658_DESRM RecName: Full=UPF0082 protein Dred_1658;
    1::237     2e-34  33%  250 aa  Y3481_MYCA1 RecName: Full=UPF0082 protein MAV_3481;
    1::245     2e-34  35%  252 aa  Y3629_DESHD RecName: Full=UPF0082 protein Dhaf_3629;
    1::245     2e-34  35%  252 aa  Y2470_DESHY RecName: Full=UPF0082 protein DSY2470;
    4::238     2e-34  32%  238 aa  Y2225_STAHJ RecName: Full=UPF0082 protein SH2225;
    1::137     2e-34  54%  247 aa  Y1423_PROMM RecName: Full=UPF0082 protein PMT_1423;
    6::237     3e-34  38%  244 aa  Y940_XYLF2 RecName: Full=UPF0082 protein XfasM23_0940;
    6::237     3e-34  38%  244 aa  Y885_XYLFT RecName: Full=UPF0082 protein PD_0885;
    1::212     3e-34  36%  238 aa  Y626_NAUPA RecName: Full=UPF0082 protein NAMH_0626;
    1::237     3e-34  33%  250 aa  Y2298_MYCSK RecName: Full=UPF0082 protein Mkms_2298;
    1::237     3e-34  33%  250 aa  Y2290_MYCSJ RecName: Full=UPF0082 protein Mjls_2290;
    1::237     3e-34  33%  250 aa  Y2251_MYCSS RecName: Full=UPF0082 protein Mmcs_2251;
    1::239     5e-34  35%  251 aa  Y933_CORU7 RecName: Full=UPF0082 protein cu0933;
    1::137     5e-34  49%  238 aa  Y742_CHLMU RecName: Full=UPF0082 protein TC_0742;
    1::137     5e-34  49%  238 aa  Y717_CHLT2 RecName: Full=UPF0082 protein CTL0717;
    1::137     5e-34  49%  238 aa  Y713_CHLTB RecName: Full=UPF0082 protein CTLon_0713;
    1::137     5e-34  54%  248 aa  Y538_PROM3 RecName: Full=UPF0082 protein P9303_05381;
    1::137     5e-34  49%  238 aa  Y499_CHLTA RecName: Full=UPF0082 protein CTA_0499;
    1::137     5e-34  49%  238 aa  Y457_CHLTR RecName: Full=UPF0082 protein CT_457;
    1::134     8e-34  53%  247 aa  Y2132_SYNSC RecName: Full=UPF0082 protein Syncc9605_2132;
    4::236     1e-33  32%  239 aa  Y605_BACCQ RecName: Full=UPF0082 protein BCQ_0605;
    4::236     1e-33  32%  239 aa  Y595_BACC1 RecName: Full=UPF0082 protein BCE_0595;
    1::248     1e-33  38%  252 aa  Y504_TROW8 RecName: Full=UPF0082 protein TW504;
    1::248     1e-33  38%  252 aa  Y266_TROWT RecName: Full=UPF0082 protein TWT_266;
    1::236     1e-33  35%  253 aa  Y469_THESQ RecName: Full=UPF0082 protein TRQ2_0469;
    6::237     1e-33  37%  244 aa  Y1906_XYLFA RecName: Full=UPF0082 protein XF_1906;
    4::235     1e-33  33%  237 aa  Y1693_EXIS2 RecName: Full=UPF0082 protein Exig_1693;
    1::139     1e-33  46%  252 aa  Y1075_LEIXX RecName: Full=UPF0082 protein Lxx10750;
    1::237     1e-33  32%  250 aa  Y1030_MYCPA RecName: Full=UPF0082 protein MAP_1030;
    1::242     2e-33  34%  252 aa  Y1935_KOSOT RecName: Full=UPF0082 protein Kole_1935;
    1::239     2e-33  35%  251 aa  Y1665_CHLTE RecName: Full=UPF0082 protein CT1665;
    1::236     2e-33  35%  253 aa  Y466_THEMA RecName: Full=UPF0082 protein TM_0466;
    1::248     2e-33  35%  253 aa  Y1847_ACAM1 RecName: Full=UPF0082 protein AM1_1847;
    4::236     3e-33  33%  239 aa  Y723_BACA2 RecName: Full=UPF0082 protein RBAM_007230;
    4::236     3e-33  31%  239 aa  Y615_BACC7 RecName: Full=UPF0082 protein BCAH187_A0615;
    1::239     3e-33  32%  251 aa  Y3246_MYCUA RecName: Full=UPF0082 protein MUL_3246;
    1::239     3e-33  32%  251 aa  Y2098_MYCMM RecName: Full=UPF0082 protein MMAR_2098;
    1::134     4e-33  52%  248 aa  Y542_SYNS9 RecName: Full=UPF0082 protein Syncc9902_0542;
    1::237     4e-33  36%  246 aa  Y269_LAWIP RecName: Full=UPF0082 protein LI0269;
    1::134     4e-33  54%  244 aa  Y2234_SYNS3 RecName: Full=UPF0082 protein sync_2234;
    1::242     5e-33  34%  255 aa  Y718_ROSCS RecName: Full=UPF0082 protein Rcas_0718;
    4::236     5e-33  31%  239 aa  Y622_BACAA RecName: Full=UPF0082 protein BAA_0622;
    4::236     5e-33  31%  239 aa  Y578_BACC3 RecName: Full=UPF0082 protein BCA_0578;
    4::236     5e-33  31%  239 aa  Y541_BACC0 RecName: Full=UPF0082 protein BCAH820_0541;
    4::236     5e-33  31%  239 aa  Y541_BACAN RecName: Full=UPF0082 protein BA_0541/GBAA_0541/BAS0510;
    1::190     5e-33  38%  249 aa  Y4974_MYXXD RecName: Full=UPF0082 protein MXAN_4974;
    4::236     5e-33  31%  239 aa  Y453_BACHK RecName: Full=UPF0082 protein BT9727_0453;
    4::236     5e-33  31%  239 aa  Y449_BACCZ RecName: Full=UPF0082 protein BCE33L0449;
    4::236     5e-33  31%  239 aa  Y4045_BACAC RecName: Full=UPF0082 protein BAMEG_4045;
    1::138     5e-33  49%  252 aa  Y3030_HERA2 RecName: Full=UPF0082 protein Haur_3030;
    6::237     5e-33  37%  244 aa  Y1059_XYLFM RecName: Full=UPF0082 protein Xfasm12_1059;
    1::134     7e-33  53%  250 aa  Y543_SYNPX RecName: Full=UPF0082 protein SYNW0543;
    4::236     7e-33  31%  239 aa  Y465_BACCN RecName: Full=UPF0082 protein Bcer98_0465;
    1::139     7e-33  48%  252 aa  Y1141_CHLSY RecName: Full=UPF0082 protein Chy400_1141;
    1::139     7e-33  48%  252 aa  Y1043_CHLAA RecName: Full=UPF0082 protein Caur_1043;
    1::236     7e-33  35%  253 aa  Y1011_THELT RecName: Full=UPF0082 protein Tlet_1011;
    1::215     9e-33  37%  246 aa  Y394_RUTMC RecName: Full=UPF0082 protein Rmag_0394;
    1::236     9e-33  35%  239 aa  Y1898_ACISJ RecName: Full=UPF0082 protein Ajs_1898;
    4::236     1e-32  31%  239 aa  Y4761_BACC2 RecName: Full=UPF0082 protein BCG9842_B4761;
    4::238     1e-32  32%  238 aa  Y437_STAES RecName: Full=UPF0082 protein SE_0437;
    4::238     1e-32  32%  238 aa  Y322_STAEQ RecName: Full=UPF0082 protein SERP0322;
    1::244     2e-32  35%  254 aa  Y1358_MICAN RecName: Full=UPF0082 protein MAE_13580;
    4::236     2e-32  31%  239 aa  YEEI_BACSU RecName: Full=UPF0082 protein yeeI;
    1::243     2e-32  34%  251 aa  Y3828_MYCGI RecName: Full=UPF0082 protein Mflv_3828;
    1::139     2e-32  47%  252 aa  Y2594_CHLAD RecName: Full=UPF0082 protein Cagg_2594;
    4::236     3e-32  31%  239 aa  Y577_BACC4 RecName: Full=UPF0082 protein BCB4264_A0577;
    4::236     3e-32  31%  239 aa  Y539_BACCR RecName: Full=UPF0082 protein BC_0539;
    1::236     3e-32  33%  248 aa  Y3980_PSESM RecName: Full=UPF0082 protein PSPTO_3980;
    1::236     3e-32  35%  248 aa  Y3775_PSE14 RecName: Full=UPF0082 protein PSPPH_3775;
    1::136     3e-32  51%  253 aa  Y1833_SYNR3 RecName: Full=UPF0082 protein SynRCC307_1833;
    1::236     3e-32  33%  248 aa  Y1407_PSEU2 RecName: Full=UPF0082 protein Psyr_1407;
    1::237     3e-32  33%  247 aa  Y2259_DESVH RecName: Full=UPF0082 protein DVU_2259;
    1::237     5e-32  33%  247 aa  Y986_DESVV RecName: Full=UPF0082 protein Dvul_0986;
    1::188     5e-32  40%  241 aa  Y4067_DECAR RecName: Full=UPF0082 protein Daro_4067;
    4::235     6e-32  32%  237 aa  Y153_EXISA RecName: Full=UPF0082 protein EAT1b_0153;
    1::140     8e-32  48%  253 aa  Y529_SYNP6 RecName: Full=UPF0082 protein syc0529_d;
    4::236     8e-32  31%  239 aa  Y1481_BREBN RecName: Full=UPF0082 protein BBR47_14810;
    1::241     8e-32  33%  253 aa  Y1291_MICLC RecName: Full=UPF0082 protein Mlut_12910;
    1::140     8e-32  48%  253 aa  Y1017_SYNE7 RecName: Full=UPF0082 protein Synpcc7942_1017;
    4::236     1e-31  32%  242 aa  Y1004_SYMTH RecName: Full=UPF0082 protein STH1004;
    1::244     2e-31  34%  245 aa  Y6590_MYCAP RecName: Full=UPF0082 protein MAG6590;
    1::245     2e-31  40%  253 aa  Y2125_TRIEI RecName: Full=UPF0082 protein Tery_2125;
    4::235     4e-31  36%  238 aa  YEEN_SHISS RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_SHIFL RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_SHIBS RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_ECOUT RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_ECOLI RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_ECOL6 RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_ECOL5 RecName: Full=UPF0082 protein yeeN;
    4::235     4e-31  36%  238 aa  YEEN_ECO57 RecName: Full=UPF0082 protein yeeN;
    9::200     4e-31  37%  237 aa  Y2560_FLAJ1 RecName: Full=UPF0082 protein Fjoh_2560;
    1::235     4e-31  39%  244 aa  Y2194_DEIGD RecName: Full=UPF0082 protein Dgeo_2194;
    1::236     4e-31  33%  244 aa  Y2075_RHOFD RecName: Full=UPF0082 protein Rfer_2075;
    4::134     5e-31  46%  238 aa  Y727_STAAC RecName: Full=UPF0082 protein SACOL0727;
    4::134     5e-31  46%  238 aa  Y708_STAA2 RecName: Full=UPF0082 protein SaurJH1_0708;
    4::134     5e-31  46%  238 aa  Y693_STAA9 RecName: Full=UPF0082 protein SaurJH9_0693;
    4::134     5e-31  46%  238 aa  Y690_STAAT RecName: Full=UPF0082 protein USA300HOU_0690;
    4::134     5e-31  46%  238 aa  Y680_STAAR RecName: Full=UPF0082 protein SAR0680;
    4::134     5e-31  46%  238 aa  Y675_STAA8 RecName: Full=UPF0082 protein SAOUHSC_00675;
    4::134     5e-31  46%  238 aa  Y669_STAAM RecName: Full=UPF0082 protein SAV0669;
    4::134     5e-31  46%  238 aa  Y655_STAA3 RecName: Full=UPF0082 protein SAUSA300_0655;
    4::134     5e-31  46%  238 aa  Y638_STAAE RecName: Full=UPF0082 protein NWMN_0638;
    4::134     5e-31  46%  238 aa  Y634_STAAS RecName: Full=UPF0082 protein SAS0634;
    4::134     5e-31  46%  238 aa  Y631_STAAW RecName: Full=UPF0082 protein MW0631;
    4::134     5e-31  46%  238 aa  Y624_STAAN RecName: Full=UPF0082 protein SA0624;
    4::134     5e-31  46%  238 aa  Y618_STAAB RecName: Full=UPF0082 protein SAB0618;
    6::135     9e-31  50%  243 aa  Y3128_STRM5 RecName: Full=UPF0082 protein Smal_3128;
    4::235     1e-30  36%  238 aa  YCDB_LACLA RecName: Full=UPF0082 protein ycdB;
    4::235     1e-30  35%  238 aa  Y364_STRU0 RecName: Full=UPF0082 protein SUB0364;
    1::236     1e-30  33%  239 aa  Y3203_ACIAC RecName: Full=UPF0082 protein Aave_3203;
    7::238     1e-30  36%  241 aa  Y195_STRT1 RecName: Full=UPF0082 protein str0195;
    4::235     1e-30  36%  238 aa  Y242_STRTD RecName: Full=UPF0082 protein STER_0242;
    1::241     1e-30  35%  249 aa  Y2155_ACIBY RecName: Full=UPF0082 protein ABAYE2155;
    1::241     1e-30  35%  249 aa  Y2152_ACIBS RecName: Full=UPF0082 protein ABSDF2152;
    1::241     1e-30  35%  249 aa  Y1989_ACIB3 RecName: Full=UPF0082 protein ABBFA_001989;
    7::238     1e-30  36%  241 aa  Y195_STRT2 RecName: Full=UPF0082 protein stu0195;
    1::241     1e-30  35%  249 aa  Y1731_ACIB5 RecName: Full=UPF0082 protein AB57_1731;
    1::241     1e-30  35%  249 aa  Y1536_ACIBC RecName: Full=UPF0082 protein ACICU_01536;
    1::241     1e-30  35%  249 aa  Y1496_ACIBT RecName: Full=UPF0082 protein A1S_1496;
    1::139     2e-30  46%  251 aa  Y475_MYCLE RecName: Full=UPF0082 protein ML0475;
    1::139     2e-30  46%  251 aa  Y475_MYCLB RecName: Full=UPF0082 protein MLBr00475;
    6::135     2e-30  49%  243 aa  Y3713_STRMK RecName: Full=UPF0082 protein Smlt3713;
    9::131     2e-30  51%  242 aa  Y097_PORGI RecName: Full=UPF0082 protein PG_0097;
    1::237     3e-30  35%  252 aa  Y1106_FERNB RecName: Full=UPF0082 protein Fnod_1106;
    4::235     4e-30  34%  238 aa  Y316_STRP1 RecName: Full=UPF0082 protein SPy_0316/M5005_Spy0269;
    4::235     4e-30  34%  238 aa  Y311_STRP8 RecName: Full=UPF0082 protein spyM18_0311;
    4::235     4e-30  34%  238 aa  Y297_STRP6 RecName: Full=UPF0082 protein M6_Spy0297;
    4::235     4e-30  34%  238 aa  Y287_STRPB RecName: Full=UPF0082 protein MGAS2096_Spy0287;
    4::235     4e-30  34%  238 aa  Y268_STRPC RecName: Full=UPF0082 protein MGAS9429_Spy0268;
    4::235     4e-30  34%  238 aa  Y266_STRPD RecName: Full=UPF0082 protein MGAS10270_Spy0266;
    4::235     4e-30  34%  238 aa  Y265_STRPZ RecName: Full=UPF0082 protein Spy49_0265;
    4::235     4e-30  34%  238 aa  Y261_STRPM RecName: Full=UPF0082 protein M28_Spy0261;
    4::235     4e-30  34%  238 aa  Y231_STRP3 RecName: Full=UPF0082 protein SpyM3_0231/SPs1628;
    4::235     4e-30  34%  238 aa  Y1586_STRPG RecName: Full=UPF0082 protein SpyM51586;
    4::235     6e-30  34%  238 aa  Y264_STRPF RecName: Full=UPF0082 protein MGAS10750_Spy0264;
    4::236     6e-30  35%  238 aa  Y1789_STRMU RecName: Full=UPF0082 protein SMU_1789c;
    1::139     6e-30  46%  251 aa  Y1435_SYNWW RecName: Full=UPF0082 protein Swol_1435;
    9::132     6e-30  50%  243 aa  Y1233_PARD8 RecName: Full=UPF0082 protein BDI_1233;
    9::200     7e-30  34%  236 aa  Y835_FLAPJ RecName: Full=UPF0082 protein FP0835;
    1::237     7e-30  35%  245 aa  Y641_NEOSM RecName: Full=UPF0082 protein NSE_0641;
    1::141     7e-30  45%  255 aa  Y4362_ROSS1 RecName: Full=UPF0082 protein RoseRS_4362;
    4::235     9e-30  35%  238 aa  Y242_LACLM RecName: Full=UPF0082 protein llmg_0242;
    4::235     9e-30  35%  238 aa  Y237_LACLS RecName: Full=UPF0082 protein LACR_0237;
    9::132     1e-29  48%  247 aa  Y627_BACTN RecName: Full=UPF0082 protein BT_0627;
    4::235     1e-29  34%  238 aa  Y1691_STRA3 RecName: Full=UPF0082 protein gbs1691;
    4::235     1e-29  34%  238 aa  Y1658_STRA1 RecName: Full=UPF0082 protein SAK_1658;
    4::235     1e-29  34%  238 aa  Y1645_STRA5 RecName: Full=UPF0082 protein SAG1645;
    1::134     2e-29  48%  247 aa  Y1972_SYNPW RecName: Full=UPF0082 protein SynWH7803_1972;
    1::138     2e-29  45%  252 aa  Y1246_THEAB RecName: Full=UPF0082 protein THA_1246;
   20::234     3e-29  40%  235 aa  Y424_CAMFF RecName: Full=UPF0082 protein CFF8240_0424;
    4::236     5e-29  30%  239 aa  Y317_STACT RecName: Full=UPF0082 protein Sca_0317;
    9::132     1e-28  46%  245 aa  Y2589_BACFN RecName: Full=UPF0082 protein BF2589;
    9::132     1e-28  46%  245 aa  Y2564_BACFR RecName: Full=UPF0082 protein BF2564;
    4::236     1e-28  33%  238 aa  Y402_STRSY RecName: Full=UPF0082 protein SSU05_0402;
    9::186     1e-28  39%  238 aa  Y3516_CYTH3 RecName: Full=UPF0082 protein CHU_3516;
    1::138     1e-28  45%  241 aa  Y1337_METPP RecName: Full=UPF0082 protein Mpe_A1337;
    9::132     2e-28  47%  246 aa  Y3469_BACV8 RecName: Full=UPF0082 protein BVU_3469;
    1::113     2e-28  51%  248 aa  Y552_LACRD RecName: Full=UPF0082 protein Lreu_0552;
    1::113     2e-28  51%  248 aa  Y538_LACRJ RecName: Full=UPF0082 protein LAR_0538;
    6::236     2e-28  35%  242 aa  Y3027_XANCP RecName: Full=UPF0082 protein XCC3027;
    9::182     2e-28  41%  232 aa  Y1964_BDEBA RecName: Full=UPF0082 protein Bd1964;
    6::236     2e-28  35%  242 aa  Y1169_XANCB RecName: Full=UPF0082 protein xcc-b100_1169;
    6::236     2e-28  35%  242 aa  Y1131_XANC8 RecName: Full=UPF0082 protein XC_1131;
    1::236     3e-28  33%  242 aa  Y2064_BURP8 RecName: Full=UPF0082 protein Bphy_2064;
    9::235     9e-28  34%  238 aa  Y5184_VIBVU RecName: Full=UPF0082 protein VV2_1184;
    9::235     9e-28  34%  238 aa  Y4010_VIBVY RecName: Full=UPF0082 protein VVA0010;
    4::236     9e-28  34%  238 aa  Y387_STRS2 RecName: Full=UPF0082 protein SSU98_0387;
   20::239     9e-28  32%  240 aa  Y2184_ANADE RecName: Full=UPF0082 protein Adeh_2184;
    6::236     9e-28  35%  242 aa  Y1659_XANOR RecName: Full=UPF0082 protein XOO1659;
    6::236     9e-28  35%  242 aa  Y1543_XANOM RecName: Full=UPF0082 protein XOO1543;
    1::140     1e-27  45%  244 aa  Y821_THET8 RecName: Full=UPF0082 protein TTHA0821;
    1::140     1e-27  45%  244 aa  Y469_THET2 RecName: Full=UPF0082 protein TT_C0469;
   20::239     1e-27  32%  240 aa  Y1765_ANAD2 RecName: Full=UPF0082 protein A2cp1_1765;
   20::239     1e-27  32%  240 aa  Y1694_ANASK RecName: Full=UPF0082 protein AnaeK_1694;
   20::239     2e-27  36%  240 aa  Y7062_MYXXD RecName: Full=UPF0082 protein MXAN_7062;
    1::215     2e-27  35%  246 aa  Y365_VESOH RecName: Full=UPF0082 protein COSY_0365;
    6::236     2e-27  34%  242 aa  Y3282_XANC5 RecName: Full=UPF0082 protein XCV3282;
    9::239     2e-27  33%  239 aa  Y2806_VIBCM RecName: Full=UPF0082 protein VCM66_A0006;
    9::239     2e-27  33%  239 aa  Y2806_VIBCH RecName: Full=UPF0082 protein VC_A0006;
    9::239     2e-27  33%  239 aa  Y124_VIBC3 RecName: Full=UPF0082 protein VC0395_0124;
    1::138     6e-27  45%  249 aa  Y2052_ACIAD RecName: Full=UPF0082 protein ACIAD2052;
   20::235     1e-26  40%  235 aa  Y557_CAMJD RecName: Full=UPF0082 protein JJD26997_0557;
    1::214     1e-26  35%  240 aa  Y373_MYCS5 RecName: Full=UPF0082 protein MS53_0373;
    1::240     1e-26  30%  253 aa  Y1367_KOCRD RecName: Full=UPF0082 protein KRH_13670;
    3::128     2e-26  49%  234 aa  Y3162_PSESM RecName: Full=UPF0082 protein PSPTO_3162;
    3::128     2e-26  49%  234 aa  Y3028_PSEU2 RecName: Full=UPF0082 protein Psyr_3028;
    3::128     2e-26  49%  234 aa  Y2212_PSE14 RecName: Full=UPF0082 protein PSPPH_2212;
    9::235     2e-26  33%  241 aa  Y2063_PSYIN RecName: Full=UPF0082 protein Ping_2063;
    6::135     2e-26  47%  242 aa  Y1555_XANOP RecName: Full=UPF0082 protein PXO_01555;
    9::240     4e-26  34%  240 aa  Y3241_ALISL RecName: Full=UPF0082 protein VSAL_II0141;
   22::235     4e-26  31%  240 aa  Y3175_ALTMD RecName: Full=UPF0082 protein MADE_03175;
   13::206     4e-26  34%  236 aa  Y303_UREP2 RecName: Full=UPF0082 protein UPA3_0303;
   13::206     4e-26  34%  236 aa  Y295_UREPA RecName: Full=UPF0082 protein UU295;
   13::205     4e-26  34%  236 aa  Y292_UREU1 RecName: Full=UPF0082 protein UUR10_0292;
    9::241     5e-26  31%  241 aa  Y4169_COLP3 RecName: Full=UPF0082 protein CPS_4169;
   20::132     5e-26  49%  235 aa  Y1081_CAMLR RecName: Full=UPF0082 protein Cla_1081;
    9::237     6e-26  29%  239 aa  Y1803_ALCBS RecName: Full=UPF0082 protein ABO_1803;
   20::133     6e-26  49%  235 aa  Y1306_CAMJR RecName: Full=UPF0082 protein CJE1306;
   20::133     6e-26  49%  235 aa  Y1187_CAMJJ RecName: Full=UPF0082 protein CJJ81176_1187;
   20::133     6e-26  49%  235 aa  Y1172_CAMJE RecName: Full=UPF0082 protein Cj1172c;
   20::131     8e-26  50%  235 aa  Y1116_CAMJ8 RecName: Full=UPF0082 protein C8J_1116;
    6::135     1e-25  46%  242 aa  Y3151_XANAC RecName: Full=UPF0082 protein XAC3151;
    9::235     1e-25  35%  240 aa  Y810_CHRSD RecName: Full=UPF0082 protein Csal_0810;
    1::236     1e-25  31%  247 aa  Y2210_HALHL RecName: Full=UPF0082 protein Hhal_2210;
    9::240     2e-25  30%  240 aa  Y3150_VIBF1 RecName: Full=UPF0082 protein VF_A0150;
    9::240     2e-25  30%  240 aa  Y2986_VIBFM RecName: Full=UPF0082 protein VFMJ11_A0186;
    9::235     2e-25  32%  241 aa  Y2154_MARAV RecName: Full=UPF0082 protein Maqu_2154;
    9::240     2e-25  31%  240 aa  Y3401_SHEON RecName: Full=UPF0082 protein SO_3401;
    9::235     2e-25  33%  238 aa  Y164_IDILO RecName: Full=UPF0082 protein IL0164;
    9::238     3e-25  31%  238 aa  Y1551_SACD2 RecName: Full=UPF0082 protein Sde_1551;
    4::235     7e-25  33%  238 aa  YEEN_SALTY RecName: Full=UPF0082 protein yeeN;
    4::235     7e-25  33%  238 aa  YEEN_SALTI RecName: Full=UPF0082 protein yeeN;
    4::235     7e-25  33%  238 aa  YEEN_SALPA RecName: Full=UPF0082 protein yeeN;
    4::235     7e-25  33%  238 aa  YEEN_SALCH RecName: Full=UPF0082 protein yeeN;
    9::214     7e-25  33%  239 aa  Y1104_THICR RecName: Full=UPF0082 protein Tcr_1104;
    9::237     9e-25  31%  237 aa  Y1370_PSEHT RecName: Full=UPF0082 protein PSHAa1370;
    1::237     1e-24  29%  247 aa  Y3201_DESVM RecName: Full=UPF0082 protein DvMF_3201;
    4::235     1e-24  30%  238 aa  Y293_STRS7 RecName: Full=UPF0082 protein SZO_02930;
    4::235     1e-24  30%  238 aa  Y1904_STRE4 RecName: Full=UPF0082 protein SEQ_1904;
    4::235     1e-24  30%  238 aa  Y1681_STREM RecName: Full=UPF0082 protein Sez_1681;
    3::207     2e-24  35%  234 aa  Y3960_PSEF5 RecName: Full=UPF0082 protein PFL_3960;
    3::162     2e-24  42%  237 aa  Y2550_PSEPK RecName: Full=UPF0082 protein PP_2550;
    9::235     3e-24  31%  240 aa  Y5582_PHOPR RecName: Full=UPF0082 protein PBPRB1582;
   22::132     3e-24  46%  239 aa  Y044_ACHLI RecName: Full=UPF0082 protein ACL_0044;
    4::236     3e-24  32%  238 aa  Y586_STRSV RecName: Full=UPF0082 protein SSA_0586;
    9::131     3e-24  45%  238 aa  Y4704_VIBSL RecName: Full=UPF0082 protein VS_II1504;
    9::132     3e-24  45%  238 aa  Y4011_VIBPA RecName: Full=UPF0082 protein VPA0011;
   27::155     5e-24  45%  290 aa  YG1D_YEAST RecName: Full=UPF0082 protein YGR021W;
    3::207     5e-24  34%  234 aa  Y3677_PSEPF RecName: Full=UPF0082 protein Pfl01_3677;
   58::296     5e-24  30%  297 aa  CCD44_HUMAN RecName: Full=Coiled-coil domain-containing protein 44;
    9::132     6e-24  45%  238 aa  Y7036_VIBHB RecName: Full=UPF0082 protein VIBHAR_07036;
   13::242     8e-24  32%  248 aa  Y802_MYCPE RecName: Full=UPF0082 protein MYPE8020;
    4::135     1e-23  42%  238 aa  Y454_STRGC RecName: Full=UPF0082 protein SGO_0454;
   20::234     1e-23  33%  235 aa  Y535_CAMC5 RecName: Full=UPF0082 protein Ccur92_05350;
   20::234     1e-23  36%  235 aa  Y494_CAMC1 RecName: Full=UPF0082 protein Ccon26_04940;
   20::133     7e-23  43%  244 aa  Y1426_CAMHC RecName: Full=UPF0082 protein CHAB381_1426;
   11::236     9e-23  29%  237 aa  Y1016_WOLSU RecName: Full=UPF0082 protein WS1016;
    1::236     2e-22  27%  239 aa  Y4238_VEREI RecName: Full=UPF0082 protein Veis_4238;
   20::132     2e-22  46%  237 aa  Y2928_POLSJ RecName: Full=UPF0082 protein Bpro_2928;
    9::133     4e-22  42%  236 aa  Y1389_SULDN RecName: Full=UPF0082 protein Suden_1389;
   29::201     6e-22  34%  237 aa  Y598_MYCCT RecName: Full=UPF0082 protein MCAP_0598;
    9::241     7e-22  29%  241 aa  Y3560_PSEHT RecName: Full=UPF0082 protein PSHAb0060;
   25::132     1e-21  45%  237 aa  Y546_MESFL RecName: Full=UPF0082 protein Mfl546;
    9::238     1e-21  33%  238 aa  Y2868_MARMS RecName: Full=UPF0082 protein Mmwyl1_2868;
   11::133     2e-21  43%  240 aa  Y820_HELPS RecName: Full=UPF0082 protein HPSH_00820;
    4::236     3e-21  28%  238 aa  Y2064_STRPI RecName: Full=UPF0082 protein SPH_2064;
    4::236     3e-21  28%  238 aa  Y2002_STRP7 RecName: Full=UPF0082 protein SP70585_2002;
    4::236     3e-21  28%  238 aa  Y1952_STRZP RecName: Full=UPF0082 protein SPP_1952;
    4::236     3e-21  28%  238 aa  Y1946_STRPJ RecName: Full=UPF0082 protein SPN23F19460;
    4::236     3e-21  28%  238 aa  Y1922_STRPN RecName: Full=UPF0082 protein SP_1922;
    4::236     3e-21  28%  238 aa  Y1919_STRZJ RecName: Full=UPF0082 protein SPJ_1919;
    4::236     3e-21  28%  238 aa  Y1897_STRPS RecName: Full=UPF0082 protein SPCG_1897;
    4::236     3e-21  28%  238 aa  Y1871_STRZT RecName: Full=UPF0082 protein SPT_1871;
    4::236     3e-21  28%  238 aa  Y1835_STRP4 RecName: Full=UPF0082 protein SPG_1835;
    4::236     3e-21  28%  238 aa  Y1738_STRR6 RecName: Full=UPF0082 protein spr1738;
    4::236     3e-21  28%  238 aa  Y1725_STRP2 RecName: Full=UPF0082 protein SPD_1725;
   29::156     4e-21  41%  293 aa  YGWC_SCHPO RecName: Full=UPF0082 protein C8D2.12c;
   11::133     4e-21  43%  240 aa  Y162_HELPJ RecName: Full=UPF0082 protein jhp_0149;
   11::133     5e-21  44%  240 aa  Y344_HELAH RecName: Full=UPF0082 protein Hac_0344;
   11::133     5e-21  43%  240 aa  Y162_HELPY RecName: Full=UPF0082 protein HP_0162;
   11::133     5e-21  43%  240 aa  Y160_HELP2 RecName: Full=UPF0082 protein HPP12_0160;
   11::131     5e-21  44%  238 aa  Y1604_HELHP RecName: Full=UPF0082 protein HH_1604;
   11::133     5e-21  43%  240 aa  Y159_HELPH RecName: Full=UPF0082 protein HPAG1_0159;
   11::133     5e-21  43%  240 aa  Y148_HELPG RecName: Full=UPF0082 protein HPG27_148;
    7::209     8e-21  31%  234 aa  Y133_MYCGA RecName: Full=UPF0082 protein MYCGA1330;
    9::235     2e-19  28%  243 aa  Y550_PSEA6 RecName: Full=UPF0082 protein Patl_0550;
   55::293     2e-19  29%  294 aa  CCD44_MOUSE RecName: Full=Coiled-coil domain-containing protein 44;
   25::139     8e-19  41%  257 aa  Y2667_SALRD RecName: Full=UPF0082 protein SRU_2667;
   89::245     2e-18  27%  331 aa  U082_ARATH RecName: Full=UPF0082 protein At2g25830;
    7::235     9e-17  29%  239 aa  Y332_MYCGE RecName: Full=UPF0082 protein MG332;
    9::133     1e-15  37%  245 aa  Y1622_SULNB RecName: Full=UPF0082 protein SUN_1622;
    7::133     7e-14  32%  235 aa  Y478_MYCPN RecName: Full=UPF0082 protein MG332 homolog;
    1::126     5e-10  29%  242 aa  Y597_BUCCC RecName: Full=UPF0082 protein BCc_197;
  296::415     4e-04  27% 1272 aa  NRDJ_AGRT5 RecName: Full=Vitamin B12-dependent ribonucleotide
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
Y592_PELUB      MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
Y2795_RHISN     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGMPDPAMNPRLRLAIQNAKAQSMPKDNIERAV
Y2114_PARL1     MAGHSQFKNIMYRKGAQDKKRSKLFAKLAKEITVAAKMGLPDPEYNPRLRAAIQAARVENMPKDNIERAI
Y2641_SINMW     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAV
Y2753_RHIME     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKTGLPDPTMNPRLRLAIQNAKAQSMPKDNIERAV
Y3631_AGRVS     MAGHSQFKNIMHRKGKQDSVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQSMPKDNIERAV
Y2729_NITWN     MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARAENMPKDNIERAI
Y3727_AGRT5     MAGHSQFKNIMHRKGKQDSVRSKMFSKLAREITVAAKTGMPDPNMNARLRLAIQNAKAQSMPKDNIERAI
Y2308_RHOS1     MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVSMPKDVIERAI
Y2261_RHOS4     MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVSMPKDVIERAI
Y163_BARBK      MAGHSQFKNIMHRKGRQDAVRSKVFSKLAREITVAAKQGSPDPAMNPRLRLAVQNAKSQSMPKDNIERAI
Y577_RHOS5      MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVSMPKDVIERAI
Y3945_RHILO     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGTPDPSMNPRLRLAIQNAKAVSMPKDNIQRAI
Y2012_RHOSK     MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVSMPKDVIERAI
Y4273_RHOP2     MAGHSQFKNIMHRKGKQDAQRSKAFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARAENMPKDNIERAI
Y4807_RHOPB     MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPAMNARLRSAIIAARQENMPKDNIERAI
Y419_NOVAD      MAGHSKFKNIMHRKGAQDKKRSAMFSKLSREITVAAKMGMPDPDMNPRLRAAINAAKAQSMPKDNIARAI
Y2363_BART1     MAGHSQFKNIMHRKGRQDAVRSKIFSKLAREITVAAKQGAPDPAMNPRLRLAVQNAKAQSMPKDNIERAI
Y1481_BARHE     MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGSPDPAMNPRLRLAVQNAKAQSMPKDNIERAI
Y4171_RHOPS     MAGHSQFKNIMHRKGKQDAQRSKAFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARQENMPKDNIERAI
Y3692_BRUSI     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y321_BRUME      MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1769_BRUMB     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1755_BRUC2     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1729_BRUA2     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1717_BRUSU     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1702_BRUAB     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1660_BRUO2     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI
Y1200_OCHA4     MAGHSQFKNIMHRKGRQDAVRSKMFSKLGREITVAAKQGLPDPTMNPRLRLAIQNAKAQSMPKDNIERAI
Y1072_SILPO     MAGHSKWANIQHRKGRQDAARSKLFSKFSKEITVAAKMGDPDPDKNPRLRLAIKEAKSQSMPKDNIERAI
Y4771_RHOP5     MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGAPDPAMNARLRSAIIAARQENMPKDNIERAI
Y153_ZYMMO      MAGHSKFKNIMYRKGAQDKKRSALFSKLSREVTVAAKSGLPDPNANPRLRAAVSAARSGGMPKDNIERAI
Y1179_BARQU     MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGAPDPAMNPRLRLAVQNAKAQSMPKDNIERAI
Y3475_RHIEC     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQSMPKDNIDRAI
Y3714_RHIE6     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQSMPKDNIDRAI
Y2018_ROSDO     MAGHSKWANIQHRKGRQDAVRAKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSQSMPKDNIDRAI
Y3214_RHILW     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPMMNARLRLAIQNAKAQSMPKDNIDRAI
Y2142_SPHWW     MAGHSKFKNIMHRKGAQDKKRSALFSKLSREITVAARMGLPDPAMNARLRQAVITARKEGLPKDNIERSI
Y2762_DINSH     MAGHSKWANIQHRKGRQDKLRAKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSQSVPKDVIERAI
Y3983_RHIL3     MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQSMPKDNIDRAI
Y1534_BRAJA     MAGHSQFKNIMHRKGRQDAQKSKLFGKLAREITVAAKLGTPDPAMNPRLRAAVIAARAENMPKDNIERAI
Y1893_SILST     MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSNSVPKDVIDRAI
Y1905_PARDP     MAGHSKWANIQHRKGKQDKLRSKLFSKLAKEITVAAKMGDPDPEKNPRLRLAVKEAKSNSMPKDVIDRAI
Y3380_JANSC     MAGHSKWANIQHRKGRQDKLRAKVFSKMSKEITVAAKMGDPDPDKNPRLRLAVKEAKSVSVPKDVIERAI
Y2433_MARMM     MAGHSKWANIQHRKGRQDKLRSKLFSRLSKEISIAAKLGGPDVDANPRLRLAVSNAKGQSMPKDNIQRAI
Y1143_BRASO     MAGHSQFKNIMHRKGRQDAMKSKLFGKLAREITVAAKLGTPDPAMNPRLXXXXXXXXXENMPKDNIERAI
Y3192_MESSB     MAGHSQFKNIMHRKGRQDAVKSKMFSKLAREITVAAKAGLPDPAMNPRLRLAVQNARAQSMPKDNIERAI
Y3068_PHEZH     MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGMPDPAMNPRLRLAVQNAKAESMPKDNIDRAI
Y1287_RHOPT     MAGHSQFKNIMHRKGRQDAQRSKLFSKLAREITVAAKLGTPDPAMNPXXXXXXXXXXXENMPKDNIERAI
Y1097_RHOPA     MAGHSQFKNIMHRKGRQDAQRSKLFSKLAREITVAAKLGTPDPAMNPXXXXXXXXXXXENMPKDNIERAI
Y6910_BRASB     MAGHSQFKNIMHRKGRQDAMKSKLFGKLAREITVAAKLGTPDPAMNPRLXXXXXXXXXENMPKDNIERAI
Y2673_PELPD     MSGHNKWSTIKHKKGAADAKRGKVFTKLIKEISVAAKLGGGDPAANPRLRTAVDKAKAENMPKDNIERAI
Y1679_GLUOX     MAGHSQFKNIMHRKGAQDAKRAKQFAKVLREITVATRSGLPDPTSNPRLRAAISMAREVNMPKDNVERAI
Y510_AZOC5      MAGHSQFKNIMHRKGRQDAVRSKLFSKLAREITVAAKMGLPDPNMNXXXXXXXXXXXXENMPKDNIERAI
Y922_METPB      MAGHSQFKNIMHRKGRVDAVRSKVFSKLAREITVAAKLGTPDPSMNPXXXXXXXXXXXENMPKDNIERAI
Y7401_METNO     MAGHSQFKNIMHRKGRVDAVRSKVFGKLAREITVAAKLGTPDPAMNPXXXXXXXXXXXENMPKDNIERAI
Y371_DESOH      MSGHNKWSSIKHKKGAADAKRGKVFTKLIKEITLAARTGGGDPDGNPRLRTAIAAAKDENMPKDNIERAI
Y7305_OLICO     MAGHSQFKNIMHRKGKQDAMRSKVFGKLAREITVAAKLGTPDPAMNPXXXXXXXXXXXENMPKDNIERAI
Y946_METC4      MAGHSQFKNIMHRKGRVDAVRSKVFSKLAREITVAAKLGTPDPSMNPXXXXXXXXXXXENMPKDNIERAI
Y1808_RHOCS     MAGHSQFKNIMHRKGAQDAKRAKKFNKLAREITVSAKAGLPDPASNPRLRAAIQAARAENMPKDRIERAI
Y1575_AQUAE     MAGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANMPWENIERAI
Y3553_METRJ     MAGHSQFKNIMHRKGRVDAVRSKVFGKLAREITVAAKLGTPDPAMNPXXXXXXXXXXXENMPKDNIERAI
Y2524_GEOSW     MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKTGGGDPASNPALRLVIEKAKAANMPNENIERAI
Y345_BEII9      MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKLGLPDPAMNXXXXXXXXXXXXENMPKDNIERAI
Y400_DESAH      MSGHSKWSTIKHKKGAADAKRGKIFTKLIKEITVAARMGGGDIDSNPRLRGAVAAAKAQNMPKDNLERAI
Y1097_GRABC     MAGHSQFKNIMHRKGAQDARRAREFAKVIREITVSARSGLPDPASNPRLRAAISWAREVNMPKDTVDRAI
Y709_ANOFW      MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKMGGGDPTTNATLRLAIEKAKSANMPNENIERAI
Y1800_NATTJ     MAGHSKWANIKHKKARVDEKRGKLFSKLSKEIIVAAKEGGGDPEKNFRLRMAVQKAKENNMPNDNIERAI
Y2958_DESAA     MSGHNKWSTIKHKKGAADAKRGKVFSKLIKEITIAARMGGGDPDANPRLRTAINAAKAENMPKDNWERAI
Y2305_METSB     MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKLGLPDPNMNXXXXXXXXXXXXENMPKDNIERAI
Y161_HYPNA      MAGHSKWANIQHRKGKQDKKRAVLFARLSKEITVASKMGGPDPAMNPRLRLAITNAKGVSVPKDNIQRAI
Y3240_RICB8     MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKAGSTNPDNNPRLRTALATARSQNLPKERIDKAI
Y677_LACDA      MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPLGNPRLRLAVDKARAANMPKDNIQRAI
Y609_LACDB      MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPLGNPRLRLAVDKARAANMPKDNIQRAI
Y3352_CAUCN     MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAESLPKDVIERAI
Y3243_CAUCR     MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAESLPKDVIERAI
Y2125_ACIBL     MSGHSKWATIKHKKGALDAKRGKIFTRLIKEITMAAKQGG-DAEKNPRLRSAVAAAKAENMPADNIKRAI
Y1661_FUSNN     MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGGDPNFNPRLRLAIEKAKAGNMPKDILERAI
Y799_RICFE      MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKTGSSNPENNPRLRNALTAARSQNLPKERIDKAI
Y568_RICBR      MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKAGSTNPDNNPRLRTALATARSQNLPKERIDKAI
Y1487_TREDE     MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISIAAKMGGGDPATNPRLRTAVLKARAANMPKDNIERAI
Y685_SULSY      MAGHSRWHXXXXXXXXXXXXXGRMFTKVIKEITIAARLGGGDPEANPRLRIAIEKAKEVNMPMENVERAI
Y651_METI4      MAGHSHWAKVKHQKGLTDIRKGKLFSKLSREISIAARLGGGDPTFNSRLRRAIANAKDEGVPLENITRAI
Y2522_RALEJ     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAAKLGGGDPDSNPRLRLSMDKAMDANMPKDNIQRAI
Y337_SPHAL      MAGHSKFKNIMHRKGAQDKKRSALFSKLSREITVAAKMGLPDPDXXXXXXXXXXXXXXQSMPKDNIQRAI
Y1186_LACCB     MSGHSKWHNIQGRKNAQDSKRGKIFQKLSRELYMAAKQGGPDPSGNPSLRLVMDKAKAANMPKDNIKRAL
Y1151_ELUMP     MGGHSHWAGIKHKKALLDSKRGKVFTRIIREITIAAKMGGAELENNPRLRKAVEDAKAANMPADNIKRAI
Y1086_RHORT     MAGHSQFKNIMHRKGGQDAKRAQLFTKLAREITVSAKLGSPDPNANPXXXXXXXXXXXQSLPKDNIQRAI
Y1022_LACC3     MSGHSKWHNIQGRKNAQDSKRGKIFQKLSRELYMAAKQGGPDPSGNPSLRLVMDKAKAANMPKDNIKRAL
Y859_CUPTR      MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAAKLGGGDPDSNPRLRLSMDKAMDANMPKDNIQRAI
Y1868_THEYD     MAGHSKWAQIKHKKAQVDAKKGKIFTKLVKEISVAARLGGGDPEKNPRLRVAIEKAREVNMPMDNIKRAI
Y681_RICCN      MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNPENNPRLRNALTAARSQNLPKERIDKAI
Y2215_THIDA     MAGHSKWANIQHRKGRQDAKRGKIFTKLIKEITVAAKMGGGDPAMNPRLRLAIEKGKAESLPKDNIENAI
Y979_FRATF      MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAI
Y929_FRATH      MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAI
Y908_FRATO      MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAI
Y2524_GEOTN     MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKNGGGDPAANPSLRLVIEKAKAANMPGENIERAI
Y137_NITOC      MAGHSKWANIQYRKGAQDAKRGKLFTRLIREITVAARLEGGDPATSPRLRTAIDKAFAANMPKDNIERAI
Y916_RALEH      MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAAKLGGGDVDSNPRLRLSIDKAMDANMPKDNIQRAI
Y4175_RICAH     MAGHSKFKNIQHRKCAQDKKRAKVFTKLIREIVTAVKTGSSNPENNPRLRNALTAARSQNLPKERIDKAI
Y1073_FRATW     MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAV
Y442_RICTY      MSGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNPENNPRLRKALNAARSQNLPKERIDKAI
Y2908_DESPS     MSGHSKWSTIKRKKGANDAKRGKIFTRLIKEITVAARGGGGDPEGNPRLRSAILVAKSENMPKDNITRAI
Y1028_FRATN     MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAV
Y964_CALS8      MSGHSKWANIRHKKEKTDAQKGKIFSKLGRELMVVAKMYGPDPETNPKLRDVIAKAKANNMPMDKIMGFI
Y943_CLOBA      MSGHSKWHNIQAKKGKTDAKRGKIFTKIGKELMVAVKNGGPSPETNNRLRDIIAKAKAANMPNDTITRSI
Y422_LACS1      MSGHSKWHNIQGRKNAQDAKRGKIFQKISREIYMVAKSGGPDPDGNPQLRLIMDKARAANMPKDNIKRAI
Y1307_LACSS     MSGHSKWHNIQGRKNAQDAKRGKIFQKLSRELFMAARSGGPDPSSNAALRLIMDKARSANMPKDNIKRAI
Y1220_METCA     MAGHSKWANIQHRKGAQDAKRGKLFTKLIREITVASRTGGPDPGNNPRLRTAIDKALVANMSKDTIERAI
Y1008_CLOBB     MSGHSKWHNIQAKKGKTDAKRGKIFTKIGKELMVAVKNGGPSPETNNRLRDIIAKAKAANMPNDTITRSI
Y904_LACJO      MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPSGNPTLRMVMDKARAANMPKTNIERAI
Y655_FRATT      MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAV
Y655_FRAT1      MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAV
Y2594_GEOKA     MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKSGGGDPASNPSLRLVIEKAKAANMPSENIERAI
Y1276_LACGA     MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPSGNPTLRMVMDKARAANMPKTNIERAI
Y1240_PEDPA     MSGHSKWHNIQGRKNAQDAKRGKIFQRISREIYVAVKAGGPDPSSNPQLRLMMDKARAANMPKDNIKRAV
Y474_TREPS      MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISVAARMAGGDPQANPRLRTAILKARAANMPKDNIERAI
Y474_TREPA      MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISVAARMAGGDPQANPRLRTAILKARAANMPKDNIERAI
Y1203_FRATM     MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANNMSKDTIERAV
Y780_CAUSK      MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKSGVPDPNMNPRLRLAVNNAKAESLPKDVIDRAI
Y743_GEOMG      MSGHNKWSTIKHKKGAADAKRGKVFTKIIKEITVAAKLGGGDPNGNPRLRSAVDKAKAENMPKDNIERAI
Y4222_CLOB8     MSGHSKWHNIQAKKGKTDAKRGKIFTKIGKEIVMAVKNGGANQDINAKLRDVVAKAKAANMPNDTISKAI
Y2379_BURVG     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDASSNPRLRLAVDKAADANMPKDNVKRAI
Y1757_HELMI     MAGHSKWANIKHRKAKVDAQKGKIFTKIGRELIVAARQGGPDPNSNFRLKIAIQKAKENNMPNDNIQRAI
Y902_EUBE2      MSGHSKFANIAHKKAANDAAKGKIFTRLGKELMIAVKEGGPDVNNNSKLRQVVAKCKAANMPNDTIDRAI
Y785_RALME      MAGHSKWANIKHKKAAADAKRGKVWTRLIKEITVAAKLGGGEFDSNPRLRLAMEKAMDANMPKDNIQRAI
Y717_RICAE      MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNPENNPRLRNALTAARSQNLPKERIDKAI
Y710_MANSM      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDAGSNPRLRAAVDKALASNMTRDTINRAI
Y733_LACAC      MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPDGNPALRMVIDKARSNNMPKDNIQRAI
Y2775_CYAP7     MAGHSKWANIKRQKARVDAKKGKTFTQLSRAIIVAARNGLPDPAANLQLRTAIEKAKAAGIPNDNIERAI
Y079_PERMH      MAGHSKWHNIRHKKAKMDAKRGQMFTKIIREITVAARQGGGDPEFNPRLRIAIEKAKKANMPVENIERAI
Y6579_METS4     MAGHSQFKNIMHRKGRVDAVRSKVFGKLAREITVAAKLGVPDPXXXXXXXXXXXXXXXXXXXKDNIERAI
Y2210_BURA4     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDANSNPRLRLAVDKAADANMPKDNVKRAI
Y2190_RALSO     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAARLGGGDVDSNPRLRLAIDKGTDANMPKDNIQRAI
Y1570_FRAP2     MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATAFANNMSKDTVERAI
Y1449_THEPX     MSGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPNTNSKLRDAIEKAKANNLPNENIQRAI
Y1378_ORITI     MAGHSKFKNIQHRKGAQDKKKAKLFASLVREISLSAKSG-ADIQYNPRLRAAISAAKFNNLPKDRIEKAI
Y1009_THEP3     MSGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPNTNSKLRDAIEKAKANNLPNENIQRAI
Y777_LACH4      MSGHSKWHNIQGRKNAQDAKRGKIFQKLSREIYMAAKSGGPDPDGNPTLRMVIDKARSNNMPKDNIKRAI
Y1803_ACTSZ     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDAGSNPRLRAAVDKALASNMTRDTINRAI
Y2886_DESAD     MAGHSKWANIQHRKGRQDAKRGKIFTKMAKDIILAAK-GGGDPAMNPSLRLAISKAKAVNMPNDKIDTAI
Y1344_BIFA0     MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEIAARQGGGDPDGNPALYDAIYKAKKASMPADNIKRAV
Y726_BIFLO      MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEIAARLGGGDPDGNPSLYDAIYKAKKASMPADNIARAV
Y538_CHLPD      MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGADPGGNPRLRLAIDTARSNSMPMENILRAV
Y450_BIFLD      MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEIAARLGGGDPDGNPSLYDAIYKAKKASMPADNIARAV
Y2335_PELCD     MAGHSKWANIKHRKGAQDAKRGKIFTKLIKEITVAAKIGGGDLEANARLRLAVDKAKQANMPKDNIERAI
Y2332_BURCM     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDANSNPRLRLAVDKAADANMPKDNVKRAI
Y2326_GEOSF     MSGHNKWSTIKHKKGAADAKRGKIFTKLIKEITVAAKLGGGDPDGNPRLRTAIDKAKGENMPKDNIERAI
Y060_ACIF5      MSGHSKWSTIKFKKALKDAKRGKIFTRLIREITVAARAGGGDPASNSRLRLALDKAYGANMTKDTIERAI
Y059_ACIF2      MSGHSKWSTIKFKKALKDAKRGKIFTRLIREITVAARAGGGDPASNSRLRLALDKAYGANMTKDTIERAI
Y596_HAEDU      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVAANPRLRSAVDKALSSNMTRDTINRAI
Y2722_NITMU     MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGGGDPNSNPRLRLAVDKAYEQNMPKENVERAI
Y618_POLSQ      MAGHSKWANIQHRKGRQDEKRGKIWTKLIKEITVAAKMGGGDLTANPRLRLAIDKAKDANMPNDNVQRAI
Y5505_RICPU     MAGHSKFKNIQHRKGAQDTKRAKVFTKLIREIVIAAKTGSSNPENNPRLRNALTAARIQNLPKERIDKAL
Y496_PROA2      MSGHSKWSTIKRKKAATDQKRGNLFTKLVREITIAAKMGGGDPSGNPRLRLALDNARANSMPQENIQRAI
Y446_COXB2      MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAI
Y422_COXBN      MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAI
Y421_DEHSB      MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPEGNARLRLAIQKAKDSRMPSDNIERAI
Y400_DEHSC      MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPEGNARLRLAIQKAKDSRMPSDNIERAI
Y2028_CYAP8     MAGHSKWANIKRQKERVDAKKGKTFAQLSRAIIVAARHGLPDPTGNFQLRTAIEKAKAAGIPNENIERAI
Y1793_COXB1     MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAI
Y1752_COXBR     MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAI
Y1566_COXBU     MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAANMPKDTITRAI
Y025_BORBZ      MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAVNKAKVANMPKDNIEKAI
Y025_BORBU      MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAVNKAKVANMPKDNIEKAI
Y2348_BURCJ     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y2317_BURCC     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y2294_BURCH     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y1682_BURCA     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y996_SYNFM      MSGHSKWSTIKHKKGAADAKRGKVFTKIIKEIMVAARMGGGAIDANPRLRAAVLAAKAENMPKENIERAI
Y933_GEOSM      MSGHNKWSTIKHKKGAADAKRGKIFTKIIKEITVAAKLGGGDPDGNPRLRTAIDKAKGENMPKDNVERAI
Y2215_CLOTE     MSGHSKWHNIQAKKGKMDAKRGKIFTKIGRELIIASKEGGSNPDTNSKLRDVIAKARANNMPQDTISRAI
Y181_CLOCE      MSGHSKWANIKRQKGAADAVRGKIFTKLGREIQIAVRMGGADPSSNSKLKDVIAKCKANNMPNDNIQRSI
Y663_ENTFA      MSGHSKWSNIQGRKNAQDAKRGKIFQKVSREIYMAAKAGGPDPAMNPALRLAVDKAKSANMPNDNIARAI
Y5621_BURS3     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y2210_CLOP1     MSGHSKWHNIQAKKGKMDAKRGKIFTKIGKEIAVAVKEGGANLDGNSRLKDAVAKAKAANMPNDNIQRAI
Y1954_CLOPE     MSGHSKWHNIQAKKGKMDAKRGKIFTKIGKEIAVAVKEGGANLDGNSRLKDAVAKAKAANMPNDNIQRAI
Y1922_CLOPS     MSGHSKWHNIQAKKGKMDAKRGKIFTKIGKEIAVAVKEGGANLDGNSRLKDAVAKAKAANMPNDNIQRAI
YU82_CLOHI      MSGHSKWHNIQAKKSKVDAKRGKIFTKIGKEIAIAAKNGGPNPDANPKLRDVIAKAKANNMPKDSIERAI
Y544_JANMA      MAGHSKWANIQHRKGRQDERRGKIWTRLIKEITVAARMGGGDVAANPRLRLAVDKAADANMPKDNVTRAI
Y3313_GEOBB     MSGHNKWSTIKHKKGAADAKRGKVFTKIIKEITVAAKLGGGDPDGNPRLRTAIDKAKGENMPKDNVERAI
Y1817_PECCP     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNNMTRDTLNRAI
Y1432_PROVI     MSGHSKWATIKRKKSATDQKRGNLFTKLVKEITIAAKMGGGDPAGNPRLRLAIDTARSNSMPMDNIQRAI
Y1235_HALOH     MAGHSKWANIKHKKAKEDRKRGKLFSKLSKMITVAAREGGGDPEMNPDLRLAIQKAKDNNMPNDNIERAI
Y025_BORGA      MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDVESNPRLRVAVNKAKVANMPKDNIEKAI
Y024_BORAP      MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAVSKAKVANMPKDNIEKAI
Y816_ANATD      MAGHSKWANIKHKKEKTDAQKGKLFTKLGRELMVVAKMYGPDPETNPKLRDVIAKAKANNMPMDKIMGFI
Y2494_ERWCT     MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNNMTRDTLNRAI
Y869_HAMD5      MAGHSKWANTKHRKAAQDAKKGKIFTKIIRELVTSARLGGGDPASNPRLRTAIDKALSHNMTRDTLNRAI
Y281_NITEC      MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGGGDPGSNPRLRLAMDKAFGHNMPKDNVERAI
Y1505_DICT6     MSGHSKWANIKHRKAAADAKKGKLFSQLSKEIIIAAKHGGGNPETNPRLRAAIERAKEANMPKENIEKAI
Y1416_GEOUR     MSGHNKWSTIKHKKGAADAKRGKIFTKLIKEITVAAKLGGGDPEGNPRLRTAIDKAKGENMPKDNIERAI
Y894_CYAA5      MAGHSKWANIKRQKERVDAKKGKTFAQLSRAIIVAAKHGIPDPAGNFQLRTAIEKAKAAGIPNDNIERAI
Y455_RICPR      MAGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNPENNPRLRKALNAARSQNLPKERIDKAI
Y980_PASMU      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDVNANPRLRTAVDKALSSNMTRDTINRAI
Y4400_RICRS     MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNPENNPRLRNALTAARSQNLPKERIDKAL
Y251_ORITB      MAGHSKFKNIQHRKGAQDKKKAKLFASLIREISLSAKSGT-DIQYNHRLRAAISAAKFNNLPKDRIEKAI
Y2388_RALPJ     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAARLGGGDADSNPRLRLAMDKATDANMPKDNINRAI
Y1535_LISMO     MSGHSKWNNIQGRKNAQDSKRSKVFQKLAREIFVAAKKGP-DPSLNPSLRLVMDKAKAVNMPNDNIKRAI
Y025_BORHD      MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIDSNPRLRLAINKARVSNMPKDNIEKAI
Y508_HAES1      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDVGANPRLRAAVDKALSNNMTRDTINRAI
Y3062_XANP2     MAGHSQFKNIMHRKGRQDAMRSKLFSKLAREITVSAKMGLPDPNMNXXXXXXXXXXXXENMPKDNIERAI
Y1763_HAES2     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDVGANPRLRAAVDKALSNNMTRDTINRAI
Y056_LEPBP      MSGHSKWATIRRKKGAIDAKRGAIFTRIAKEISVAAKEGGGDQEGNPRLRLAVTKAKAANMPKDNIERAI
Y056_LEPBA      MSGHSKWATIRRKKGAIDAKRGAIFTRIAKEISVAAKEGGGDQEGNPRLRLAVTKAKAANMPKDNIERAI
Y501_HYDS0      MAGHSHWAQIKHKKAKVDAQKGKLFGKLIREITVATKLGGPDPNANPRLRIAIEAARKVSMPMDTIEKAI
Y1214_PSEPK     MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGGPDPASNPRLRLALDKALGANMSRDIIDRAV
Y3099_BORPD     MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGPDPDSNPRLRMAWDKATDANMPKDNIQRAI
Y1910_MYCMO     MAGHSKWANIKHRKGAQDAARSKIFMKLSKEIFVAASPGGADPETNPSLRLAVSKAKAQSMPKANIEKAL
Y1596_EDWI9     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
Y1228_ANAVT     MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIILAARSGIPDPSGNFQLRTAIDKAKAAGIPNDNIERAI
Y5651_NOSP7     MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIIVAARSGVPDPALNFQLRTAIDKAKAASIPNDNIERAI
Y1554_LISMF     MSGHSKWNNIQGRKNAQDSKRSKVFQKLAREIFVAAKKGP-DPNLNPSLRLVMDKAKAVNMPNDNIKRAI
Y1088_IDILO     MAGHSKWSNIKHRKAAQDAKRGKIFTKLIREITVSAREGGGDPETNPRLRAAIDKALSNNMKRDTIDTAV
Y210_NITEU      MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGGGDPNSNPRLRLAMDKAFGHNMPKDNVERAI
Y1663_CORGL     MSGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGGGDPSANPTLDDMIKKAKKASVPNDNIERAR
Y1210_ACTP7     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRSAVDKALSNNMTRDTINRAI
Y1151_ACTP2     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRSAVDKALSNNMTRDTINRAI
Y444_DEHE1      MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPEGNARLRLAIQKAKDNRMPSDNIERAI
Y2620_WOLWR     MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPELNPRLRSAIFAARKENLPKDKIETAI
Y2507_CLOPH     MSGHSKFANIKHKKEKNDATKGKIFTRLGREIAVAVKEGGPDPNNNNKLKDIVAKAKANNMPNDTIDRSI
Y1171_ACTPJ     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRSAVDKALSNNMTRDTINRAI
Y1155_BIFLI     MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEIAARLGGGDPDGNPSLYDAIYKAKKASMPADNIARAV
Y624_MYCPU      MAGHSKWANIKHRKGAQDAARAKIFQKFAKEIYVAAVAGGPDVDSNPALRLAVNKAKSKSMPKVNIEKAI
Y2779_SERP5     MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAAKLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y1708_CORGB     MAGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGGGDPSANPTLDDMIKKAKKASVPNDNIERAR
Y1113_PROMH     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAVDKALSNNMTRDTLNRAI
Y943_HAEPS      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDTSSNPRLRAAVDKALSNNMTRDTINRAI
Y893_FINM2      MSGHNKWSKIKNKKGSEDARRGKIFTKMARAITVAVREGGADPEYNPSLKSVIEKARAENMPNDNIDRAI
Y4926_HAHCH     MAGHSKWANIKHRKASQDAKRGKIFTKLIREITVAAKNGAL-PEDNPRLRAVIDKALTVNMKKDTIEKAI
Y4276_ANASP     MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIILAARSGVPDPSGNFQLRTAIDKAKAAGIPNDNIERAI
Y3525_NITHX     MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPXXXXXXXXXXXXXXXXXXPKDNIERAI
Y2138_FRAAA     MSGHSKWATTKHKKAVIDARRGKLFAKLIKTVEVAAKTGGGDPAGNPTLADAIAKAKSQSVPNDNIERAV
Y905_COPPD      MSGHSKWHNIKAKKSKMDAQRGKIFTKLTRELVIAAREGGPNPDTNLRLRVAIDKARAANMPKDNIDKAI
Y1368_FRASC     MSGHSKWATTKHKKAVIDARRGKLFAKLIKTVEVAAKTGGGDPAGNPTLADAIAKAKSQSVPNDNIERAV
Y1135_THETN     MAGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPETNSKLKLAIERAKAFNLPSENIQRAI
Y484_WOLPM      MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPELNPRLRSAIFAARKENLPKDKIETAI
Y3338_CLOB6     MSGHSKWHNIQAKKGKVDAKRGKIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y3132_CLOBL     MSGHSKWHNIQAKKGKVDAKRGKIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y2466_CLOBM     MSGHSKWHNIQAKKGKVDAKRGKIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y1421_CORA7     MAGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGGGDPAANPTLDDMIKKAKKASVPNDNIERAR
YEEN_SALAR      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
Y5948_SOLUE     MSGHSKWATIKHKKAATDAKRGRAFTRLIKEITIAARNGG-DPDGNPRLRSAILAAKNVSMPSDNIKKAI
Y5500_RHOBA     MAGHSKWANIQHRKGRVDAQRGKMWSKLSKAIIVSAKMGGGDPSLNIRLRKAIDDAKAVSMPKDNIERAI
Y3478_CLOBJ     MSGHSKWHNIQAKKGKVDAKRGKIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y2422_BORPA     MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRMAWDKATDANMPKDNIQRAI
Y2308_BORPE     MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRMAWDKATDANMPKDNIQRAI
Y2207_BORA1     MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRLAWDKATDANMPKDNVQRAI
Y1871_BORBR     MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRMAWDKATDANMPKDNIQRAI
Y1318_RUBXD     MSGHSKWSTIKRKKGAMDAKRGALFAKLSRAITVAAREGGGDPEANPALALAVQKAKDANMPNDNIQRAI
YEBC_ECOUT      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNNMTRDTLNRAI
YEBC_ECOL6      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNNMTRDTLNRAI
YEBC_ECOL5      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNNMTRDTLNRAI
YEBC_ECO57      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNNMTRDTLNRAI
Y543_LEPBJ      MSGHSKWATIKRKKDAIDSKRGAIFTRVGKEITVAAKMGGGDPEGNPRLRLAILKAKSVNMPKDNIERAI
Y542_CHLPB      MSGHSKWATIKRKKAATDQKRGNLFTKLVREITIAAKTGGGDPGGNPRLRLAIDTAKMNSMPNDNIQRAI
Y525_CHLP8      MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGGDPSGNPRLRLAIDTARANSMPMDNIQRAI
Y5147_FRASN     MSGHSKWATTKHKKAVVDARRGKLFAKLVKTVEVAAKTGGGDPAGNPTLADAIAKAKSQSVPNDNIERAI
Y3102_CLOB1     MSGHSKWHNIQAKKGKVDAKRGKIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y3073_CLOBH     MSGHSKWHNIQAKKGKVDAKRGKIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y2537_LEPBL     MSGHSKWATIKRKKDAIDSKRGAIFTRVGKEITVAAKMGGGDPEGNPRLRLAILKAKSVNMPKDNIERAI
YEBC_SHISS      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
YEBC_SHIFL      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
YEBC_SHIBS      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
YEBC_SALCH      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANNMTRDTLNRAI
YEBC_ECOLI      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
Y479_MAGSM      MAGHSKWANIKHRKGAQDAKRGKIFTRLIKEITVSARMGGGDAATNPRLRSAITAARAQNLPKDTMDKAI
Y1378_ENTS8     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNNMTRDTLNRAI
Y561_HERAR      MAGHSKWANIQHRKGRQDEKRGKIWTRLIKEITVAARMGGGDIAANPRLRLAVDKAADANMPKDNVTRAI
Y2347_LARHH     MAGHSKWANIQHRKGRQDAKRGKIFTRLIKEITVAAKMGGADLGSNPRLRLAVDKAKAESMPKDNIENAI
Y2237_THISH     MAGHSKWANIQHRKNAQDAKRGKLFTKLIKEITVAARMGGSDLNSNPRLRLAVDKALDANMTKDTVERAI
Y2109_PHOLL     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAIDKALSNNMTRDTLNRAI
Y1967_POLSJ     MAGHSKWANIQHRKGRQDEKRQRVWTRVMREIMVAARMGGGDLGTNPRLRLAVDKAKAANMPADNVKYGI
YEBC_SHIDS      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
YEBC_SALTY      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANNMTRDTLNRAI
YEBC_SALTI      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANNMTRDTLNRAI
YEBC_SALPA      MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANNMTRDTLNRAI
Y1097_CITK8     MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAI
Y2424_YERPG     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y2395_YERE8     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y2097_YERPB     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y2055_YERPE     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y2038_YERPS     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y2033_YERP3     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y1532_YERPN     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y1525_CARHZ     MAGHSKWANIKHRKEKMDSLRGKVFTKLAREIMVAARLGGGDPEANPRLKAAIARAREANIPNENIQRAI
Y1437_YERPA     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y1067_YERPP     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y2146_YERPY     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNNMTRDTLNRAI
Y6832_STRAW     MSGHSKWATTKHKKAVIDAKRGKLFAKMIKNIEVAARTGGADPAGNPTLFDAIQKAKKSSVPNKNIDSAV
Y480_ANAPZ      MAGHSQFANIKHRKGAQDAKRAKLFTKLRKEIIVAARSGSPVPELNPNLRSAIASAKAFNLPKDRIEAAI
Y2343_KLEP7     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNNMTRDTLNRAI
Y1989_BEUC1     MSGHSKWATTKHKKAVIDARRGKLFAKLIKNIEVAARTGGGDPAGNPTLYDAIQKAKKTSVPNDNIDRAV
Y1906_KLEP3     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNNMTRDTLNRAI
Y1113_PHOPR     MAGHSKFANIKHRKAAQDSKRGKIFTKLIREIIVATKDGGPEAENNPRLRAAVDKALSNNMTRDTINRAV
Y2909_BACLD     MAGHSKWKNIQRRKNAQDAKRGKIFMKLAKEIYVAAKEGGPDPESNASLRLVIDKAKNANMPNDNIDRAI
Y2034_ARTCA     MSGHSKWATTKHKKAIIDSRRAKSFAKLIKNIEVAARMGGPDLAGNPGLELAVTKAKKTSVPNDNIDRAI
Y624_AMOA5      MAGHSKWANIKHRKGANDAKKAKYFGKLIREITAAVKQSGNDIEVNPRLRLAIQNAKGANMPKENIDRAI
Y2072_AZOSE     MAGHSKWANIQHRKGRQDAKRGKVFTKLIKEITVAARMGGGDPNFNPRLRLAVDKAKAENMPSENIDRAI
Y1471_OPITP     MAGHNKWSKVKRLKAVTDARKGKVFSRLSRDITLAAKAGGGDPNGNARLRTLLLKARDANMPADNVDRAV
Y1057_CORJK     MAGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGGGDPSANPTLQDAITKAKKSSVPNDNIERAR
Y768_OENOB      MSGHSKWHNIQGRKNAQDAKRGKIFQKISHDLYVAAKAGGADPSANASLRLVMDKAKAANMPKDNVQRAL
Y694_ANAMM      MAGHSQFANIKHRKGAQDAKRSKVFTKLRKEIIIAARSGPPTPDLNPRLRAAIASAKAENLPKDKIEAAI
Y1328_PARUW     MAGHSKWANIKHRKGKADAKKGKIFSRIAKEIISAVKLGGADQKNNPRLRLALQKARDANMPNENIDRNI
Y1249_LEGPL     MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNANMKRDTIDNAV
Y4347_CYAP4     MAGHSKWANIKRQKARVDAKKGAVFARLSRAIIVAARHGIPDPEGNFQLRSAIEKAKAAGIPNDNIERAI
Y1479_PSYCK     MAGHSKWANIKHRKARQDAVKGKVFTKIIREIVSAAKQGDPDPDKNPRLRAVIEKALSVNMTRDTINRAV
Y1286_LEGPH     MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNANMKRDTIDNAV
Y838_CHLFF      MAGHSKWANTKYRKERADHKRGKIFSRTIKELISAVKMGGPDPKTNARLRVIIQKAKDQNIPSENIERNL
Y711_LEGPC      MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNANMKRDTIDNAV
Y574_AZOSB      MAGHSKWANIQHRKGRQDAKRGKVFTKLIKEVTVAAKMGGGDPNANPRLRLAIDKAKAESMPKDNIENAI
Y472_MYCH2      MAGHSKWANIKHRKGAQDALKAKIFNKFSKEIMVAVAKGGSDPNSNPALRLIISKARAKSMPKSNIEKAI
Y1249_LEGPA     MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNANMKRDTIDNAV
Y938_PSYA2      MAGHSKWANIKHRKARQDAVKGKVFTKIIREIVSAAKQGDPDPDKNPRLRAVIEKALSVNMTRDTINRAV
Y6014_STRGG     MSGHSKWATTKHKKAVIDAKRGKLFAKLIKNIEVAARSGGVDPDGNPTLVDAIQKAKKSSVPNKNIESAV
Y4410_PSEPF     MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGANMSRDIIDRAV
Y2355_METFK     MAGHSKWANIQHRKGRQDAKRGKIFTKLIKEITVSARMGGGDVNFNPRLRAAVAEAKEQNMPAENIIRAI
Y2253_LACPL     MSGHSKWHNIQGRKNAQDAKRGKVFQKISRELYMAVKAGGPDPDSNAQLRLVMDKAKAANMPKDNIKRAV
Y1902_NEIMA     MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENNMPKDNVQRAI
Y1648_NEIMB     MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGSNPRLRLALEKAAENNMPKDNVQRAI
Y1563_NEIMF     MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENNMPKDNVQRAI
Y1508_NEIG2     MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENNMPKDNVQRAI
Y1487_ERWT9     MAGHSKWANTKHRKAAQDAKRGKIFTKVIRELVTAAKLGGGDAGSNPRLRAAMDKALANNMTRDTMNRAI
Y1291_NEIG1     MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENNMPKDNVQRAI
Y1819_CLONN     MSGHSKWHNIQAKKGKNDAAKGRIFTKIGRELILAARDGGSNPDTNAKLRDVIAKAKAANMPNDTIDRAI
Y709_AKKM8      MSGHNKWSKIKYVKAKEDAKKGKVFARFAHEIMLAAKSGGGDPDLNPRLRAAIDGAKAVSTPKENIERAI
Y541_LACF3      MSGHSKWHNIQGRKNAQDAKRGKIFQKISRDLYQAAKAGDPDPDNNPQLRLVMDKARAANMPKQNIQRAI
Y521_ACIC5      MSGHSKWATIKHKKGALDAKRGKIFTRLIKEITISARAGG-DPDGNPRLRTAIAAAKAENMPQDNIKRAI
Y2866_ENTFA     -----KWANIKEKKAAKDANNSRVYAKFGIEIYVAAKSGDPDPHANQKLRFVIERAKTYNVPKHIIDRAI
Y2432_ENT38     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDAGSNPRLRAAIDKALANNMTRDTLNRAI
Y166_CHLAB      MAGHSKWANTKYRKERADHKRGKIFSRTIKELMAAVKMGGPDPKTNARLRMIIQKAKDQNIPNENIERNL
Y1259_SODGM     MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDVGSNPRLRAAVDKALANNMTRDTLNRAI
Y474_MYCH7      MAGHSKWANIKHRKGAQDALKAKIFNKFSKEIMVAVAKGGSDPNSNPALRLIISKARAKSMPKSNIEKAI
Y4390_HAEIG     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRAAVDKALSNNMTRDTINRAI
Y433_HAEI8      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRAAVDKALSNNMTRDTINRAI
Y315_HAEIN      MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRAAVDKALSNNMTRDTINRAI
Y1480_HAEIE     MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRAAVDKALSNNMTRDTINRAI
Y025_BORT9      MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIESNSRLRLAVNKARVSNMPKDNIEKAI
Y739_SYNAS      MSGHSKWSTIKRKKGAIDSKRGKIFTKIIKEITLAARLGGGDTEGNSRLRQAILAAKNENMPRDNIDRAI
Y454_THEP1      MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPRLRAAVEKARAENMPKENIERAI
Y2075_CLOTH     MAGHSKWANIKHKKQKTDAQKGKIFTKIGREIAIVVKQGGPDPEVNSKLKDVIAKAKAANMPNETIMRSI
Y1776_COREF     MAGHSKWATTKHKKAANDAKRGKEFAKLVKNIEVAARMGGGDPSANPTLDDMIKKAKKASVPNDNIERAR
Y471_MYCHJ      MAGHSKWANIKHRKGAQDALKAKIFNKFSKEIMVAVAKGGSDPNSNPALRLIISKARAKSMPKSNIEKAI
Y1179_DICNV     MAGHSKWANIKHKKAKEDAKRGKIFTRLIRELTVAARHGGSDINANPRLRLAVSKAQAENMTKETMERAI
Y3085_DESMR     MAGHSKWHNIQARKSVQDAKKSKFFTKVTKELMLAARAGGADTALNQRLKSAIAAAKAVNLPKDKIDQAI
Y2002_RENSM     MSGHSKWATTKHKKAVIDGRRAKSFAKLIKNIEVAARVGGPDMAGNPALELAVTKAKKTSVPNDNIDRAI
Y1640_SYNP2     MAGHSKWANIKRQKARVDAKKGKTFTQLSRAIIVAARHGLPDPAGNFQLRTAIEKAKAAGIPNENIERAI
Y1350_SYNJB     MAGHSKWANIKRQKARVDAKKGSLFTKLSRAIIVAARNGLPDPDGNFQLRAAVEKAKAAGMPSENIERAI
Y4766_PSEF5     MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAARQGGGDPNSNPRLRLALDKALGANMSRDIIDRAI
Y4544_PSEA7     MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAAKQGGGVPADNPRLRLAVDKALTANMTRDTIDRAI
Y1570_LISIN     MAGHSKWNNIQGRKNAQDSKRSKVFQKLAREIFVAAKKGP-DPNLNPSLRLVMDKAKAVNMPNDNIKRAI
Y030_BORDL      MSGHSKWSTIKRKKGTLDAKRNKIFTKLIREISIAARMGGGDIDSNPRLRLAVNKARVANMPKDNIEKAI
Y029_BORRA      MSGHSKWSTIKRKKGTLDAKRNKIFTKLIREISIAARMGGGDIDSNPRLRLAVNKARVANMPKDNIEKAI
YRBC_BACSU      MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGGADPEANSALRLVIEKAKGANMPNENIDRAI
Y377_EHRRW      MAGHSQFANIKHRKGAQDAKRAQKFTKLIREIIVATKQGLPDPEFNSRLRSAIITAKKENLPKDRIDAAI
Y372_EHRRG      MAGHSQFANIKHRKGAQDAKRAQKFTKLIREIIVATKQGLPDPEFNSRLRSAIITAKKENLPKDRIDAAI
Y2507_GLOVI     MAGHSKWAQIKRQKAKNDVAKGAMFARLSREIIVATRLGGPDPAGNFRLRLAIEQAKAASLPGENIQRAI
Y2300_ARTAT     MSGHSKWATTKHKKAIIDGRRAKSFAKLIKNIEVAARMGGPDLAGNPGLELAVTKAKKTSVPNDNIDRAI
Y2259_SYNJA     MAGHSKWANIKRQKARVDAKKGSLFTKLSRAIIVAARNGLPDPDANFRLRSAVEKAKAAGMPAETIERAI
Y1522_AERHH     MAGHSKWANIKHRKAAQDAKRGKIFTKLIREITTSARLGDADPANNPRLRAAVAAALTGNMTRDTINRAI
Y1521_STRCO     MSGHSKWATTKHKKAVIDAKRGKLFAKLIKNIEVAARMGGVDIEGNPTLYDAIQKAKKQSVPNKNIDSAV
Y1301_BURPP     MAGHSKWANIKHKKAAADAKRGKVWTRLIKEIQVAARMGGGDIDSNPRLRLAVEKAYDANMPKDNVNRAI
Y807_PETMO      MSGHNKWANIKHRKGAQDAKRSQMFTKLIRELTIAAREGGGDPESNPRLRTAVENAKAANMPKDKIESAI
Y2295_CLOAB     MSGHSKWHNIQXXXXXXXXXXXXVFTKIGKEIAVAVKTGGANLDANSKLRDCVAKAKAANMPMDTINRAI
Y964_PSEAE      MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAARQGGGVPADNPRLRLAVDKALTANMTRDTIDRAI
Y704_EHRCR      MAGHSQFANIKHRKGAQDAKRAQKFTKLIREIIVAAKQGLPDPEFNSRLRSAIIAAKKENLPKDRIDAAI
Y5181_PSEAB     MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAARQGGGVPADNPRLRLAVDKALTANMTRDTIDRAI
Y475_CHLL2      MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITISAKMGGGDPSGNPRLRLAVDTARANSMPMDNIQRAI
Y4350_PSEA8     MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAARQGGGVPADNPRLRLAVDKALTANMTRDTIDRAI
Y385_LISMF      -----KWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHANQKLRFVIERAKTYNVPKHIIDRAI
Y169_CHLCV      MAGHSKWANTKYRKERADHKRGKIFSRTIKELMAAVKMGGPDPKTNARLRVVIQKAKDQNIPNENIERNL
Y1533_BRAHW     MSGHSKWASIKHKKAANDSKKGKIWSKIAKEITIAVKEGGSDPDQNARLRMVIVKAKGTNMPNDNIDRAI
Y1013_PSYWF     MAGHSKWANIKHKKAKEDAKRGKIFTKIIRELVSATKQGDPDPESNPRLRAAVEKALSANMTKDTIKRAI
Y1245_GEOLS     MSGHNKWSTIKHKKGAADAKRGKIFTKIIKEISVAAKLGGGDPAANPRLRTAIDKAKGENMPKDNIERAI
Y715_CLAMS      MSGHSKWATTKHKKAIIDSRRAKSFAKLIKNIEVAAKIGGADMSGNPTLVDAVQKAKKTSVPNDNIDRAV
Y657_PELPB      MSGHSKWATIKRKKAVTDQKRGSLFTKLVKEITIAAKMGGGDPAGNPRLRLAIDTARDNSMPMDNIQRAI
Y2304_ARTS2     MSGHSKWATTKHKKAILDSRRAKSFAKLIKNIEVAARMGGPDLAGNPSLELAVTKAKKTSVPADNIDRAI
Y1185_BURXL     MAGHSKWANIKHKKAAADAKRGKVWTRLIKEIQVAARMGGGDIDSNPRLRLAVEKAYDANMPKDNVNRAI
Y536_DESDA      MAGHSKWANIQHRKGRQDAKRGKLFTXXXXXXXXXXXXXX-DPSMNPRLRXXXXXXXXVNLPKDKIEAAI
Y3259_BACHD     -----KWNNIKEKKAAKDKNTSRIYAKFGREIYVAAKQGEPDPELNQALKFVLERAKTYNVPKAIIERAI
Y2383_NOCSJ     MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEIAAKMGGPDPAGNPTLYDAIQKAKKQSVPNKNIDSAV
Y795_CLOD6      --------NIINRKGKQDAQRAKIFTKHARAIAVAAKEGGADPEYNAALKTAIEKAKADNMPNDNIDRXX
Y720_LEPIN      MSGHSKWATIKRKKDAIDSKRGAIFTRVGKEITVAAKMGGGDPEGNPRLRLAILKAKSVNMPKDNIERAI
Y351_EHRCJ      MAGHSQFANIKHRKGAQDAKRAQRFTKLIREIIVSAKQGLPDPEFNSRLRSAIIAAKKENLPKDRIDAAI
Y2886_LEPIC     MSGHSKWATIKRKKDAIDSKRGAIFTRVGKEITVAAKMGGGDPEGNPRLRLAILKAKSVNMPKDNIERAI
Y2325_DESDG     MAGHSKWKNIQHRKGRQDAKKSKAFTKVAKEIIIAAK-GGGDPVANSRLRXXXXXXXXVNLPKDKIETAI
Y175_THEEB      MAGHSKWANIKRQKARVDAQKGKXXXXXXXXXXXXXXHGGGDPAGNFQLRSAIEKAKAAGIPSENIERAI
Y6870_RHOOB     MSGHSKWATTKHKKAVIDAKRGKAFAKLIKNIEVAARTGGGDPAGNPTLYDAIQKAKKTSVPNDNIXXXX
Y2548_DEIRA     MAGHSKWAQIKRKKGANDKKRSAMYSKHIRAIQAAVRSGGSDPAGNLSLKNAIAAAKTDTVPADNIENAI
Y2520_RICCK     MAGHSKFKNIQYRKGAQDKKRAKIFTKLIREIVTAAKTGSSNPENNPRLRNALTAARSQNLPKERIDKAI
Y1845_CHRSD     MAGHSKWANIKHRKAAQDAKRGKIFSKLIRELTVASRQGGGEVADNPRLRAAIDKALANNMTKDTIQRAI
Y1817_CLAM3     MSGHSKWATTKHKKAIIDSRRAKSFAKLIKNIEVAAKIGGADMSGNPTLVDAVQKAKKTSVPNDNIDRAV
Y1214_WOLPP     MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLTDPELNPRLRSAIFSARKENLPKDKIETAI
Y462_UNCTG      MSGHNKWASIKHKKTATDVKKGKVFTKIIREIVVATKESGAQIENNARLRKAIEDAKEANMPQDNIKKAI
Y3123_CHRVO     MAGHSKWANIQHRKGRQDAKRGKIFTRLIKEITVAAKMGGGDANMNPRLRLAVDKAKAESMPKDNIENAI
Y2038_OCEIH     MAGHSKWKNIQKRKNAQDAKKGKIFMRHAKDIYIAAKQGGGDLGTNAALRTAVEKAKADNMPNDNIDRNI
Y165_CHLCH      MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGGDPTGNPRLRLAIDTARSNSMPMDNIQRAI
Y750_ALCBS      MAGHSKWANIKHRKAAQDAKRGKIFTKLIRELTVAAKMGGGEPNDNPRLRAAIDKALGQNMTRDTIDRAV
Y1779_SALAI     MSGHSKWATTKHKKAVIDAKRGKMFAKLIKNVEVAARTGGGDPAGNPTLYDAIQKAKKNSVPNDNIDRAV
Y6891_RHOSR     MSGHSKWATTKHKKAVIDAKRGKAFAKLIKNIEVAARTGGGDPAGNPTLYDAIQKAKKTSVPNDNIXXXX
Y388_LISIN      -----KWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQKLRFVIERAKTYNVPKHIIDRAI
Y369_LISMO      -----KWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQKLRFVIERAKTYNVPKHIIDRAI
Y2940_MYCS2     MSGHSKWATTKHKKAVIDAKRGKMFAKLIKNIEVAARVGGGDPGGNPTLYDAIQKAKKSSVPNDNIXXXX
Y2888_MYCA9     MSGHSKWATTKHQKAVKDARRGKEFAKLIKNIEVAARTGGGDPAGNPTLYDAIQKAKKTSVPNDNIXXXX
Y2280_BURM1     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVSSNPRLRLAVDKAADANMPKDNVKRAI
Y2018_SACEN     MSGHSKWATTKHKKAALDAKRGKLFAKLIKNVEVAARTGGGDPDGNPTLYDAIQKARKNSVPQDNIXXXX
Y1157_PROAC     MSGHSKWATTKHKKAAIDAKRGKLFARLIKNIEVAARLGGGDPSGNPTLYDAIQKAKKSSVPNDNITRAV
Y635_GEMAT      MAGHSKWKTIKRAKAATDNKRGALFTRLIREITMAAKLGGGDAGGNPRLRTAIDNAKAVSMPKDNIDRAI
Y2432_SHEON     MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVSAREGGSDPDSNPRLRIAIDKALGGNMTRDTIERAI
Y1778_ALKOO     -------------KSKQDAKKAKIYTKLARVISVAAREGGGDVEYNAALKNAIDKAKLQNMPNDNIDRAI
Y1132_THERP     MAGHSKWAQIKRQKQAADFRKGQIFSKLAREIHVAVREGGPNPETNVRLRMAIERARREGMPKDTIENXX
Y1074_GEOSL     MSGHNKWSTIRHKKGAADAKRGKVFTKLIKEITVAAKIGGGDPNGNPRLRAAVDKAKAENMPKDNIERAI
Y754_BACLD      -----KWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPELNQNLKFVLERAKTYNVPKAIIERAI
Y1961_EUBR3     MSGHSKFANIKHKKEKNDAAKGKIFTMIGRELAVAVKEGGPDPANNFKLAQVVAKAKANNMPNDTIERGI
Y3092_BURM9     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y2875_BURMS     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y2858_BURM7     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y1884_BURMA     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y1385_BURP1     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y1240_BURP0     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y1231_BURP6     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y1165_BURPS     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNSNPRLRLAVDKAADANMPKDNVKRAI
Y573_CHLPN      MAGHSKWANTKHRKERADHKKGKIFSRIIKELISAVKLGGADPKSNARLRMVIQKAKXXXXXXXXXXXXL
Y3702_NOCFA     MSGHSKWATTKHKKAAIDAKRGKLFAKLIKNIEVAARTGGGDPEGNPTLYDAIQKAKKSSVPNDNIXXXX
Y2922_RHOE4     MSGHSKWATTKHKKAVIDARRGKSFAKLIKNIEVAARTGGGDPTGNPTLYDAIQKAKKTSVPNDNIXXXX
Y2714_TOLAT     MAGHSKWANIKHRKAAQDAKRGKMFTKMIREITTAARLGGPDGGSNPRLRAAVAAALSINMTRDTVDRAI
Y1643_PELLD     MSGHSKWATIKRKKAVTDQKRGSLFTKLVKEITIAAKMGGGDPSGNPRLRLAIDTARSNSMPMDNIQRAV
Y1378_CORDI     MSGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGGGDPSANPTLDDMIKKAKKASVPNDNIERAR
Y1467_CLOBK     MSGHSKWHNIQXXXXXXXXXXXXIFTKIGKEIVVAVKQGGPSADSNPRLRDVIAKAKANNMPNDTIERSI
Y1032_CORK4     MSGHSKWATTKHKKAANDAKRGKEFAKLIKNIEVAARTGGGDPSANPTLDDMIKKAKKASVPNDNIERAR
Y989_SYNY3      --GGRKWQSIKRQKARVDAQKGKTTTQLSRAIIVAARQGIPDPAGNFQLRTAIEKARAAGVPNDSIDRAI
Y2096_THEFY     MAGHSKWATTKHKKAVIDARRGKLFAKLIKNIEVAARTGGGDPDGNPTLYDAIQKAKKNSVPLDNIXXXX
Y1792_SALTO     MSGHSKWATTKHKKAVIDAKRGKMFAKLIKNVEVAARTGGGDPAGNPTLYDAIQKAKKNSVPNDNIDRAV
Y1786_CHLT3     MSGHSKWATIKRKKAATDQKRGKLFTKLVKEITISARMGGGDPDGNPRLRLAIENARANSMPAENIKRAV
Y985_THEM4      MSGHNKWANIKHRKAAQDAKRSKIFTKLIREIIVAAREGGGDPETNPRLRAVIERARAANMPKDTIEKSI
Y2635_MYCBO     MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y2631_MYCTA     MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y2628_MYCBP     MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y2622_MYCBT     MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y2603_MYCTU     MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y1615_DICTD     MSGHSKWANIKHRKAAADAKKGKLFSQLSKEIIIAAKHGGGNPETNPXXXXXXXXXXXXNMPKENIEKAI
Y1346_ACIC1     MSGHSKWATTKHKKAVIDARRGKLFAKLIKNIEVAARVGGPDPNGNPTLADAIAKARDQSVPNDNIERAI
Y2570_MYCVP     MSGHSKWATTKHKKAVIDARRGKMFAKLIKNIEVAARTGGGDPAGNPTLFDAIQKAKKSSVPNDNIERAR
Y1199_LACBA     MSGHSKWHNIQGRKNAQDAKRGKIFQKISRDLYQAAKAGGPDPDGNPQLRLEMDKARAANMPKENIKRAL
Y743_BACP2      -----KWNNIKEKKASKDASTSRIYAKFGREIYVAAKQGEPNPESNQALRFVLERAKTYSVPKHIVDRAI
Y560_NITSB      MAGHNKWSKVKHIKAKEDAKKGKVFTKAVRDIMTAVRDGGPNPDTNAALRLAIERAKAVSMPQDNIKRAI
Y1024_PELTS     MSGHSKWSTIKRKKAKVDAQRGKIFTRLAREIIVAARQGGGDPESNVRLKAAIQRAKEANVPNENIMRAI
Y1015_BURTA     MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDANSNPRLRLAVDKAADANMPKDNVKRAI
Y3057_KINRD     MSGHSKWATTKHKKAVVDAKRAKSFARLIKNIEVAARTGGGDVSGNPTLFDAIQKAKKTSVPADNIDRAV
Y271_MYCA5      MSGHSKWATTKNHKFAQDAKRSKMFQKFSKEIIVAATLGGADPDSNPXXXXXXXXXXXXSMPKANIEKAI
Y1704_MOOTA     MSGHSKWANIKNRKAKVDEKRGRLFTKIGREIIIAARMGGGDPEGNMRLXXXXXXXXXXNMPNENIQRAI
Y2054_STAS1     -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPDPESNQALRLTLERAKTYSVPNHIIEKAI
Y670_WOLTR      MAGHSQFSNIKYRKGAQDAKRSQRFTKLIREITVAAKQGLPDPEFNPRLRSAVFAARKENLPKDRIETAI
Y2843_AERS4     MAGHSKWANIKHRKAAQDAKRGKIFTKLIREITTSARIGDPDPANNPRLRAAVTAALTSNMTRETINXXX
Y1956_BACSK     -----KWNNIKEKKASKDANTSRIYAKFGREIYVAARQGEPDPELNQALKAVLERAKTYNVPKSIIDRAI
Y1658_DESRM     MSGHSKWSTIKRKKAKIDSQRGKVFTKLSKEIIIAARNGGADPNGNMRLXXXXXXXXXXXXPNDNIQRAI
Y3481_MYCA1     MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y3629_DESHD     MSGHSKWANIKHKKAKADAQKGKIFTKLGRELIVAARAGGGDPNNNFRLKIAIDNAKSANMPNDNIQRAI
Y2470_DESHY     MSGHSKWANIKHKKAKADAQKGKIFTKLGRELIVAARAGGGDPNNNFRLKIAIDNAKSANMPNDNIQRAI
Y2225_STAHJ     -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPDPESNQALRLVLERAKTYSVPNHIIDRAI
Y1423_PROMM     MAGHSKWSQIKRSKAVVDAKRGAVFTRLAREISVAARSGG-DPNGNFQLRTAINKAKAARMPAANIERAI
Y940_XYLF2      --------SIEARKNASDSKRGKIFTKIIRQIGVAARAGGGDPSNNPSLRVVIDKALASNMSKDVIERAI
Y885_XYLFT      --------SIEARKNASDSKRGKIFTKIIRQIGVAARAGGGDPSNNPSLRVVIDKALASNMSKDVIERAI
Y626_NAUPA      MAGHNKWSKVKHIKAKEDAKKSKIFTKHVRAIMTAARQGGGNPDTNAALRLAVERAKADSMPMQNIQRAI
Y2298_MYCSK     MSGHSKWATTKHKKAIIDARRGKNFAKLIKNIEVAARTGGGDPGGNPTLYDAIQKAKKSSVPNDNIXXXX
Y2290_MYCSJ     MSGHSKWATTKHKKAIIDARRGKNFAKLIKNIEVAARTGGGDPGGNPTLYDAIQKAKKSSVPNDNIXXXX
Y2251_MYCSS     MSGHSKWATTKHKKAIIDARRGKNFAKLIKNIEVAARTGGGDPGGNPTLYDAIQKAKKSSVPNDNIXXXX
Y933_CORU7      MAGHSKWETTKRKKAAIDAKRGKEFARLVKNIEVAARMGGGDPDANPTLQDAITKAKKSSVPNDNIERAR
Y742_CHLMU      MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGGPDPKSNARLRMIIQKAKDQNIPNENIERNL
Y717_CHLT2      MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGGPDPKSNARLRMIIQKAKDQNIPNENIERNL
Y713_CHLTB      MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGGPDPKSNARLRMIIQKAKDQNIPNENIERNL
Y538_PROM3      MAGHSKWSQIKRSKAVVDAKRGAVFTRLAREISVAARSGG-DPNGNFQLRTAINKAKAARMPAANIERAI
Y499_CHLTA      MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGGPDPKSNARLRMIIQKAKDQNIPNENIERNL
Y457_CHLTR      MAGHSKWANTKHRKERADHKKGKIFSRTIKELISAVKMGGPDPKSNARLRMIIQKAKDQNIPNENIERNL
Y2132_SYNSC     MAGHSKWSQIKRTKAVVDAKRGAVFTRLGREIMVAARAG-ADPAGNFQLRTAISKARAAGVPASNIERAI
Y605_BACCQ      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y595_BACC1      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y504_TROW8      MSGHSKWATIKRKKAVNDAQRSKNFAKLIRLIEVAAKQGGPDLAGNPGLAEAVQKAKKNSVPNDNIDRAI
Y266_TROWT      MSGHSKWATIKRKKAVNDAQRSKNFAKLIRLIEVAAKQGGPDLAGNPGLAEAVQKAKKNSVPNDNIDRAI
Y469_THESQ      MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPXXXXXXXXXXXXNMPKENIERAI
Y1906_XYLFA     --------SIEARKNASDSKRGKIFTKIIRQIGVAARAGGGDPSNNPSLRVVIDKALASNMSKDVIERAI
Y1693_EXIS2     -----KWNNIKEKKASKDKNTSRVYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPRAIVDRAI
Y1075_LEIXX     MSGHSKWATTKHKKAVIDARRAKSFAKLIKNIEVAAKIGGADLSGNPTLVDAVQKAKKTSVPNDNIDRAI
Y1030_MYCPA     MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y1935_KOSOT     MSGHNKWANIKHRKMAQDAKKSKIFTKIIRELMVAAREGGTDPNTNNXXXXXXXXXXXXNMPKDTMEKAI
Y1665_CHLTE     MSGHSKWATIKRKKAATDQKRGSLFTKLVKEITIAAKMGGGDPTGNPRLRLAIDTARANSMPMDNIQRAI
Y466_THEMA      MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPXXXXXXXXXXXXNMPKENIERAI
Y1847_ACAM1     MAGHSKWANIKRQKARVDAKKGKVFARLSRAIIVAARHGSADPNGNFQLRSAIDKAKAAGIPNENIDRAI
Y723_BACA2      -----KWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPKNIIERAI
Y615_BACC7      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y3246_MYCUA     MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y2098_MYCMM     MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIXXXX
Y542_SYNS9      MAGHSKWSQIKRTKAVVDSKRGALFTRLGREIMVAARAGS-DPAGNFQLRTAINKARAAAMPASNIDRAI
Y269_LAWIP      MAGHSKWANIQHRKGRQDAKRGKEFTXXXXXXXXXXXNGG-DPSGNPRLRAAIAAAKSINLPKDKIEAAI
Y2234_SYNS3     MAGHSKWSQIKRTKAVVDGKRGALFTRLGREITVAARNG-ADPNGNFQLRTAITKARSAGLPAGNIERAI
Y718_ROSCS      MSGHSKWHSIRRTKGVLDQRRGQLFTKLARDITIATREGGSDPEANFRLRLAVDKARAANMPMDNIQRAI
Y622_BACAA      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y578_BACC3      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y541_BACC0      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y541_BACAN      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y4974_MYXXD     MSGHNRWSKIKRQKAAMGATKGKLYSKVVKEITVASRLGGGEPSGNXXXXXXXXXXXXXNIPKDTIERAI
Y453_BACHK      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y449_BACCZ      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y4045_BACAC     -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y3030_HERA2     MSGHTKWHEIRRKKGVLDQRRGQRWTKIARDITIAAREGGGSPDMNFRLRLAIEKAKADNMPADNIQRAI
Y1059_XYLFM     --------SIEARKNASDSKRGKIFTKIIRQIGVAARAGGGDPYNNPSLRVVIDKALASNMSKDVIERAI
Y543_SYNPX      MAGHSKWSQIKRTKAVVDAKRGAVFTRLGREIMVAARDG-ADPSGNFQLRTAISKAKAAGVPAGNIERAI
Y465_BACCN      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPKSIIDRAI
Y1141_CHLSY     MSGHSKWHTIRRTKGVNDQRRGQLFTKLARDITIATREGGSDPDLNFRLRLAIEKARANNMPNENIQRAI
Y1043_CHLAA     MSGHSKWHTIRRTKGVNDQRRGQLFTKLARDITIATREGGSDPDLNFRLRLAIEKARANNMPNENIQRAI
Y1011_THELT     MSGHNKWANIKHRKMAQDAKKSQLFTKLIRELIVAAREGGGDPETNSRLRTAIEKAKEANMPRENIEKAI
Y394_RUTMC      MAGHSKWHNIQHRKGAQDAKRGKIFTKLIKEIVISAKIGGGRIENNHSLKIIIDKALAVNMRRNTIENAV
Y1898_ACISJ     MAGHSKWANIQHRKGRQDEKRGKIWTRIIREITVAARTGGGDPSANPRLRLAIDKAKAANMPADRIKYNI
Y4761_BACC2     -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y437_STAES      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQTLRLVLERAKTYSVPNHIIDRAI
Y322_STAEQ      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQTLRLVLERAKTYSVPNHIIDRAI
Y1358_MICAN     MAGHSKWANIKRQKARVDAKKGQTFTQLSRAIIVATRNGVPDPAGNFQLRTAIEKAKAAGIPNDNIERAI
YEEI_BACSU      -----KWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPKNIIERAI
Y3828_MYCGI     MSGHSKWATTKHKKAVIDARRGKNFAKLIKNIEVAARTGGGDPGGNPTLYDAIQKAKKNSVPNDNIXXXX
Y2594_CHLAD     MSGHSKWHTIRRAKSANDQRRGQLFTKLARDITIATREGGSDPELNFRLRLAIEKARANNMPNENIQRAI
Y577_BACC4      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y539_BACCR      -----KWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALRVVLERAKTYNVPRTIIDRAV
Y3980_PSESM     MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGANMTRDTIDRAV
Y3775_PSE14     MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGANMTRDTIDRAV
Y1833_SYNR3     MAGHSKWSQIKRTKAVVDAKRGAVFTRLGREISVAARAG-ADPDGNFQLRTAINKAKAAGVPAANIERAI
Y1407_PSEU2     MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGANMTRDTIDRAV
Y2259_DESVH     MAGHSKWANIQHRKGRQDAKRGKMFTXXXXXXXXXXXXGG-DPVGNSRLRXXXXXXXXXNLPKDKIENAI
Y986_DESVV      MAGHSKWANIQHRKGRQDAKRGKMFTXXXXXXXXXXXXGG-DPVGNSRLRXXXXXXXXXNLPKDKIENAI
Y4067_DECAR     MAGHSKWANIQHRKGRQDEKRGAAFSKIAKEITVASKMGGGDINFNPRLRVAVDKAKGVNMPKDKIDTAI
Y153_EXISA      -----KWNNIKEKKASKDANTSRVYAKFGREIYVAARQGEPDPELNQSLKFVVERAKTYNVPRAIIDRAI
Y529_SYNP6      MAGHSKWANIKRQKARVDAKKAQVFARLSRAMIVAARQGLPDPAANFQLRTAIEKAKAAGIPNDNIERAI
Y1481_BREBN     -----KWNNIKEKKASKDASTSRIYARFGKEIYVAAKQGEPDPESNRALKVVLERAKTYSVPKAIIDRAI
Y1291_MICLC     MSGHSKWATTKHKKAVIDARRAKAFAKYIKNIEVAARAGGPDVAGNPALDLAVSKAKKASVPNDNIDRAV
Y1017_SYNE7     MAGHSKWANIKRQKARVDAKKAQVFARLSRAMIVAARQGLPDPAANFQLRTAIEKAKAAGIPNDNIERAI
Y1004_SYMTH     -----KWENIKRSKAKLDQQRGATFSRITKDIMKAAREGGPDPETNFXXXXXXXXXXXXNMPNENIQRAI
Y6590_MYCAP     MAGHSHWAGIKHKKGANDAARGKIFQKMFKEIYVAATPGGTDPSSNPALRLAISKAKAKSMPKANIERAL
Y2125_TRIEI     MAGHSKWANIKRQKARVDAVKGKVFAKVSRQIIVAARSG-ADPAGNFQLRTAIEKAKTVGIPNDNIERAI
YEEN_SHISS      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_SHIFL      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_SHIBS      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_ECOUT      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_ECOLI      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_ECOL6      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_ECOL5      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
YEEN_ECO57      -----KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAI
Y2560_FLAJ1     ----------KGRKMKRWSAMAKTFTRIGKDIVMAVKEGGPNPDANSRLRAVIQNAKAANMPKDNVERAI
Y2194_DEIGD     MAGHSKWAQIKRKKGANDKKRSAIYSKHIRAIQAAVRSGGSDPXXXXXXXXXXXXXXXDTVPADNIENAI
Y2075_RHOFD     MAGHSKWANIQHRKGRQDEKRGKVWTRIIREITVAARAGGADLGTNPRLRLAVERAKAANMPADRIKYNI
Y727_STAAC      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y708_STAA2      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y693_STAA9      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y690_STAAT      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y680_STAAR      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y675_STAA8      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y669_STAAM      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y655_STAA3      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y638_STAAE      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y634_STAAS      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y631_STAAW      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y624_STAAN      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y618_STAAB      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQALRLVLERAKTYSVPNHIIEKAI
Y3128_STRM5     --------SIENRKNASDAKRGKIFTKIIREIGVAARXXXXDPNNNPRLRVAMDKGLTANMSKDVIERAI
YCDB_LACLA      -----KWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGEPDPESNSSLKFVIERAKQAQVPKHVIDKAI
Y364_STRU0      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGDPDPESNSALKFVIDRAKQAQVPKHVIDKAI
Y3203_ACIAC     MAGHSKWANIQHRKGRQDEKRGKIWTRIIREITVAARAGGGDVSANPRLRLAIDKAKAANMPADRIKYNI
Y195_STRT1      -----KWANIVAKKTAKDGANSKIYAKFGVEIYVAAKQGEPDPESNSALKFVLERAKQAQVPKHVIDKAI
Y242_STRTD      -----KWANIVAKKTAKDGANSKIYAKFGVEIYVAAKQGEPDPESNSALKFVLERAKQAQVPKHVIDKAI
Y2155_ACIBY     MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVNMTRDTINRAI
Y2152_ACIBS     MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVNMTRDTINRAI
Y1989_ACIB3     MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVNMTRDTINRAI
Y195_STRT2      -----KWANIVAKKTAKDGANSKIYAKFGVEIYVAAKQGEPDPESNSALKFVLERAKQAQVPKHVIDKAI
Y1731_ACIB5     MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVNMTRDTINRAI
Y1536_ACIBC     MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVNMTRDTINRAI
Y1496_ACIBT     MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVNMTRDTINRAI
Y475_MYCLE      MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLYDAIQKAKKSSVPNGNIERA-
Y475_MYCLB      MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPVGNPTLYDAIQKAKKSSVPNGNIERA-
Y3713_STRMK     --------SIEARKNASDAKRGKIFTKIIREIGVAARXXXXDPNNNPRLRVAVDKGLAVNMSKDVIERAI
Y097_PORGI      ----------KARKMKRWGNMARVFTKLGKEITIAAKEGGPDVETNPRLRILVQTAKKENMPKENVERAI
Y1106_FERNB     MSGHNKWANIKHRKAAQDAKRSKIFTKLIREIIVAAREGGGNPDTNPRLRAVLEKAREANMPKDTVERSX
Y316_STRP1      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y311_STRP8      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y297_STRP6      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y287_STRPB      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y268_STRPC      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y266_STRPD      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y265_STRPZ      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y261_STRPM      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y231_STRP3      -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y1586_STRPG     -----KWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTTLKFVIDRAKQAQVPKHVIDKAI
Y264_STRPF      -----KWANIVAKKTAKDGATSKIYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVPKHVIDKAI
Y1789_STRMU     -----KWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGEPDPESNSALKFVLERAKQAQVPKHVIDKAI
Y1435_SYNWW     MAGHSKWANIKHKKARSDEKRGKEFTKIAKEITIAVRSGGSDPEANSXXXXXXXXXXXXNMPNENINRAV
Y1233_PARD8     ----------KARKFKRWGNMARVFTKLGKEITIAAKQGGPEPENNPRLRVLMQNAKKENMPKENVERAI
Y835_FLAPJ      ----------KGRKMKRWSAMAKAFTRIGKDIVMAVKEGGPNPEANSRLRAVIQNSKAVNMPKENVERAI
Y641_NEOSM      MAGHSQYANIKHRKNAQDAKRARKFTKLRREILVAARSGLPDPEFNPRLRSALANARRFGLPKDKIESAI
Y4362_ROSS1     MSGHSKWHSIRRTKSVLDQRRGQLFTKLARDITIATREGGSDPEANFRLRLAVDKARAANMPMENIQRAI
Y242_LACLM      -----KWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGEPDPESNSSLKFVIERAKQAQVPKHVIDKAI
Y237_LACLS      -----KWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGEPDPESNSSLKFVIERAKQAQVPKHVIDKAI
Y627_BACTN      ----------KAAKLKRWGHMAKTFTRLGKQIAIAVKAGGPEPENNPTLRSVIATCKRENMPKDNIERAI
Y1691_STRA3     -----KWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGEPDPESNSALKFVLDRAKQAQVPKHVIDKAI
Y1658_STRA1     -----KWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGEPDPESNSALKFVLDRAKQAQVPKHVIDKAI
Y1645_STRA5     -----KWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGEPDPESNSALKFVLDRAKQAQVPKHVIDKAI
Y1972_SYNPW     MAGHSKWSQIKRTKAVVDAKRGAVFTRIGREITVAARQG-ADPDGNFQLRTXXXXXXXXGVPAGNIERAI
Y1246_THEAB     MSGHNKWANIKHRKAAQDAKKSKIFTKLIREIIVAAKEGGGDPETNPXXXXXXXXXXXXNMPKDTIEKSI
Y424_CAMFF      ---------------------SKLFPKLSKAITVAAKEGGIDPDMNPKLRTAIATAKAQNMPKDNIDAAI
Y317_STACT      -----KWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPDPESNQNLRLVLERAKTYNVPRNIIDRAI
Y2589_BACFN     ----------KATKLKRWGNMARTFTRIGKQIAIAVKAGGPDPENNPHLRAVVATAKRENMPKDNVERAI
Y2564_BACFR     ----------KATKLKRWGNMARTFTRIGKQIAIAVKAGGPDPENNPHLRAVVATAKRENMPKDNVERAI
Y402_STRSY      -----KWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETNSALKFVIDRAKQAQVPKHXXXXXX
Y3516_CYTH3     ----------KGRRAKRFDRMAKAFTRLGKEIVMAAKQGGGNIETNSRLRTAVNNAKSVNMPKDRIDAAI
Y1337_METPP     MAGHSKWANIQHRKGRQDEKRGKIWTRIIREIVVAARAGGGDTAMNPRLRLAIDKAKAANMPADRIKYNV
Y3469_BACV8     ----------KATKLKRWGHMAKTFTRLGKQIAIAVKAGGPEPENNPTLRGVIATCKRENMPKDNIERAI
Y552_LACRD      MSGHSKWHNIQGRKNAQDAKRGKIFQKISRDLYQAAKAGDPDPANNAQLRLVIDKAHAANMPKKNIDRXX
Y538_LACRJ      MSGHSKWHNIQGRKNAQDAKRGKIFQKISRDLYQAAKAGDPDPANNAQLRLVIDKAHAANMPKKNIDRXX
Y3027_XANCP     --------SIEGRKNASDAKRGKIFTKIIREISVAARAGGGDPSNNPRLRTAMDKGLSSNMSKDVIERAI
Y1964_BDEBA     --------------GKVEKQKGQIFTKLAREIAVAAKAGGPDPNANARLRMAIDAAKKVSCPNDTIERAI
Y1169_XANCB     --------SIEGRKNASDAKRGKIFTKIIREISVAARAGGGDPSNNPRLRTAMDKGLSSNMSKDVIERAI
Y1131_XANC8     --------SIEGRKNASDAKRGKIFTKIIREISVAARAGGGDPSNNPRLRTAMDKGLSSNMSKDVIERAI
Y2064_BURP8     MAGHSKWXXXXXXXXXXXXXXXXVWTRLIKEIQVAARMGGGDIDSNPRLRLAVDKAYDANMPKDNINRAI
Y5184_VIBVU     ----------KASMAKTAGAKIKVYSKYGKEIYVCAKNGGIDPDMNLSLRHLITKAKKDQVPSHVIEKAL
Y4010_VIBVY     ----------KASMAKTAGAKIKVYSKYGKEIYVCAKNGGIDPDMNLSLRHLITKAKKDQVPSHVIEKAL
Y387_STRS2      -----KWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETNSALKFVIDRAKQAQVPKHXXXXXX
Y2184_ANADE     ---------------------AKAFTRISKDIAIAVKGGGPNPDNNPALRRVLQNARHLNMPKDKVEAAI
Y1659_XANOR     --------SIEGRKNASDAKRGKMFTKIIREISVAARAGGGDPSNNPRLRTAMDKGLSANMSKDVIERAI
Y1543_XANOM     --------SIEGRKNASDAKRGKMFTKIIREISVAARAGGGDPSNNPRLRTAMDKGLSANMSKDVIERAI
Y821_THET8      MAGHSKWAQIKRKKAANDLKRGKLISKHLRAIQAAARAGGSPPEANVQLRNAIEAARADDVPMENIERLL
Y469_THET2      MAGHSKWAQIKRKKAANDLKRGKLISKHLRAIQAAARAGGSPPEANVQLRNAIEAARADDVPMENIERLL
Y1765_ANAD2     ---------------------AKAFTRISKDIAIAVKGGGPNPDNNPALRRVLQNARHLNMPKDKVEAAI
Y1694_ANASK     ---------------------AKAFTRISKDIAIAVKGGGPNPDNNPALRRVLQNARHLNMPKDKVEAAI
Y7062_MYXXD     ---------------------AKVFTRISKDIAIAVKAGGPNPDSNSTLRRVLQNARAANMPKDKVDAAI
Y365_VESOH      MAGHSKWHNIQHRKGIQDVKRGXXXXXXXXXXXXXXXXGGSVIENNPSLRMVIDRALAANMKRNTIENAV
Y3282_XANC5     --------SIEGRKNASDAKRGKMFTKIIREISVAARAGGGDPSNNPRLRTAMDKGLSSNMSKDVMERAI
Y2806_VIBCM     ----------KASMAKTQGAKIKVYSKYGKEIYVCAKNGGTDPDMNLSLRHLITKAKKDQVPAHVIEKAL
Y2806_VIBCH     ----------KASMAKTQGAKIKVYSKYGKEIYVCAKNGGTDPDMNLSLRHLITKAKKDQVPAHVIEKAL
Y124_VIBC3      ----------KASMAKTQGAKIKVYSKYGKEIYVCAKNGGTDPDMNLSLRHLITKAKKDQVPAHVIEKAL
Y2052_ACIAD     MAGHSKWANTKHRKAKQDASRAKVFTKYIREIVTAAKLGGADAASNPRLRAVVEKALSVNMTRDAINRAI
Y557_CAMJD      ---------------------SKLFPKLAKAIQVAAKEGGIDPDMNPKLRSAIATAKANNMPKDNIDAAI
Y373_MYCS5      MAGHSHSANIAHRKNAQDAARGKIFQKLSKEIFVAAQKG-FDPEMNXXXXXXXXXXXXXNMPKDNIERAI
Y1367_KOCRD     MSGH