[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21432.1

[Show Plain Result]


## Summary of Sequence Search
    1::637
    1::637       0.0 100%  637 aa  DXS_PELUB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::640       0.0  64%  641 aa  DXS_BRASO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   23::637       0.0  64%  650 aa  DXS_MESSB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::639       0.0  64%  641 aa  DXS_BRASB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::638       0.0  64%  640 aa  DXS_RHOP5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   36::667       0.0  64%  668 aa  DXS_NITHX RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   29::659       0.0  63%  661 aa  DXS_BRAJA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::639       0.0  63%  641 aa  DXS_RHOPB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::636       0.0  63%  638 aa  DXS_RHOP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::629       0.0  63%  641 aa  DXS_RHOPT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::629       0.0  63%  641 aa  DXS_RHOPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   34::664       0.0  63%  666 aa  DXS_NITWN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::636       0.0  62%  638 aa  DXS_RHOPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628       0.0  63%  639 aa  DXS_SPHWW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    9::631       0.0  61%  643 aa  DXS_BRUO2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  62%  643 aa  DXS_BRUSU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  62%  643 aa  DXS_BRUC2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628       0.0  62%  637 aa  DXS_RHILO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::621       0.0  62%  642 aa  DXS_RHOCS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  62%  643 aa  DXS_BRUME RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  62%  643 aa  DXS_BRUMB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  62%  643 aa  DXS_BRUAB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  62%  643 aa  DXS_BRUA1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  61%  643 aa  DXS_BRUA2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::630       0.0  62%  642 aa  DXS_BEII9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  61%  643 aa  DXS_BRUSI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    9::628       0.0  61%  635 aa  DXS_BART1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::619       0.0  62%  638 aa  DXS_OCHA4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::626       0.0  62%  643 aa  DXS_MARMM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    9::628       0.0  61%  640 aa  DXS_BARQU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628       0.0  61%  638 aa  DXS_RHIEC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::631       0.0  60%  640 aa  DXS_BARHE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628       0.0  61%  640 aa  DXS_ERYLH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::628       0.0  60%  639 aa  DXS_AGRVS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628       0.0  61%  642 aa  DXS_SPHAL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::639       0.0  59%  645 aa  DXS_RHIME RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::628       0.0  59%  638 aa  DXS_AGRRK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::632       0.0  61%  642 aa  DXS_SILPO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    9::627       0.0  61%  641 aa  DXS_AZOC5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::630       0.0  61%  639 aa  DXS1_JANSC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
   13::632       0.0  61%  642 aa  DXS2_ROSDO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
   10::620       0.0  60%  638 aa  DXS_RHIL3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::620       0.0  60%  638 aa  DXS_RHIE6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::620       0.0  60%  638 aa  DXS_RHILW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::626       0.0  60%  640 aa  DXS_HYPNA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::632       0.0  61%  645 aa  DXS_SILST RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::633       0.0  58%  639 aa  DXS_AGRT5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::626       0.0  60%  638 aa  DXS_BARBK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   14::651       0.0  59%  660 aa  DXS_GLUOX RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::638       0.0  58%  645 aa  DXS1_RHORT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
   10::638       0.0  58%  645 aa  DXS2_RHORT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
    9::607       0.0  62%  643 aa  DXS_XANP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::641       0.0  58%  644 aa  DXS_MAGSA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::626       0.0  58%  638 aa  DXS_CAUSK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628       0.0  57%  637 aa  DXS2_RHOS4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
   10::628       0.0  58%  640 aa  DXS_NOVAD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::626       0.0  58%  638 aa  DXS_PHEZH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::626       0.0  57%  640 aa  DXS_CAUCR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::626       0.0  57%  640 aa  DXS_CAUCN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   79::718       0.0  55%  719 aa  DXS_CAPAN RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate
   73::705       0.0  54%  720 aa  DXS_ORYSJ RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate
   15::631       0.0  57%  645 aa  DXS1_ROSDO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
   19::623       0.0  56%  648 aa  DXS1_RHOS4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
    9::627       0.0  56%  636 aa  DXS2_JANSC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
   77::709       0.0  53%  717 aa  DXS_ARATH RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate
   10::628       0.0  52%  649 aa  DXS1_ZYMMO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
   10::620       0.0  52%  650 aa  DXS2_ZYMMO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
   11::638       0.0  52%  641 aa  DXS_RHOCA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::608     e-175  53%  614 aa  DXS_NITEU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::612     e-173  51%  614 aa  DXS_NITEC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-171  50%  631 aa  DXS_NATTJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::604     e-170  51%  614 aa  DXS_NITMU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::615     e-169  51%  621 aa  DXS_SERP5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::616     e-168  49%  638 aa  DXS_SYNWW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::626     e-168  49%  635 aa  DXS2_GEOMG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
    5::619     e-168  51%  625 aa  DXS_HAEIG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-168  52%  617 aa  DXS_ACTPJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-168  52%  617 aa  DXS_ACTP7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-168  52%  617 aa  DXS_ACTP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-168  49%  622 aa  DXS_LARHH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-168  51%  625 aa  DXS_HAEIE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::621     e-168  50%  622 aa  DXS_MAGSM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-168  50%  631 aa  DXS_PSEPG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::614     e-168  52%  636 aa  DXS_POLNA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-168  51%  625 aa  DXS_HAEIN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::621     e-168  52%  621 aa  DXS_PHOLL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::614     e-167  52%  614 aa  DXS_PASMU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::616     e-167  51%  621 aa  DXS_PECCP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-167  51%  625 aa  DXS_HAEI8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-167  50%  631 aa  DXS_PSEPK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-167  50%  631 aa  DXS_PSEP1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::616     e-167  51%  621 aa  DXS_ERWCT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-166  50%  624 aa  DXS_PROMH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::620     e-166  51%  638 aa  DXS_CUPTR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::613     e-166  51%  622 aa  DXS_ACIAC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-166  50%  631 aa  DXS_PSEPW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   18::626     e-166  50%  631 aa  DXS_PSEMY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-166  53%  634 aa  DXS_BURCJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-166  53%  634 aa  DXS_BURS3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::615     e-166  51%  631 aa  DXS_METPP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::622     e-166  49%  636 aa  DXS_HALOH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::620     e-166  51%  638 aa  DXS_RALEJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-165  50%  629 aa  DXS_DIAST RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-165  53%  634 aa  DXS_BURP6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::598     e-165  50%  637 aa  DXS1_GEOSL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
    2::613     e-165  50%  622 aa  DXS_THETN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::625     e-165  51%  630 aa  DXS_COLP3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::611     e-165  51%  635 aa  DXS_POLSJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   40::627     e-165  53%  646 aa  DXS_BURCM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::633     e-165  50%  637 aa  DXS_RALME RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-165  49%  630 aa  DXS_PSEU2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::612     e-165  50%  634 aa  DXS_DESAP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-165  53%  634 aa  DXS_BURPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-165  53%  634 aa  DXS_BURP1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-165  53%  634 aa  DXS_BURP0 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-165  53%  634 aa  DXS_BURMA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-165  53%  634 aa  DXS_BURA4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::623     e-165  51%  632 aa  DXS_PSEFS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::612     e-165  51%  617 aa  DXS_HAEDU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   18::623     e-165  50%  631 aa  DXS_PSESM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::614     e-164  50%  616 aa  DXS_CHRVO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-164  52%  619 aa  DXS_YERE8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-164  53%  634 aa  DXS_BURTA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   40::627     e-164  53%  646 aa  DXS_BURCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-164  53%  634 aa  DXS_BURCC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-164  53%  634 aa  DXS_BURCA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::621     e-164  49%  634 aa  DXS_PELCD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::631     e-164  48%  637 aa  DXS_PELTS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::615     e-164  53%  635 aa  DXS_BURXL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   22::627     e-163  50%  632 aa  DXS_PSEPF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::623     e-163  51%  633 aa  DXS_PSEF5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::614     e-163  52%  615 aa  DXS_HAEPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-163  52%  619 aa  DXS_YERPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-163  52%  619 aa  DXS_YERPB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::604     e-163  50%  614 aa  DXS_METFK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-162  50%  631 aa  DXS_PSEE4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-162  52%  619 aa  DXS_YERPY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-162  52%  619 aa  DXS_YERP3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::622     e-162  49%  630 aa  DXS_PSE14 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::629     e-162  52%  632 aa  DXS_BURP8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-162  49%  620 aa  DXS_SODGM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-162  51%  625 aa  DXS_ALTMD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::621     e-162  50%  639 aa  DXS_LEPCP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::619     e-162  47%  628 aa  DXS_BREBN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-162  48%  620 aa  DXS_PHOPR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-162  50%  620 aa  DXS_ESCF3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::626     e-161  47%  629 aa  DXS_BACHD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::608     e-161  50%  621 aa  DXS_AZOSE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-161  51%  619 aa  DXS_YERPP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-161  51%  619 aa  DXS_YERPN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-161  51%  619 aa  DXS_YERPG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-161  51%  619 aa  DXS_YERPE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::614     e-161  51%  619 aa  DXS_YERPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   19::619     e-161  50%  621 aa  DXS_ERWT9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-161  50%  620 aa  DXS_SHISS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::619     e-161  50%  620 aa  DXS_CITK8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::615     e-161  49%  629 aa  DXS_ACISJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::615     e-161  48%  618 aa  DXS_IDILO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::620     e-161  50%  638 aa  DXS_RALEH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_SHIDS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::620     e-160  49%  627 aa  DXS_PSEA7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   14::644     e-160  48%  645 aa  DXS_DESPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::619     e-160  49%  620 aa  DXS_KLEP3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOLI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECODH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOBW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_SHIBS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_SHIB3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::619     e-160  49%  620 aa  DXS_KLEP7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOUT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOSM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOL6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOK1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO81 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO7I RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO5E RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO57 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO45 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::614     e-160  50%  617 aa  DXS_HAES2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::614     e-160  50%  617 aa  DXS_HAES1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-160  49%  621 aa  DXS_VIBPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::625     e-160  49%  627 aa  DXS_VIBF1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_SHIFL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOSE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOLC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOL5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOHS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO8A RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECO24 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::625     e-160  49%  627 aa  DXS_VIBSL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::624     e-160  49%  626 aa  DXS_VIBCM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::624     e-160  49%  626 aa  DXS_VIBCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::624     e-160  49%  626 aa  DXS_VIBC3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::614     e-160  50%  617 aa  DXS_MANSM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-160  50%  620 aa  DXS_ECOLU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::623     e-160  47%  631 aa  DXS_DESHY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::607     e-160  50%  619 aa  DXS_AZOSB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::625     e-159  48%  627 aa  DXS_VIBFM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::613     e-159  50%  632 aa  DXS_RHOFD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::620     e-159  49%  627 aa  DXS_PSEAE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::620     e-159  49%  627 aa  DXS_PSEAB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   24::620     e-159  49%  627 aa  DXS_PSEA8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::589     e-159  51%  618 aa  DXS_DECAR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-159  47%  622 aa  DXS_CARHZ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::625     e-159  49%  627 aa  DXS_ALISL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::635     e-159  48%  635 aa  DXS_NOSP7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALPK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_ECO27 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-159  49%  621 aa  DXS_AERS4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::623     e-159  47%  631 aa  DXS_DESHD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALTI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALTY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALSV RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALPC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALPB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALNS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALHS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALG2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALEP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALDC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-159  50%  620 aa  DXS_SALA4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::615     e-159  49%  647 aa  DXS_HELMI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::614     e-159  50%  622 aa  DXS_HAMD5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::617     e-159  48%  624 aa  DXS_ALKOO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-158  50%  620 aa  DXS_SALAR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::589     e-158  51%  620 aa  DXS_BORA1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::612     e-158  50%  631 aa  DXS_VEREI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::620     e-158  50%  636 aa  DXS_CELJU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::617     e-158  48%  640 aa  DXS_NITOC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-158  48%  621 aa  DXS_AERHH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   48::625     e-158  51%  643 aa  DXS_HAHCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::615     e-158  49%  620 aa  DXS_ENT38 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::619     e-158  49%  620 aa  DXS_ENTS8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::611     e-157  48%  620 aa  DXS_PSEHT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::594     e-157  51%  620 aa  DXS_ECO55 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::622     e-157  48%  628 aa  DXS_AQUAE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::589     e-157  51%  620 aa  DXS_BORPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::589     e-157  51%  620 aa  DXS_BORBR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::620     e-157  46%  621 aa  DXS_SHEHH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::617     e-157  49%  623 aa  DXS_BAUCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::635     e-156  48%  636 aa  DXS_CYAP8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::589     e-156  51%  620 aa  DXS_BORPE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   18::638     e-156  45%  650 aa  DXS_SYNAS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-156  48%  622 aa  DXS_PSYIN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-156  48%  621 aa  DXS_VIBHB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   49::618     e-156  51%  632 aa  DXS_PSEU5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::618     e-156  49%  625 aa  DXS_MARMS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::619     e-156  46%  625 aa  DXS1_GEOMG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
    5::614     e-156  49%  621 aa  DXS_PSEA6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   25::611     e-155  49%  621 aa  DXS_EDWI9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::620     e-155  47%  622 aa  DXS_SHEDO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::629     e-155  47%  635 aa  DXS_CHLTE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-155  47%  622 aa  DXS_SHESW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-155  47%  622 aa  DXS_SHEPC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::618     e-155  47%  618 aa  DXS_FRAP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-154  48%  632 aa  DXS_CYAP4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRAT1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-154  46%  628 aa  DXS_BACSK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::611     e-154  46%  615 aa  DXS_FRATM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::569     e-153  51%  627 aa  DXS_BORPD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-153  47%  621 aa  DXS_VIBVY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-153  47%  621 aa  DXS_VIBVU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-153  48%  639 aa  DXS_METCA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::634     e-153  48%  635 aa  DXS_CYAP7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::620     e-153  46%  621 aa  DXS_SHESH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::620     e-153  47%  624 aa  DXS_BLOPB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-153  48%  638 aa  DXS_THEEB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::626     e-153  46%  633 aa  DXS_DEHSB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::633     e-153  46%  647 aa  DXS_DEHE1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   11::630     e-152  48%  649 aa  DXS_SACD2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::640     e-152  46%  647 aa  DXS_DEHSC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::628     e-152  46%  635 aa  DXS_ACAM1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::620     e-152  45%  621 aa  DXS_SHEPW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::630     e-152  47%  635 aa  DXS_ANASP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-152  46%  621 aa  DXS_SHEWM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::635     e-152  47%  635 aa  DXS_ANAVT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::549     e-152  50%  618 aa  DXS_THIDA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-152  47%  640 aa  DXS_SYNR3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   27::566     e-152  53%  636 aa  DXS_RALPJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::622     e-152  47%  629 aa  DXS_PROM9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::615     e-151  47%  619 aa  DXS_CLOBA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::631     e-151  47%  636 aa  DXS_SYNE7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::620     e-151  48%  636 aa  DXS_RALSO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-151  46%  621 aa  DXS_SHEFN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-151  46%  622 aa  DXS_SHEAM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-151  47%  636 aa  DXS_CYAA5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::631     e-151  47%  636 aa  DXS_SYNP6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::620     e-151  45%  621 aa  DXS_SHEPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-151  45%  633 aa  DXS_BACP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::621     e-150  46%  640 aa  DXS_MOOTA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::630     e-150  46%  636 aa  DXS_MICAN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::616     e-150  46%  618 aa  DXS_CLOB8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::620     e-150  47%  635 aa  DXS_ANADF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::618     e-150  46%  635 aa  DXS_STRMK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::635     e-150  47%  640 aa  DXS_SYNY3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::612     e-149  46%  633 aa  DXS_LYSSC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::620     e-149  45%  626 aa  DXS2_GEOSL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
    3::625     e-149  47%  647 aa  DXS_SYNPW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-149  47%  628 aa  DXS_PROMT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::618     e-149  46%  618 aa  DXS_DICT6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-149  46%  637 aa  DXS_PROMP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-149  47%  628 aa  DXS_PROM1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::622     e-149  47%  629 aa  DXS_THERP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-149  47%  635 aa  DXS_TRIEI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::630     e-149  45%  636 aa  DXS_CYTH3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-148  45%  630 aa  DXS_GEOTN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-148  46%  647 aa  DXS_SYNS3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-148  46%  622 aa  DXS_SHEB9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::632     e-148  45%  632 aa  DXS_LISIN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::617     e-148  46%  619 aa  DXS_CLOBB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-147  46%  622 aa  DXS_SHEB8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-147  46%  622 aa  DXS_SHEB5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-147  46%  622 aa  DXS_SHEB2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::627     e-147  45%  630 aa  DXS_GEOSW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::618     e-147  45%  630 aa  DXS_METI4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   14::623     e-147  46%  645 aa  DXS_ALCBS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::610     e-147  46%  640 aa  DXS_THISH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::625     e-147  45%  628 aa  DXS_GEOKA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::630     e-146  45%  634 aa  DXS_LISW6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::634     e-146  44%  637 aa  DXS_LAWIP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::619     e-146  44%  633 aa  DXS_BACA2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::631     e-146  47%  638 aa  DXS_GLOVI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::625     e-146  44%  627 aa  DXS_MACCJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-146  45%  622 aa  DXS_SHESR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-146  45%  622 aa  DXS_SHESM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::638     e-146  46%  643 aa  DXS_PROMA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-145  45%  648 aa  DXS_SYMTH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-145  45%  622 aa  DXS_SHESA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   12::638     e-145  43%  638 aa  DXS_DESDG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::619     e-145  44%  633 aa  DXS_BACLD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-145  46%  631 aa  DXS_PROM5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::594     e-145  46%  622 aa  DXS_SHELP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACWK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACHK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACCZ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACC7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACC0 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACAN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACAC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACAA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-145  45%  638 aa  DXS_XANCP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-145  45%  638 aa  DXS_XANC8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-145  45%  638 aa  DXS_XANOR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-145  45%  638 aa  DXS_XANOP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-145  45%  638 aa  DXS_XANOM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACC2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACC1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-145  45%  643 aa  DXS_SYNSC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACCR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-145  44%  630 aa  DXS_BACC4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::622     e-145  46%  629 aa  DXS_PROMS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::600     e-145  47%  636 aa  DXS_ANASK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::633     e-144  45%  638 aa  DXS_SYNP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::622     e-144  46%  629 aa  DXS_PROM0 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   19::626     e-144  46%  637 aa  DXS_ACIBY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   36::627     e-144  50%  649 aa  DXS_SYNJA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   19::626     e-144  46%  637 aa  DXS_ACIBS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::600     e-144  47%  636 aa  DXS_ANAD2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-144  45%  622 aa  DXS_SHEON RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-144  46%  644 aa  DXS_PROM3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::622     e-144  46%  629 aa  DXS_PROM2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-144  44%  638 aa  DXS_XANC5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-144  46%  644 aa  DXS_PROMM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   30::619     e-144  48%  619 aa  DXS_CLOP1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   12::618     e-143  45%  626 aa  DXS_WIGBR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   30::619     e-143  48%  619 aa  DXS_CLOPE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::623     e-143  45%  623 aa  DXS_CLONN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-143  44%  619 aa  DXS_CLOAB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::626     e-143  43%  627 aa  DXS_ACIC5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::618     e-143  45%  618 aa  DXS_DICTD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::619     e-143  44%  638 aa  DXS_XANAC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-143  46%  643 aa  DXS_SYNS9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::618     e-143  46%  624 aa  DXS_CLOK5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::618     e-143  46%  624 aa  DXS_CLOK1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::615     e-143  46%  636 aa  DXS_ANADE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::631     e-142  44%  641 aa  DXS_DESVV RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::631     e-142  44%  641 aa  DXS_DESVH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::619     e-142  43%  633 aa  DXS_BACSU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   33::619     e-142  48%  619 aa  DXS_CLOPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::615     e-142  43%  621 aa  DXS_CLOD6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   19::629     e-142  46%  640 aa  DXS_ACIAD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::618     e-142  45%  635 aa  DXS_XYLFT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::618     e-142  45%  635 aa  DXS_XYLFM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::618     e-142  45%  635 aa  DXS_XYLF2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::612     e-142  46%  617 aa  DXS_BLOFL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::616     e-142  44%  628 aa  DXS_ALHEH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::618     e-142  45%  635 aa  DXS_XYLFA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::621     e-142  45%  643 aa  DXS_SYNPX RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   36::627     e-141  49%  648 aa  DXS_SYNJB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-141  44%  630 aa  DXS_BACCN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::617     e-141  44%  625 aa  DXS_CLOPH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::589     e-141  47%  637 aa  DXS_NEIMA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::565     e-140  48%  635 aa  DXS_NEIM0 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::622     e-139  46%  643 aa  DXS_PROM4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::616     e-139  44%  628 aa  DXS_EXIS2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::567     e-139  48%  637 aa  DXS_NEIG1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::598     e-139  46%  609 aa  DXS_LISMO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::567     e-139  48%  637 aa  DXS_NEIMB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::567     e-138  48%  637 aa  DXS_NEIG2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   23::642     e-138  45%  653 aa  DXS_CHRSD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::618     e-138  44%  618 aa  DXS_CLOTE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::598     e-138  45%  609 aa  DXS_LISMF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::598     e-138  45%  609 aa  DXS_LISMC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::630     e-136  42%  632 aa  DXS_AZOPC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::626     e-136  44%  635 aa  DXS_PROVI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::628     e-135  44%  635 aa  DXS_LEPBL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::628     e-135  44%  635 aa  DXS_LEPBJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   29::629     e-135  44%  632 aa  DXS_PELLD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::628     e-134  43%  632 aa  DXS_PARD8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::630     e-134  43%  632 aa  DXS_BACV8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::638     e-134  42%  653 aa  DXS_TREDE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-134  43%  634 aa  DXS_LEPIN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::627     e-134  43%  634 aa  DXS_LEPIC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::567     e-133  46%  637 aa  DXS_NEIMF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::608     e-133  43%  619 aa  DXS_WOLSU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::597     e-133  43%  600 aa  DXS_CAMFF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   20::580     e-133  47%  585 aa  DXS_BUCAP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::611     e-132  43%  618 aa  DXS_HELPH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::611     e-132  42%  618 aa  DXS_HELPJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::611     e-132  42%  618 aa  DXS_HELPG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::600     e-132  43%  601 aa  DXS_ARCB4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::611     e-131  42%  618 aa  DXS_HELPY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::603     e-131  42%  607 aa  DXS_CAMHC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::629     e-130  42%  648 aa  DXS_BACFR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::629     e-130  42%  648 aa  DXS_BACFN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   25::625     e-130  41%  629 aa  DXS_HELHP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::620     e-129  42%  634 aa  DXS_PORGI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::620     e-129  42%  634 aa  DXS_PORG3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::619     e-129  40%  635 aa  DXS_PARUW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::595     e-128  42%  599 aa  DXS_NITSB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   27::611     e-127  42%  615 aa  DXS_CAMJE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   27::611     e-127  42%  615 aa  DXS_CAMJJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   27::611     e-127  42%  615 aa  DXS_CAMJ8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   27::611     e-126  42%  615 aa  DXS_CAMJR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   27::611     e-126  43%  615 aa  DXS_CAMJD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    7::647     e-125  40%  647 aa  DXS_BACTN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::602     e-125  43%  608 aa  DXS_BUCAT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::602     e-125  43%  608 aa  DXS_BUCA5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    8::602     e-125  44%  608 aa  DXS_BUCAI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::596     e-125  42%  608 aa  DXS_THEMA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::596     e-124  43%  608 aa  DXS_THEP1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::596     e-124  42%  608 aa  DXS_THESQ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   44::679     e-124  43%  680 aa  DXS_PSYCK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   13::621     e-124  42%  629 aa  DXS_DEIRA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   10::602     e-124  41%  606 aa  DXS_SULDN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   17::625     e-124  42%  633 aa  DXS_DEIGD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::627     e-123  39%  650 aa  DXS_FRASN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::617     e-121  41%  641 aa  DXS_MYCA9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   44::679     e-121  41%  680 aa  DXS_PSYA2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::618     e-120  40%  648 aa  DXS_RHOE4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::617     e-119  39%  630 aa  DXS_TREPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    6::617     e-119  39%  630 aa  DXS_TREPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::617     e-118  40%  649 aa  DXS_RHOSR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::620     e-118  39%  642 aa  DXS2_STRAW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
    2::616     e-116  39%  637 aa  DXS_MYCUA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-116  39%  638 aa  DXS_MYCTU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-116  39%  638 aa  DXS_MYCTA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-116  39%  638 aa  DXS_MYCBT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-116  39%  638 aa  DXS_MYCBP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-116  39%  638 aa  DXS_MYCBO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::620     e-116  40%  641 aa  DXS_MYCPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::620     e-116  39%  641 aa  DXS_MYCA1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::603     e-115  40%  615 aa  DXS_THET8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::603     e-115  40%  615 aa  DXS_THET2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::627     e-115  39%  644 aa  DXS_CHLPN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::554     e-115  40%  600 aa  DXS_FUSNN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::628     e-114  40%  633 aa  DXS2_KITGR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
    4::624     e-114  39%  630 aa  DXS_CORJK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::627     e-114  37%  655 aa  DXS_FRASC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::620     e-113  39%  642 aa  DXS2_STRCO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
    2::616     e-113  38%  643 aa  DXS_MYCLE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-113  38%  643 aa  DXS_MYCLB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::623     e-113  41%  635 aa  DXS_CORDI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-113  39%  638 aa  DXS_MYCS2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-113  39%  637 aa  DXS_MYCGI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::618     e-112  39%  629 aa  DXS_TROWT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    5::618     e-112  39%  629 aa  DXS_TROW8 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::623     e-111  39%  637 aa  DXS_THEFY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-110  39%  638 aa  DXS_MYCSS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-110  39%  638 aa  DXS_MYCSK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::540     e-110  42%  656 aa  DXS1_STRCO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
    4::560     e-110  40%  631 aa  DXS_STRC1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::630     e-110  38%  632 aa  DXS_CORGB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-110  39%  638 aa  DXS_MYCSJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::634     e-110  38%  636 aa  DXS_CORGL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    2::616     e-110  38%  637 aa  DXS_MYCVP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::630     e-109  37%  632 aa  DXS1_STRAW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
    4::624     e-108  37%  631 aa  DXS_NOCFA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::625     e-108  39%  636 aa  DXS_COREF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::613     e-108  38%  649 aa  DXS1_KITGR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
    4::616     e-106  38%  634 aa  DXS_NOCSJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::620     e-106  36%  637 aa  DXS_STRGG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::626     e-106  38%  644 aa  DXS_CHLFF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::626     e-105  37%  644 aa  DXS_CHLAB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   15::626     e-105  38%  644 aa  DXS_CHLCV RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    1::619     e-105  38%  627 aa  DXS_PROAC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::567     e-104  41%  583 aa  DXS_MYXXD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::636     e-104  38%  657 aa  DXS_ARTS2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::620     e-104  36%  635 aa  DXS_RHOBA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::636     e-103  38%  657 aa  DXS_ARTAT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::636     e-101  37%  657 aa  DXS_ARTCA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::619     e-100  36%  650 aa  DXS_CLAMS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::633     e-100  33%  642 aa  DXS_SACEN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-100  37%  640 aa  DXS_CHLTB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     e-100  37%  640 aa  DXS_CHLT2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   28::621     2e-99  39%  632 aa  DXS_CHLMU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     3e-99  37%  640 aa  DXS_CHLTR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    3::623     3e-99  37%  640 aa  DXS_CHLTA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::637     3e-97  35%  667 aa  DXS_KOCRD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::636     1e-96  36%  657 aa  DXS_RENSM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    4::619     4e-93  35%  650 aa  DXS_LEIXX RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   16::553     2e-90  37%  612 aa  DXS_MYCPE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   31::343     2e-37  30%  345 aa  Y4MN_RHISN RecName: Full=Putative uncharacterized transketolase
   13::311     4e-37  32%  316 aa  TKTC_METJA RecName: Full=Putative transketolase C-terminal section;
  218::623     1e-25  31%  627 aa  TKTL2_MOUSE RecName: Full=Transketolase-like protein 2;       
   15::569     2e-24  27%  623 aa  TKT_MOUSE RecName: Full=Transketolase;         Short=TK;       
   15::582     1e-23  26%  623 aa  TKT_BOVIN RecName: Full=Transketolase;         Short=TK;       
   15::582     2e-21  26%  623 aa  TKT_RAT RecName: Full=Transketolase;         Short=TK;       
  129::582     1e-20  29%  623 aa  TKT_PANTR RecName: Full=Transketolase;         Short=TK;       
  187::543     1e-20  30%  596 aa  TKTL1_BOVIN RecName: Full=Transketolase-like protein 1;       
  129::582     2e-20  29%  623 aa  TKT_HUMAN RecName: Full=Transketolase;         Short=TK;       
   15::582     2e-20  28%  623 aa  TKT_MACFA RecName: Full=Transketolase;         Short=TK;       
   15::582     5e-20  28%  623 aa  TKT_PONAB RecName: Full=Transketolase;         Short=TK;       
  216::572     6e-20  30%  626 aa  TKTL2_BOVIN RecName: Full=Transketolase-like protein 2;       
  187::586     8e-20  28%  596 aa  TKTL1_MACFA RecName: Full=Transketolase-like protein 1;       
  217::573     7e-19  31%  626 aa  TKTL2_HUMAN RecName: Full=Transketolase-like protein 2;       
  187::586     3e-18  27%  596 aa  TKTL1_HUMAN RecName: Full=Transketolase-like protein 1;       
  121::416     1e-17  27%  462 aa  ODPB_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component
  298::543     4e-17  30%  595 aa  TKTL1_MOUSE RecName: Full=Transketolase-like protein 1;       
   48::295     1e-14  29%  359 aa  ODPB_BOVIN RecName: Full=Pyruvate dehydrogenase E1 component
   48::295     2e-14  28%  359 aa  ODPB_PONAB RecName: Full=Pyruvate dehydrogenase E1 component
   48::295     2e-14  28%  359 aa  ODPB_MOUSE RecName: Full=Pyruvate dehydrogenase E1 component
   48::295     2e-14  28%  359 aa  ODPB_HUMAN RecName: Full=Pyruvate dehydrogenase E1 component
   48::295     7e-14  28%  359 aa  ODPB_RAT RecName: Full=Pyruvate dehydrogenase E1 component subunit
   96::326     1e-13  28%  370 aa  ODBB_DICDI RecName: Full=2-oxoisovalerate dehydrogenase subunit
  185::397     1e-13  27%  460 aa  ODPB_RHIME RecName: Full=Pyruvate dehydrogenase E1 component
    5::297     1e-13  24%  327 aa  ODBB_BACSU RecName: Full=2-oxoisovalerate dehydrogenase subunit
   49::278     1e-12  24%  326 aa  ODPB_RICCN RecName: Full=Pyruvate dehydrogenase E1 component
   49::278     3e-12  24%  326 aa  OPDB_RICFE RecName: Full=Pyruvate dehydrogenase E1 component
   37::307     4e-12  26%  356 aa  ODPB_DICDI RecName: Full=Pyruvate dehydrogenase E1 component
   53::273     4e-12  24%  326 aa  ODPB_CYAME RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     5e-12  26%  325 aa  ODPB_STAAW RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     5e-12  26%  325 aa  ODPB_STAAU RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     5e-12  26%  325 aa  ODPB_STAAS RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     5e-12  26%  325 aa  ODPB_STAAR RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     5e-12  26%  325 aa  ODPB_STAAN RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     5e-12  26%  325 aa  ODPB_STAAM RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     8e-12  26%  325 aa  ODPB_STAAC RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     1e-11  27%  325 aa  ODPB_STAES RecName: Full=Pyruvate dehydrogenase E1 component
   21::248     1e-11  27%  325 aa  ODPB_STAEQ RecName: Full=Pyruvate dehydrogenase E1 component
   50::278     3e-11  24%  326 aa  OPDB_RICTY RecName: Full=Pyruvate dehydrogenase E1 component
   50::278     5e-11  24%  326 aa  ODPB_RICPR RecName: Full=Pyruvate dehydrogenase E1 component
   26::283     1e-10  24%  331 aa  ODPB_PORPU RecName: Full=Pyruvate dehydrogenase E1 component
   43::326     2e-10  23%  327 aa  ODPB_MESVI RecName: Full=Pyruvate dehydrogenase E1 component
    5::663     4e-10  27%  666 aa  TKT_BUCBP RecName: Full=Transketolase;         Short=TK;       
   49::261     4e-10  25%  325 aa  OPDB_RICBR RecName: Full=Pyruvate dehydrogenase E1 component
   32::293     4e-10  22%  342 aa  ACOB_BACSU RecName: Full=Acetoin:2,6-dichlorophenolindophenol
   34::322     6e-10  28%  366 aa  ODPB_YEAST RecName: Full=Pyruvate dehydrogenase E1 component
   72::288     6e-10  27%  359 aa  ODPB_PEA RecName: Full=Pyruvate dehydrogenase E1 component subunit
   19::283     8e-10  27%  327 aa  ODPB_ACHLA RecName: Full=Pyruvate dehydrogenase E1 component
  150::273     8e-10  27%  338 aa  ACOB_RALEH RecName: Full=Acetoin:2,6-dichlorophenolindophenol
   82::298     1e-09  27%  363 aa  ODPB_ARATH RecName: Full=Pyruvate dehydrogenase E1 component
   26::283     2e-09  23%  331 aa  ODPB_PORYE RecName: Full=Pyruvate dehydrogenase E1 component
   65::274     4e-09  24%  337 aa  ODPB_LEIXX RecName: Full=Pyruvate dehydrogenase E1 component
  183::324     5e-09  25%  325 aa  ODPB_BACSU RecName: Full=Pyruvate dehydrogenase E1 component
  394::624     6e-09  26%  667 aa  TKT_BACSU RecName: Full=Transketolase;         Short=TK;       
   43::272     1e-08  23%  323 aa  ODPB_GRATL RecName: Full=Pyruvate dehydrogenase E1 component
   46::322     2e-08  26%  366 aa  ODPB_SCHPO RecName: Full=Pyruvate dehydrogenase E1 component
  386::583     2e-08  26%  677 aa  TKT_PICST RecName: Full=Transketolase;         Short=TK;       
    2::188     2e-08  29%  663 aa  TKT2_VIBPA RecName: Full=Transketolase 2;         Short=TK 2;      
  405::585     4e-08  27%  679 aa  TKT1_KLULA RecName: Full=Transketolase;         Short=TK;       
   19::282     4e-08  24%  326 aa  ODPB_CHAVU RecName: Full=Pyruvate dehydrogenase E1 component
  149::348     4e-08  27%  392 aa  ODBB_HUMAN RecName: Full=2-oxoisovalerate dehydrogenase subunit
   54::294     5e-08  27%  339 aa  ODBB_PSEPU RecName: Full=2-oxoisovalerate dehydrogenase subunit
   12::192     7e-08  33%  672 aa  TKT_RHOCA RecName: Full=Transketolase;         Short=TK;       
    2::188     7e-08  29%  663 aa  TKT2_VIBVU RecName: Full=Transketolase 2;         Short=TK 2;      
    5::189     7e-08  29%  664 aa  TKT1_VIBVY RecName: Full=Transketolase 1;         Short=TK 1;      
    5::189     7e-08  29%  664 aa  TKT1_VIBVU RecName: Full=Transketolase 1;         Short=TK 1;      
   26::262     7e-08  24%  324 aa  ODBB_THET2 RecName: Full=2-oxoisovalerate dehydrogenase subunit
   26::316     9e-08  23%  361 aa  ODPB_ASCSU RecName: Full=Pyruvate dehydrogenase E1 component
   26::262     9e-08  24%  324 aa  ODBB_THET8 RecName: Full=2-oxoisovalerate dehydrogenase subunit
    2::188     2e-07  29%  663 aa  TKT2_VIBVY RecName: Full=Transketolase 2;         Short=TK 2;      
   20::180     2e-07  34%  648 aa  TKT_MYCGE RecName: Full=Transketolase;         Short=TK;       
   19::282     2e-07  22%  335 aa  ODPB_CHLAT RecName: Full=Pyruvate dehydrogenase E1 component
  183::296     2e-07  27%  325 aa  ODPB_BACST RecName: Full=Pyruvate dehydrogenase E1 component
  149::348     2e-07  25%  392 aa  ODBB_BOVIN RecName: Full=2-oxoisovalerate dehydrogenase subunit
  356::592     3e-07  27%  665 aa  TKT_BUCAI RecName: Full=Transketolase;         Short=TK;       
    5::189     3e-07  28%  664 aa  TKT1_VIBPA RecName: Full=Transketolase 1;         Short=TK 1;      
    5::189     4e-07  34%  665 aa  TKT_HAEIN RecName: Full=Transketolase;         Short=TK;       
   14::219     4e-07  29%  689 aa  TKT_AQUAE RecName: Full=Transketolase;         Short=TK;       
   12::192     5e-07  28%  657 aa  TKT_RHOSH RecName: Full=Transketolase;         Short=TK;       
   20::180     5e-07  36%  648 aa  TKT_MYCPN RecName: Full=Transketolase;         Short=TK;       
  407::580     5e-07  27%  667 aa  TKT2_ECOLI RecName: Full=Transketolase 2;         Short=TK 2;      
   65::305     5e-07  30%  350 aa  ODBB_PSEAE RecName: Full=2-oxoisovalerate dehydrogenase subunit
    5::597     6e-07  29%  668 aa  TKT2_PASMU RecName: Full=Transketolase 2;         Short=TK 2;      
  406::586     6e-07  27%  680 aa  TKT1_YEAST RecName: Full=Transketolase 1;         Short=TK 1;      
    5::597     6e-07  29%  668 aa  TKT1_PASMU RecName: Full=Transketolase 1;         Short=TK 1;      
   52::287     8e-07  25%  326 aa  ODPB_CHAGL RecName: Full=Pyruvate dehydrogenase E1 component
    4::188     1e-06  29%  663 aa  TKT2_VIBF1 RecName: Full=Transketolase 2;         Short=TK 2;      
   16::198     2e-06  30%  695 aa  TKT_SINMW RecName: Full=Transketolase;         Short=TK;       
    5::260     3e-06  26%  274 aa  TKTN_METJA RecName: Full=Putative transketolase N-terminal section;
   16::636     3e-06  26%  675 aa  TKTC_MAIZE RecName: Full=Transketolase, chloroplastic;       
   23::671     4e-06  27%  679 aa  TKTA_CRAPL RecName: Full=Transketolase 10;         Short=TK;       
    7::587     5e-06  31%  658 aa  TKT_STRPN RecName: Full=Probable transketolase;         Short=TK;  
  147::346     5e-06  25%  390 aa  ODBB_RAT RecName: Full=2-oxoisovalerate dehydrogenase subunit beta,
  147::346     5e-06  25%  390 aa  ODBB_MOUSE RecName: Full=2-oxoisovalerate dehydrogenase subunit
   16::198     7e-06  29%  694 aa  TKT_RHIME RecName: Full=Transketolase;         Short=TK;       
   14::282     7e-06  22%  328 aa  ODPB_STAPU RecName: Full=Pyruvate dehydrogenase E1 component
  185::278     7e-06  29%  326 aa  ODPB_MYCGE RecName: Full=Pyruvate dehydrogenase E1 component
    2::162     7e-06  28%  312 aa  FAS3_RHOFA RecName: Full=Uncharacterized 33.6 kDa protein in
    4::188     9e-06  28%  664 aa  TKT2_VIBCH RecName: Full=Transketolase 2;         Short=TK 2;      
    5::189     9e-06  28%  665 aa  TKT1_VIBCH RecName: Full=Transketolase 1;         Short=TK 1;      
    3::195     1e-05  28%  670 aa  TKT_ANASP RecName: Full=Transketolase;         Short=TK;       
   14::195     1e-05  33%  670 aa  TKTP_RALEH RecName: Full=Transketolase, plasmid;         Short=TK; 
    5::191     1e-05  30%  681 aa  TKT2_YEAST RecName: Full=Transketolase 2;         Short=TK 2;      
    5::542     1e-05  29%  664 aa  TKT1_VIBF1 RecName: Full=Transketolase 1;         Short=TK 1;      
   25::197     1e-05  27%  706 aa  DAS_CANBO RecName: Full=Dihydroxyacetone synthase;       
  198::262     2e-05  35%  441 aa  ODBA_DICDI RecName: Full=2-oxoisovalerate dehydrogenase subunit
   14::195     3e-05  32%  670 aa  TKTC_RALEH RecName: Full=Transketolase, chromosomal;       
  186::267     3e-05  29%  327 aa  ODPB_MYCPN RecName: Full=Pyruvate dehydrogenase E1 component
  132::256     3e-05  31%  326 aa  ODPA_RICFE RecName: Full=Pyruvate dehydrogenase E1 component
  125::184     3e-05  37%  345 aa  ODPA_ACHLA RecName: Full=Pyruvate dehydrogenase E1 component
  406::625     4e-05  25%  666 aa  TKT_BACHD RecName: Full=Transketolase;         Short=TK;       
  419::640     4e-05  27%  676 aa  TKT7_CRAPL RecName: Full=Transketolase 7;         Short=TK;        
  132::208     4e-05  31%  326 aa  ODPA_RICPR RecName: Full=Pyruvate dehydrogenase E1 component
   72::256     4e-05  26%  326 aa  ODPA_RICCN RecName: Full=Pyruvate dehydrogenase E1 component
  162::213     4e-05  42%  371 aa  ODPA_BACCE RecName: Full=Pyruvate dehydrogenase E1 component
  132::256     6e-05  30%  326 aa  ODPA_RICBR RecName: Full=Pyruvate dehydrogenase E1 component
   75::267     7e-05  30%  741 aa  TKTC_SPIOL RecName: Full=Transketolase, chloroplastic;       
   73::222     7e-05  23%  354 aa  ODPA_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component
  132::256     7e-05  30%  326 aa  ODPA_RICTY RecName: Full=Pyruvate dehydrogenase E1 component
   20::573     1e-04  27%  661 aa  TKT_PHYPO RecName: Full=Transketolase;         Short=TK;       
  425::575     1e-04  27%  662 aa  TKT_STAES RecName: Full=Transketolase;         Short=TK;       
  391::592     1e-04  20%  663 aa  TKT1_ECOLI RecName: Full=Transketolase 1;         Short=TK 1;      
  148::210     1e-04  33%  348 aa  ODPA_RHIME RecName: Full=Pyruvate dehydrogenase E1 component
  198::251     2e-04  37%  279 aa  Y4MO_RHISN RecName: Full=Putative uncharacterized transketolase
  425::575     2e-04  27%  662 aa  TKT_STAEQ RecName: Full=Transketolase;         EC=2.2.1.1;
   15::568     2e-04  29%  685 aa  TKT_SCHPO RecName: Full=Probable transketolase;         Short=TK;  
    3::148     2e-04  28%  252 aa  Y4304_PHOLL RecName: Full=UPF0271 protein plu4304;
  408::522     2e-04  29%  665 aa  TKT_BUCAP RecName: Full=Transketolase;         Short=TK;       
  474::690     3e-04  25%  729 aa  TKT_STRP8 RecName: Full=Transketolase;         Short=TK;       
  474::690     3e-04  25%  729 aa  TKT_STRP6 RecName: Full=Transketolase;         Short=TK;       
  465::665     4e-04  24%  668 aa  TKT_XANFL RecName: Full=Transketolase;         Short=TK;       
  156::213     4e-04  38%  371 aa  ODPA_BACSU RecName: Full=Pyruvate dehydrogenase E1 component
  160::211     4e-04  38%  369 aa  ODPA_BACST RecName: Full=Pyruvate dehydrogenase E1 component
  215::479     5e-04  28%  519 aa  TKTC_CRAPL RecName: Full=Transketolase, chloroplastic;       
  140::198     6e-04  32%  358 aa  ODPA_MYCGE RecName: Full=Pyruvate dehydrogenase E1 component
  144::222     6e-04  29%  227 aa  BIOD_CLOTE RecName: Full=Dethiobiotin synthetase;       
    1::637

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQNYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
DXS_PELUB       MQNYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
DXS_BRASO       ------LDTIKTPEDLRRLKVEQVRQVADELRQETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_MESSB       ------LNRVRFPSDLKQIPEEDLPQLAEELRAEMIDAVSQTGGHLGAGLGVVELTVALHYIFDTPHDRL
DXS_BRASB       ------LDTIKTPEDLRRLKVEQVRQVADELRQETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_RHOP5       ------LDTIRTPDDLRKLRIDQVQQVADELRLETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_NITHX       ------LDTIRTPADLRKLRVEQLRQVADELRKETIDAVSVTGGHFGAGLGVVELTTAIHYIFDTPRDRL
DXS_BRAJA       ------LDTIRTPDDLRKLKIEQVRQVADELRQETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_RHOPB       ------LDTIRTPADLRKLRIDQVRQVADELRQETIEAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_RHOP2       MSKTPLLDTIRTPDDLRKLRIDQVQQVADELRQETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_RHOPT       ------LDTIRTPEDLRKLRIDQVRQVADELRLETIDAVSVTGGHFGAGLGVVELTTALHYVFDTPRDRL
DXS_RHOPA       ------LDTIRTPEDLRKLRIDQVRQVADELRLETIDAVSVTGGHFGAGLGVVELTTALHYVFDTPRDRL
DXS_NITWN       ------LDTIRTPADLRKLKVEQVRQVADELRLETIDAVSVTGGHFGAGLGVVELTTAIHYIFDTPRDRL
DXS_RHOPS       MSKTPLLDTIRTPEDLRKLRVDQVQQVADELRQETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRL
DXS_SPHWW       ------LDTVSTPEDLRRLKPADLRQLADELRAEMISAVSVTGGHLGAGLGVVELTVALHYVFDTPRDVL
DXS_BRUO2       ------LDKVPTPDRLRALPERDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BRUSU       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BRUC2       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_RHILO       ------LDKVRIPADLRALDESELPQLASELRLELVDAVSRTGGHLGAGLGVVELTVALHYVFNTPDDRL
DXS_RHOCS       ------LDTVNTPEDLRKLDPSQLRQFADELRTETINAVSVTGGHLGAGLGVVELTVALHYVFNTPADRL
DXS_BRUME       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BRUMB       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BRUAB       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BRUA1       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BRUA2       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BEII9       ------LDTIATPTDLRRLKESDLAQLADELRTETIDAVSVTGGHLGAGLGVVELTVALHYVFDTPHDRL
DXS_BRUSI       ------------PDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAGLGVVELTVALHHVFNTPYDRI
DXS_BART1       ------LDRVCFPQDLRALPESYLVQLANELRTETIDAVSVTGGHLGAGLGVVELTVALHYIFNTPEDRI
DXS_OCHA4       ------------PEALRALPESDLPQLAQELRAELIDVVSTTGGHLGAGLGVVELTVALHHVFDTPHDRI
DXS_MARMM       ------LDTVNSPADLKNLPLDRLKSLADEVRAETIDAVSVTGGHLGAGLGVVELTTALHHVFDTPTDTL
DXS_BARQU       ------LDRICLPQDLRALPESDLVRLADELRTETIDAVSVTGGHLGAGLGVVELTVALHYVFNTPEDRI
DXS_RHIEC       ------LDQVTYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPNDRL
DXS_BARHE       ------------PQDLRAFPESDLARLADELRAETIDVVSVTGGHLGAGLGVIELTVALHYVFNTPEDRI
DXS_ERYLH       ------LDTVSYPEDLRKLEPGQLRQLSDELRAEMISAXXXXXXXXXXXXXXXXXTAAIHYVFNTPEDRL
DXS_AGRVS       --NTPLLDQVVFPSDLRKIEDKDMPQVARELRDEMIDAVSVTGGHLGAGLGVVELTLAIHKVFNTPEDRL
DXS_SPHAL       ------LDTVDVPADLRKLKPEDLRQFADELRAEMISAXXXXXXXXXXXXXXXELTTAIHYVFDTPRDKL
DXS_RHIME       ------LDKVDYPDDLKKIDDRDLPQLAAELRAEMVDAVSRTGGHLGAGLGVVELTIAIHKIFDTPHDRL
DXS_AGRRK       MPETPLLDQVHYPSDLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHNVFDTPNDRL
DXS_SILPO       ------LDQVTRPADLKRFSDAQLTQLAGELRAETVSAVSVTGGHLGAGLGVVELTVALHAVFDTPRDKV
DXS_AZOC5       ------LDTVRDASDVRRLPEEKLSQLADELRAETISAVSVTGGHLGAGLGVVELTVALHHVFNTPHDRL
DXS1_JANSC      ------LDNVQSPNDLKGLSDFDLKRLADELRAEMIWTVSKTGGHFGAGLGVVELTVALHSVFDTPRDKL
DXS2_ROSDO      ---------VHRPADMKGLSDRQLVQLADELRSETVSAVSVTGGHLGAGLGVVELTVALHAVFDTPRDKI
DXS_RHIL3       ------LDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRL
DXS_RHIE6       ------LDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRL
DXS_RHILW       ------LDQVTYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRL
DXS_HYPNA       ----RLLDAIDTPSDLKGRSRADLKQIAAXXXXXXXXXXXXTGGHLGSGLGVVELTVAIHSVFDTPDDKL
DXS_SILST       ------LDQIASPADLKRLSDAQLEQVAHELRQETISAVSVTGGHLGAGLGVVELTVALHSVFDTPKDKV
DXS_AGRT5       MPQTPLLDRVNFPSDLKEIDDRDLPELARELRDEMIDAVSKTGGHLGAGLGVVELTIAIHKVFNTPEDRL
DXS_BARBK       ------------PLDLRALPASDLARLADELRAEMIDVVSVTGGHLGAGLGVVELTIALHYIFNTPDDRI
DXS_GLUOX       ---YPELDRVRFPADMRNLSVDQLKQLADELRSETVDAVSTTGGHLGASLGVVELTVALHAVFNTPDDRI
DXS1_RHORT      ------LDTIRGPSDTRGLSVAQLEQLAREVRAEMIDAVSVTGGHLGSGLGVVELTVALHHVFDTPDDRI
DXS2_RHORT      ------LDTIRGPSDTRGLSVAQLEQLAREVRAEMIDAVSVTGGHLGSGLGVVELTVALHHVFDTPDDRI
DXS_XANP2       ------LDTIRDAADVRRLPQDKLAQLAAELRAETIDAVSVTGGHLGAGLGVVELTVALHHVFNTPHDRL
DXS_MAGSA       ------LDRVSSPADIRDFSIEELEQLTYEVRQEMIQSVSFTGGHLGAGLGVAELTVALHHIFDTPRDRL
DXS_CAUSK       ------LDTISSPADTRGFSVAELKQLASEVRAETIDAVSVTGGHLGAGLGVVELTVALHHVFETPKDIV
DXS2_RHOS4      ------LDRVTLPVDIKGLTDRELRSLADELRAETISAVSVTGGHLGAGLGVVELTVALHAIFDAPRDKI
DXS_NOVAD       ------LDTVKTPDDLRKLAPTQLRQLADELRVEMISAXXXXXXXXXXXXXXXXXTVAIHYVFNTPEDRL
DXS_PHEZH       ------LDTVSSPADTRGLSIAQLRQLADEVRAETIDAVSQTGGHLGAGLGVVELTVALHHVYETPKDIL
DXS_CAUCR       ------LDTIASPADTRGLSLAELKQLAAEVRAETIDAVSVTGGHLGAGLGVVELTVALHHVFETPKDIV
DXS_CAUCN       ------LDTIASPADTRGLSLAELKQLAAEVRAETIDAVSVTGGHLGAGLGVVELTVALHHVFETPKDIV
DXS_CAPAN       ---------INYPIHMKNLSLKELKQLADELRSDTIFNVSKTGGHLGSSLGVVELTVALHYVFNAPQDRI
DXS_ORYSJ       ------LDTVNYPIHMKNLSLKELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKI
DXS1_ROSDO      ------------PADLRSMSDTELRNVADELRAEVVEAVSQTGGHLGSSLGVVELSVAIHAVFDTPRDKL
DXS1_RHOS4      ------------PADMKALSDAELERLADEVRSEVISVVAETGGHLGSSLGVVELTVALHAVFNTPTDKL
DXS2_JANSC      ------LDQVNYPSDLRRMSNADLAQCADELRAEVISAVSETGGHLGSSLGVVELSVAIHAVFNTPYDKL
DXS_ARATH       ------LDTINYPIHMKNLSVKELKQLSDELRSDVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKI
DXS1_ZYMMO      ------LDKIKTPAELRQLDRNSLRQLADELRKETISAXXXXXXXXXXXXXXIELTVALHYVFNTPKDAL
DXS2_ZYMMO      ------LDKIKTPAELRQLDRNSLRQLADELRKETISAXXXXXXXXXXXXXXIELTVALHYVFNTPKDAL
DXS_RHOCA       ------LDRVTGPADLKAMSIADLTALASXXXXXXXXXXSQTGGHLGSSLGVVELTVALHAVFNSPGDKL
DXS_NITEU       ---YPLLDRIEIPAQLRTLKRNQLPQLADELRNFLVESVAGTGGHLSSNLGTVELTIALHYVFDTPFDRL
DXS_NITEC       ---YPLLDRIEIPAQLRNLKRSQLPQLADELRSFLIESVAKTGGHLSSNLGTIELTIALHYIFDTPFDRL
DXS_NATTJ       ----KLLSYINTSEDLKHLSTEDLNKLAEELREFLISSISITGGHLAPNLGVVELTLAIHKVFSPIQDKI
DXS_NITMU       ---HPLLNTITDPVKLRALDRKLLPQLADELRQFLVESVAKTGGHLSSNLGTVELTIALHYVFNTPYDRL
DXS_SERP5       ------------PDELRSLPKESLPKLCDELRQYLLDSVSRSSGHFASGLGTVELTVALHYVYQTPFDHL
DXS_SYNWW       ----EILNTINSPRDLKKLSLPEMTQLANEIRQLLVKSVAKCGGHLASNLGVVELSLALHTVFDSPEDKI
DXS2_GEOMG      ---YKLLDTITGPADLKNIPREELPGLADEIRRFLIETVSQTGGHLASNLGAVELSVALHYCFDSPADKL
DXS_HAEIG       MNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQL
DXS_ACTPJ       MQNYPLLSQINSPEDLRLLAKEQLQSVADELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQL
DXS_ACTP7       MQNYPLLSQINSPEDLRLLAKEQLQSVADELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQL
DXS_ACTP2       MQNYPLLSQINSPEDLRLLAKEQLQSVADELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQL
DXS_LARHH       MTSTPLLDTIQIPADLRELDRKQLPQLARELRDFLVDSVSQTGGHFASNLGSIELTIALHYVYNTPDDRL
DXS_HAEIE       MNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQL
DXS_MAGSM       ------LSTIDSPKALRQLNEAKLPQVAQEMRDHIIECVSQSGGHLGASLGVVELTIALHYVFNTPDDRL
DXS_PSEPG       ------------PAGLRRLAEADLETLADELRQELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_POLNA       ---YSLLETINSPADLRRLPRAQLKALADELRAYVIDSVSQTGGHLSSNLGTVELTVALHYVFNTPDDRL
DXS_HAEIN       MNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQL
DXS_PHOLL       ------------PEELRMLPKESLPKLCDELRQFLLNSVSRSSGHFASGLGTVELTVALHYVYKTPFDKL
DXS_PASMU       MQNYPLLSLINSPEDLRLLSKEQLPQICQELRAYLLESVSQSSGHLASGLGTVELTVALHYVYKTPFDQL
DXS_PECCP       ---YPTLALVETPDELRLLPKDSLPKLCDELRQYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDHL
DXS_HAEI8       MNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQL
DXS_PSEPK       ------------PAGLRRLAEADLETLADELRQELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_PSEP1       ------------PAGLRRLAEADLETLADELRQELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_ERWCT       ---YPTLALVETPDELRLLPKESLPKLCDELRQYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDHL
DXS_PROMH       IEKYPTLALVETPEDLRLLPKESLPKLCDELRLYLLNSVSRSSGHFASGLGAIELTVALHYVYKTPFDNL
DXS_CUPTR       ---YALLNKIDAPADLRKLDRRELQTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFNTPDDRL
DXS_ACIAC       --SFPLLQTVNDPADLRRMSRAQLKELAAELRAFVLDSVSKTGGHLSSNLGTVELTVALHTVFDTPRDRL
DXS_PSEPW       ------------PAGLRRLAEADLEHLADELRQELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_PSEMY       ------LDSANTPDELRRLAEADLETLADELRQYLLYSVGQSGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_BURCJ       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_BURS3       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_METPP       MKSYPLLSTIDQPADLRGLSRAELKQLAQELRDHVLTSVSQTGGHLSSNLGTVELTIALHHVFNTPQDRL
DXS_HALOH       ---------VNSPEDLKSLNIEDLNSLAQEVRKFIIETVADTGGHLASNLGVVELTLALHYHLNSPKDKI
DXS_RALEJ       ---YALLKKIDAPADLRKLDRRELRTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFHTPDDRV
DXS_DIAST       --NYPLLERVNDPADLRRLPRAELKALATELRAFVLESVSKTGGHLSSNLGTVELTVALHAVFDTPRDRL
DXS_BURP6       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS1_GEOSL      ------LDTITCPADLKKIPRDQLPALAEEIRAFLLETVSRTGGHLASNLGVVELSIALHYCFDSPTDRF
DXS_THETN       ------LEQINSPYDLKKLDIKDLPRLSEEIRQFIVEKVSKTGGHLASNLGIVELTLALHYVFNSPVDKI
DXS_COLP3       LADYPLLSQINIPEDLRNMPQEQLTRISNELRSFLLNSVSKSSGHFASGLGTIELTVALHYVYNTPFDHL
DXS_POLSJ       ---YPLLETINSPADLRRLPRAQLKALADELRAFVLDSVSKTGGHLSSNLGTVELTVALHYVFNTPEDRL
DXS_BURCM       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_RALME       ---YTLLNKIDDPADLRKLDRRQLDTLAEELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFDTPNDRV
DXS_PSEU2       ------------PHGLRRLGEAELETLADELRLELLYSVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_DESAP       ------LDGISHLTDLRALTPDQLDELAAELRDLIVSTVSRTGGHLAPNLGVVELTLALHYVFRAPDDRI
DXS_BURPS       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_BURP1       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_BURP0       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_BURMA       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_BURA4       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_PSEFS       ------------PVGLRRLGEAELETLADELRLELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_HAEDU       MQNYPLLSQIDSPEDLRLLGKEDLSALANELRTYLLDSVSQTSGHLASGLGVVELTVALHYVYQTPFDQL
DXS_PSESM       ------LDQADTPHGLRRLGEAELETLADELRLELLYSVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_CHRVO       ---YPLLENINSPADXXXXXXXXXXXXAGELREFLVESVSKTGGHFASNLGSIELTIALHYVFDTPHDRL
DXS_YERE8       ------------PEELRMLPKESLPKLCDELRQYLLASVSRSSGHFASGLGVVELTVALHYVYNTPFDSL
DXS_BURTA       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_BURCH       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_BURCC       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_BURCA       -----------------------------ELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRI
DXS_PELCD       ------LKNLKSPAELKGLSVKELEVLAGEIRTKIIDTVSQTGGHLASSLGVVELTIALHHVLNTPVDKI
DXS_PELTS       ----RLLEQISSSRDIRSLTFKQLNELAGEIRQVLINTVSKTGGHLAPNLGVVELTLGLHRVFHSPVDKI
DXS_BURXL       -----------------------------ELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFDTPHDRI
DXS_PSEPF       ----------NTPDGLRRLGEAELETLADELRLELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_PSEF5       ------------PDGLRRLGEAELETLADELRLELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_HAEPS       -KTYPLLSQINSXXXXXXXXXXXXXXXCDELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQL
DXS_YERPS       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_YERPB       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_METFK       ---YELLESINSPEDLRRLDRKELHELARQLRAFLINSVAQTGGHLSSNLGVVELTIALHYVFNTPEDRV
DXS_PSEE4       ------------PAGLRRLAEADLETLADELRQDLLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_YERPY       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_YERP3       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_PSE14       ------------PHGLRRLGEAELETLADELRLELLYSVGQTGGHFGAGLGVIELTIALHYVFDTPDDRL
DXS_BURP8       -----------------------------ELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFDTPRDRI
DXS_SODGM       IKKYPTLVLADNPMELRQLPKESLVALCDELRQFLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_ALTMD       LQHYPTLALAQTPDKLRQLPQDKLRELADELREYLLNSVSQTSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_LEPCP       MNAQPLLPRIQSPADVRRLSRAELKQLADELREFVLQSVSRTGGHLSSNLGTVELTVALHHVFDTPEDRL
DXS_BREBN       ------LTTINDPQDLKKCTQPQLHTLASEIRQFLIETLSKTGGHLAPNLGVVELTLALHYVFDSPKDKL
DXS_PHOPR       ISKYPHLALANTPDELRLLPVESLPEVCDELRTYLLNSVSQSSGHFASGLGAVELTVALHHVYNTPFDHL
DXS_ESCF3       ---YPTLALVDSPQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_BACHD       ------LEKLHDPSLIKSMTKQELEQLAEEIRQFLIEKLSITGGHLGPNLGVVELTLALHSLFDSPKDKL
DXS_AZOSE       MPPYPLLHRIDSPFDLRKLDXXXXXXXXXXXXXXXIESVSKTGGHLSSNLGTVELSIALHYIFDTPEDRI
DXS_YERPP       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_YERPN       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_YERPG       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_YERPE       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_YERPA       ------------PEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_ERWT9       --------------ELRLLPKESLPTLCDELRQYLLDSVSRSSGHFASGLGVVELTVALHYVYNTPFDHL
DXS_SHISS       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_CITK8       ---YPTLALVDSTSELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ACISJ       MTNYPLLERVNDPADLRRLPRAELKTLAHELRAFVLESVSKTGGHLSSNLGTVELTVALHAVFDTPRDRL
DXS_IDILO       -QQYPLLDKINSPADLRRLPRTQLPELCAEIRQFLLTSVSQSSGHLASGLGTVELTVALHYVYHTPEDKL
DXS_RALEH       ---YALLNKIDAPADLRKLDRRELRTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFNTPDDRL
DXS_SHIDS       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_PSEA7       ------------PAELRRLGEADLETLADELRQYLLYTVGQTGGHFGAGLGVVELTIALHYVFDTPDDRL
DXS_DESPS       ------LDRVDSPKDIRQLTHDDLIILAAEIREKIIDTVSKTGGHLAPSLGVVELTLALHYVFNTPTDKL
DXS_KLEP3       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_ECOLI       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECODH       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOBW       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SHIBS       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SHIB3       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_KLEP7       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_ECOUT       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOSM       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOL6       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOK1       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO81       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO7I       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO5E       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO57       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO45       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_HAES2       MNKYPLLSLINSPDDLRLLSKDKLPQLCQELRSYLLESVSQSSGHLASGLGTVELTVALHYVFKTPFDQL
DXS_HAES1       MNKYPLLSLINSPDDLRLLSKDKLPQLCQELRSYLLESVSQSSGHLASGLGTVELTVALHYVFKTPFDQL
DXS_VIBPA       ISKYPTLALANTPEELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPVDKL
DXS_VIBF1       ISKYPILALANTPDELRSLPKESLPALCDELRTYLLNSVSKTSGHLASGLGVVELTVALHYVYNTPFDQL
DXS_SHIFL       ---YPTLALVDSTQELRLLPNESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOSE       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOLC       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOL5       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECOHS       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO8A       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO24       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_VIBSL       ISKYPTLALADKPEDLRLLPKETLTQLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQL
DXS_VIBCM       ISKYPTLALANTPDELRSLPKEVLPKLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHL
DXS_VIBCH       ISKYPTLALANTPDELRSLPKEVLPKLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHL
DXS_VIBC3       ISKYPTLALANTPDELRSLPKEVLPKLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHL
DXS_MANSM       MQNYPLLSLINSPEDLRLLNKDQLPQVCNELREYLLESVSRTSGHLASGLGTVELTVALHYIFKTPFDQL
DXS_ECOLU       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_DESHY       ------LAKIEQPRDLKGLTYPELEQLAQEIRAEMIDVVSANGGHLAPNLGVVELTLALHRVFDSPKDKI
DXS_AZOSB       MSPYPHLERIGSPADLRATERRELAQVASELRAFLIESVSKTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_VIBFM       ISKYPILALANTPDELRSLPKESLPALCDELRTYLLNSVSKTSGHLASGLGVVELTVALHYVYNTPFDQL
DXS_RHOFD       --SYPLLHTINDPADLRLVPRAQLGALADELRAYLLHSVAKTGGHLSSNLGTVELTVALHYVFNTPHDRV
DXS_PSEAE       ------------PAELRRLGEADLETLADELRQYLLYTVGQTGGHFGAGLGVVELTIALHYVFDTPDDRL
DXS_PSEAB       ------------PAELRRLGEADLETLADELRQYLLYTVGQTGGHFGAGLGVVELTIALHYVFDTPDDRL
DXS_PSEA8       ------------PAELRRLGEADLETLADELRQYLLYTVGQTGGHFGAGLGVVELTIALHYVFDTPDDRL
DXS_DECAR       ----RLLETINSPADLRRLDRKQLPQLASELRAFLIDSVSKTGGHLSSNLGTVELTIALHAVFNTPEDRL
DXS_CARHZ       ------LERISLPEDIKKLKPSELMALAQELREYIITVASQNGGHLAPSLGVVELTIALHFVFEAPKDKI
DXS_ALISL       ISKYPILALANTPDELRSLPKESLPALCDELRAYLLKSVSKSSGHLASGLGVVELTVALHYVYNTPFDQL
DXS_NOSP7       ------LSEITHPNQLHGLSVRQLQQIARQIRDKHLQTVAVNGGHLGPGLGVVELTLGLYQTLDLDRDKV
DXS_SALPK       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALPA       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ECO27       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_AERS4       ISNFPNLALADTPVELRSLPFERLPLLCNELREYLLRSVSRSSGHLASGLGTVELTVALHYVYNTPFDRL
DXS_DESHD       ------LAKIEQPRDLKGLTYPELEQLAQEIRAEMIDVVSANGGHLAPNLGVVELTLALHRVFDSPKDKI
DXS_SALTI       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALTY       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALSV       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALPC       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALPB       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALNS       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALHS       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALG2       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALEP       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALDC       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALCH       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SALA4       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_HELMI       ----QILSRISNPGDLQRLSATELDQLAKEIREVIIQTTSKNGGHLAPNLGVVELTLALHLVFQSPKDKI
DXS_HAMD5       -EKYPTLALAETPESLRLLPKESLPELCSELRSYLLDAVSQSSGHFASGLGVIELTLALHYVYKTPFDHL
DXS_ALKOO       ---YKYLMEINSIEDFKKLNSNEIKVLAEEIRHFLIESVSKTGGHLASNLGVVELTLALHQAFNSPEDKI
DXS_SALAR       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_BORA1       ------LDRIHSPADLRKLDRRDLKPIADELRAFVLESVSKTGGHLSSNLGTVELTLALHYVFDTPHDRI
DXS_VEREI       --SFPLLETIDDPAQLRQLARAQLKVLAAELRGFVLESVSRTGGHLSSNLGTVELTVALHHVFQTPHDRL
DXS_CELJU       ------LDSIDSPAELRALSEKQLPQLADELRAFLLYTVGQTGGHFGAGLGVVELTIALHYVYDTPEDRL
DXS_NITOC       --SYPLLEQIDSPERLRRLPESDLETLAEELRDFLLHSVARSGGHLAAGLGTIELTIALHYIFATPEDRL
DXS_AERHH       ISNFPNLALADTPVELRSLPFERLPVLCNELREYLLRSVSRSSGHLASGLGTVELTVALHYVYNTPFDRL
DXS_HAHCH       ----------------------------------LLYSVGQSGGHFGAGLGVVELTVALHYAFNTPEDRL
DXS_ENT38       ---YPTLALVDSTQELRLLPKESLPKLSDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_ENTS8       ---YPTLALVDSTAELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_PSEHT       ---YPLLNLVNEPAHLRDLAQDKLPAFSHELRDYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPDDRL
DXS_ECO55       ---YPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_AQUAE       LEKYEILKDYKGPFDIKNYDYETLQKLAQEVRDYIINVTSKNGGHVGPSLGVVELTIALLRVFNPPEDVI
DXS_BORPA       ----ELLDRILSPADLRQLDRRELKRLADELRGFVLESVSRTGGHLSSNLGTVELSLALHYVFDTPHDRI
DXS_BORBR       ----ELLDRILSPADLRQLDRRELKRLADELRGFVLESVSRTGGHLSSNLGTVELSLALHYVFDTPHDRI
DXS_SHEHH       ISQFPVLAQANTPDELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_BAUCH       IKRYPTLDLADNPIKLRLLPKESLLTLCDELRQFLLTSVSGSSGHFASGLGTVELTVALHYVYNTPFDNV
DXS_CYAP8       ------ISDITHPNQLHGLSIRQLEDVARQIREKHLQTIAATGGHLGPGLGVVELTIALYQTLDLDRDKV
DXS_BORPE       ----ELLDRILSPADLRQLDRRELKRLADELRGFVLESVSRTGGHLSSNLGTVELSLALHYVFDTPHDRI
DXS_SYNAS       ------LSRIQFPEDIRMLDIGDLTLLASDIRSAIIETVSRTGGHLASSLGTVELTLAVHKVFDTPKDRV
DXS_PSYIN       LKNYPLLTNINYPEDLRLLKKEQLPAFCNELRSFLLNTVSQTSGHLASGLGVVELTVALHYIYRTPFDNL
DXS_VIBHB       ISKYPTLALANTPEELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPVDQL
DXS_PSEU5       -------------------------------------SVGRTGGHFGAGLGVIELTIALHYVYDTPDDRL
DXS_MARMS       ------LDEVNSPADLRAFKKEQLPALVRELREFMLYSVGQTGGHFGAGLGVVELTVALHYLYNTPEDRI
DXS1_GEOMG      ------LDTIESPCDLKGVTQRELAQLAAELREKIITVCARNGGHLAPSLGVVELTLALHRVFDSPADKI
DXS_PSEA6       LAHYPLLALADTPEQLRELPQDKLKQVAKELRQYLLTSVSQSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_EDWI9       --------------------KESLPTLCDELRQYLLNSVSRSSGHFASGLGAVELTVALHYVYQTPFDSL
DXS_SHEDO       ISKFPVLAKANTPEDLRKLPQNMLSQVSTELRQFLLQSVGNSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_CHLTE       -QAYPLLSSIHSPADLKKLSLHELELVAAECRKKVIELVSQNGGHFGSSLGVVELTVALHYVYQSPTDRI
DXS_SHESW       ISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_SHEPC       ISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_FRAP2       MSKYTILDKINTPSDLKLVPEGQLKELASELRTFLVDTLDVSGGHFASSLGATELTVALHYVFNTPYDNI
DXS_FRATO       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_FRATH       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_FRATF       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_CYAP4       ------LSEITHPNQLHGLSIQELKQIARQIRDKHLETVAATGGHLGPGLGVVELTLGLYQTLDLDRDRV
DXS_FRATN       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_FRATW       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_FRATT       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_FRAT1       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPYDNI
DXS_BACSK       ------LEEIQDPSFLKNYSNKQLEELAADIRRFLIEKLSATGGHIGPNLGVVELTLALHQLFDSPKDKL
DXS_FRATM       MSKYTILDKINTPSDLKLIPESQLKILSAELRAFLVDTLDVSGGHFASSLGATELTVALHYVYNAPDDNI
DXS_BORPD       ----ELLDRIHSPDDVRQLDRRELKALAEELRGFVLESVSRTGGHLSSNLGTVELTLALHRVFDTPHDRI
DXS_VIBVY       ISKYPTLALAETPDELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQL
DXS_VIBVU       ISKYPTLALAETPDELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQL
DXS_METCA       -KRYALLEAADHPAALRNLPEDRLPELAEELRGYLLESVSRSGGHLAAGLGTVELTIALHYVFNTPEDKL
DXS_CYAP7       ------LSEITHPNQLHGLSIRQLEDIARQIREKHLQTVATSGGHLGPGLGVVELTIALYQTLDLDRDKV
DXS_SHESH       ISNYPVLAQANTPDELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_BLOPB       ---YPILGLINTPKELRQLSEDHLAKLCNELRQFLLTSVSKSSGHFASGLGTIELTVALHYVYNTPFDYL
DXS_THEEB       ------LSELTHPNQLHGLSIAQLTQIAAQIRDKHLETVAATGGHLGPGLGVVELTLALYQTLDLEKDRV
DXS_DEHSB       ----KLLDTINSPSDLKKLSLDELRELAVQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKI
DXS_DEHE1       LQMSKLLDTINSPSDLKKLTLDELRELAVQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKI
DXS_SACD2       --NTPLLDVVDTPARLRELSEKQLPQLAKELREYLLYTVGQTGGHFGAGLGVVELTVALHYVLNTPDDRL
DXS_DEHSC       ----KLLDTINSPSDLKKLSLDELRELAVQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKI
DXS_ACAM1       ------LSEIVHPNQLHGLSISELKQIANQIREKHLDTVATSGGHLGPGLGVVELTLALYQTLDLDQDKV
DXS_SHEPW       ISQFPVLAQANTPDELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVAIHYVYNTPFDRL
DXS_ANASP       ------LSEITHPNQLHGLSXXXXXXXXXXXXDKHLQTVAEFGGHLGPGLGVVELTLGLYQTLDLDRDKV
DXS_SHEWM       ISQYPVLAQANTPDELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_ANAVT       ------LSEITHPNQLHGLSXXXXXXXXXXXXDKHLQTVAEFGGHLGPGLGVVELTLGLYQTLDLDRDKV
DXS_THIDA       ------LDTIESPADXXXXXXXXXXXXXXXVRAFLIDSVAGTGGHLASNLGAVELTLALHYVFDTPRDRI
DXS_SYNR3       ------LSELSHPNELHGLSSSELEDVARQIREKHLKTVSTSGGHLGPGLGVVELTLALYQTLDLDHDRV
DXS_RALPJ       ---------------------------ANELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFNTPEDRI
DXS_PROM9       ------LSELSHPNELHGLTVSQLEEIACQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDSDRV
DXS_CLOBA       ------LDSLNFPKDLKNLSDSDTEILSKEIRQFLIESVSKTGGHLSSNLGVVELTLSLMKSFDFEKDKI
DXS_SYNE7       ------LSEITHPNQLHGLSVAQLEQIGHQIREKHLQTVAATGGHLGPGLGVVELTLALYQTLDLDRDKV
DXS_RALSO       ---YELLNTIDAPAELRRLDRRQLGTLADELRAFVLESVAQTGGHLSSNLGTVELTIALHYVFNTPDDRI
DXS_SHEFN       ISKFPVLAKANTPEELRKLPQGLLPQVSDELRQFLLQSVAISSGHFASGLGTVELTVALHYVYNTPFDQL
DXS_SHEAM       ISNYPLLALASTPEELRQLPQSALKQLSDELRQFLLTSVGISSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_CYAA5       ------LSDITHPNQLHGLSNRQLEDIARQIREKHLQTIAASGGHLGPGLGVVELTIALYQTLDLDRDKV
DXS_SYNP6       ------LSEITHPNQLHGLSVAQLEQIGHQIREKHLQTVAATGGHLGPGLGVVELTLALYQTLDLDRDKV
DXS_SHEPA       ISQFPVLAQANTPDELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_BACP2       ------LLSIKNPTFLKGMSNAELEELSADIRMFLIESLANSGGHIGPNLGVVELTVALHKVFDSPKDKF
DXS_MOOTA       ------LEKINEPAAIKKFTLAELDILAREIRQELVQTVARTGGHLAPNLGVVELTLALHSVFDLPRDKI
DXS_MICAN       ------LSEITHPNQLHGLSLRQLEDIARQIREKHLQTIAATGGHLGPGLGVVELTIALYQTLDLDRDKV
DXS_CLOB8       ------LDKLNFPEDLKKLNEEDYKVLSSEIRKFLIDSVSKTGGHLASNLGVVELTLSLFKAFSFDKDKI
DXS_ANADF       ----RLLDSIDSPLDLKRLPVDDLPRLCEEIREEIIQTCAKNGGHLGSSLGAVELNVALHYVYSSPTDKL
DXS_STRMK       ---YPRLARIQTPDDLRTFDESELRAVADELRAYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_SYNY3       ------ISELTHPNELKGLSIRELEEVSRQIREKHLQTVATSGGHLGPGLGVVELTVALYSTLDLDKDRV
DXS_LYSSC       ------LNKITSPSFLKNLNKKELEQVAQEIRTFLIEKCSVTGGHIGPNLGVVELTMMLHKMFDSPKDKF
DXS2_GEOSL      ----RILDRVDSPSDLKGLTTAELGILAEEIRQEIITVCSRNGGHLAPSLGVVELTLALHRVFTSPEDKI
DXS_SYNPW       ------LSDLAHPNELHGLSVAELQDVAKQIRERHLEVVSNSGGHLGPGLGVVELTLALYQTLDLDKDRV
DXS_PROMT       ------LSQLSHPNELHGLAISELEDVACQIRERHLQVVSTSGGHLGPGLGVVELTIALYQTLDLDVDKV
DXS_DICT6       ------LQKINSPKDLKRLSIDELKTLSAEIREIIINTVENNGGHLASNLGTVELTLALHYVFDTPEDKI
DXS_PROMP       ------LSELSHPNQLHGLTVSQLEEIACQIRERHLEVVSTSGGHLGPGLGVVELTLALYQTLDLDFDKV
DXS_PROM1       ------LSQLSHPNELHGLAISELEDVACQIRERHLQVVSTSGGHLGPGLGVVELTIALYQTLDLDVDKV
DXS_THERP       -----YLERIDSPQDLKRLSPXXXXXXXXXXXXXXXXXXGKTGGHFAPNLGTVELTLALHYVFDSPRDKI
DXS_TRIEI       ------LSEITHPKQLHNLSIHQLEEIARQIREKHLETVATSGGHLGPGLGVVELTLGLYQTLNLDRDKV
DXS_CYTH3       IQPGELLRTIHSPEELRKLDETQLIQVSEELRQFIVDNVSVYGGHFAASLGVVELTVALHYVFNTPVDQL
DXS_GEOTN       ------LTKIEHPRVVKTMSIPQLKQLSADIRRFLIEKLSKTGGHIGPNLGVVELTIALHREFDSPKDKL
DXS_SYNS3       ------LSELTHPNQLHGLSETQLEAVAKQIRERHLEVVSNSGGHLGPGLGVVELTLALYQTLDLDRDKV
DXS_SHEB9       ISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGISSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_LISIN       ---YLDLLKIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYTFNSPNDKF
DXS_CLOBB       ------LDSLNFPKDLNNLNDSDTERLSKEIRQFLIESVSKTGGHLSSNLGVVELTLSLMKSFDFEKDKI
DXS_SHEB8       ISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGISSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_SHEB5       ISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGISSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_SHEB2       ISQFPVLAQANTPNELRQLPQALLPQVADELREFLLKSVGISSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_GEOSW       ---------IKNPRFLKNMSTKQLIELSADIRKFLIEKLSKTGGHIGPNLGVVELTIALHKVFDSPKDKL
DXS_METI4       ----KLLDRIDSPADLKKLQVSELTKLAEEIRQEMITVLSKCGGHLGPNLGVVELTLALHYVFDVPRDHF
DXS_ALCBS       --NTPLLDTLASPADLRKLPTPQLERVVDELREYLLYAVGQCGGHFGAGLGVVELTVALHYLYHTPDDKL
DXS_THISH       -ESYPLLSRIGSPSDXXXXXXXXXXXXXXXXXXFLLESVSSTGGHLASNLGTVELTIALHYVFNTPDDRL
DXS_GEOKA       ---------IDHPRVVKNMSIPELKRLSAEIRRFLIEKLSKTGGHIGPNLGVVELTIALHREFDSPKDKL
DXS_LISW6       ------LLKIKDPSFMKQLDIKELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYTFNSPKDKF
DXS_LAWIP       ------LSHISNPCDIQKLSLQDKLTLAEELRSIIIKTVSNNGGHLAPSLGVIELTLALLATFNPAEDKL
DXS_BACA2       ------LLSIQDPSFLKKMXXXXXXXXXXXXRNFLITSLSASGGHIGPNLGVVELTIALHKEFDSPKDKF
DXS_GLOVI       ------LSDLSHPNQLRDLSVSQLGRLAQQIRDKHLQTVAATGGHLGPGLGVVELTLALYKTXXXXXXXX
DXS_MACCJ       ---------IKDPSFLKDLSYEELDGLSQDIRTFLIEKCAVTGGHIGANLGVVELTIALHKVFNSPKDKL
DXS_SHESR       ISQFPVLAQANTPNELRXXXXXXXXXXXDELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_SHESM       ISQFPVLAQANTPNELRXXXXXXXXXXXDELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_PROMA       ------LSDVSHPNQLHGLTTAQLEDVACQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDHDKV
DXS_SYMTH       ------LRDLTGPEQLKRXXXXXXXXXXXXIRRVILETVATNGGHLAPNLGVVELTLALHIVFDSPRDKI
DXS_SHESA       ISQFPVLAQANTPNELRXXXXXXXXXXXDELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_DESDG       ------LDSIQHPTDVAKLDADQLRQLADELRERIIGTVSQNGGHLAPSLGVVELTLALLSVFNPDKDKF
DXS_BACLD       ------LLSIKDPAFLKXXXXXXXXXXXAEIRRFLIETLSESGGHIGPNLGVVELTIALHKEFDSPKDKF
DXS_PROM5       ------LSELSHPNQLHGLTVSQLEEIACQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDFDKV
DXS_SHELP       ---YPVLAQADTPDELRQLPQGVLPKLADELRSYLLQSVGISSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_BACWK       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACHK       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACCZ       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACC7       ------LTQIQNPSFLKEMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACC0       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACAN       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACAC       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_BACAA       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_XANCP       ---YPRLSRIQTPDDLRTFEEADLTAVADELRAYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_XANC8       ---YPRLSRIQTPDDLRTFEEADLTAVADELRAYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_XANOR       ---YPRLSRIHTPDDLRRFDEAELTVIAEELRSYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_XANOP       ---YPRLSRIHTPDDLRRFDEAELTVIAEELRSYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_XANOM       ---YPRLSRIHTPDDLRRFDEAELTVIAEELRSYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_BACC2       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKF
DXS_BACC1       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKF
DXS_SYNSC       ------LGDLKHPNELHGLSPAQLEDVARQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDQDRV
DXS_BACCR       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKF
DXS_BACC4       ------LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKF
DXS_PROMS       ------LSELSHPNQLHGLTVSQLEEIACQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDFDKV
DXS_ANASK       ----RLLDTIDSPTDLKKVPVEQLPALCQEIREQIIQTCARNGGHLGSSLGAVEINVALHHVFSSPQDKL
DXS_SYNP2       ------LSEITHPNQLHGLTVRQLEEIARQIREKHLQTIAASGGHLGPGLGVVELTLALYQTLDLDRDKV
DXS_PROM0       ------LSELSHPNQLHGLTVSQLEEIACQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDFDKV
DXS_ACIBY       ------LDAIDHPQQLRQLEHSQLLQVADELRQYILYAAGQSGGHFGANLGVVELTVALHYCFNTPNDRL
DXS_SYNJA       -------------------------------------ANSPVGCHLGPGLGVVELTLALYKTLDLDRDKV
DXS_ACIBS       ------LDAIDHPQQLRQLEHSQLLQVADELRQYILYAAGQSGGHFGANLGVVELTVALHYCFNTPNDRL
DXS_ANAD2       ----RLLDTIDSPTDLKKVPVEQLPALCQEIREQIIQTCARNGGHLGSSLGAVEINVALHHVFSSPQDKL
DXS_SHEON       ISQFPVLAQANTPNELRXXXXXXXXXXXDELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRL
DXS_PROM3       ------LSELTHPNQLHGLSIAELEDVARQIRERHLEVVSTSGGHLGPGLGVVELTLALYQTLDLDHDRV
DXS_PROM2       ------LSELSHPNQLHGLTVSQLEEIACQIRERHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDFDKV
DXS_XANC5       ---YPRLSRIQTPDDLRRFDEAELTAIAEELRSYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_PROMM       ------LSELTHPNQLHGLSIAELEDVARQIRERHLEVVSTSGGHLGPGLGVVELTLALYQTLDLDHDRV
DXS_CLOP1       -------------------------------REFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRI
DXS_WIGBR       ---FSILKKINNPIELRKLPKKKLIFLCEELREFLIDXXXXXXGHFASGLGVIELTVALHYIYNTPFDYL
DXS_CLOPE       -------------------------------REFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRI
DXS_CLONN       --------------ELRKMSFSDLDKFAQEIRNFLINKISKTGGHLASNLGVVELTLALYKVFDLDKDKI
DXS_CLOAB       ---YNILDNYEDVDDIKNMSSDELKEFASEIRKFLIDKISKTGGHLASNLGVVELTLSLHKVFNLKKDKI
DXS_ACIC5       ------LNSIHSPADIKHFSVPQLEALAQEIRDRLIQSVARTGGHIGPNLGVVELTIAMHYVFDTPQDRF
DXS_DICTD       ------LQKIESPKDXXXXXXXXXXXXXXXXREIIINTVENNGGHLASNLGTVELTLALHYVFDAPKDKI
DXS_XANAC       ---YPRLSRIQTPDDLRRFDEAELTAIAEELRSYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPVDQL
DXS_SYNS9       ------LGDLKHPNELHGLSLAELEDVARQIRERHLDVVSTSGGHLGPGLGVVELTIALYQTLDLDRDKV
DXS_CLOK5       LDNYK---DVN---DIKKMSLDEKKQLALEIREFLIENVSKTGGHLASNLGVVELTLSLFSIFDLNHDKL
DXS_CLOK1       LDNYK---DVN---DIKKMSLDEKKQLALEIREFLIENVSKTGGHLASNLGVVELTLSLFSIFDLNHDKL
DXS_ANADE       ----RLLDTIDSPADLKKVPVEQLPALCQEIRELIIQTCARNGGHLGSSLGAVEINVALHHVFASPQDKL
DXS_DESVV       ------LARIQRPTDVAGLSADDLRTLAADLRTAIIDTVSKNGGHLAPSLGVVELTLAMLSTFDPGKDKV
DXS_DESVH       ------LARIQRPTDVAGLSADDLRTLAADLRTAIIDTVSKNGGHLAPSLGVVELTLAMLSTFDPGKDKV
DXS_BACSU       ------LLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPNLGVVELTVALHKEFNSPKDKF
DXS_CLOPS       ----------------------------------LIESVSNTGGHFASNLGVIDLTVALFKNFDFSENRI
DXS_CLOD6       ---YKYLDKVNSPKNIKNMSIEEMDLLAKDIRKFLVKSVSKTGGHLASNLGVVELTLALHKVFDSPKDKI
DXS_ACIAD       ------LDEIDHPQQLRQLEQSQLTQVADELRQFILYAAGQSGGHFGANLGVIELTVALHYCFNTPHDRL
DXS_XYLFT       ---YPRLSRIQTPEDLRAFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDQL
DXS_XYLFM       ---YPRLSRIQTPEDLRAFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDQL
DXS_XYLF2       ---YPRLSRIQTPEDLRAFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDQL
DXS_BLOFL       LNKYSILELIDTPTELRQLTENKLQTLCSELRLFLLNSVSKSSGHFASGLGTIELTVALHYVYNTPFDHL
DXS_ALHEH       IDDYPLLAQVPDPEALRTLPAHRLPALAKELRHYLLHSVARSGGHLAAGLGAVELTLALHYVFNTPEDRL
DXS_XYLFA       ---YPRLSRIQIPEDLRTFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDHL
DXS_SYNPX       ------LGDLTHPNELHGLKLSELEDVARQIRDRHLQVVSTSGGHLGPGLGVVELTLALYQTLDLDRDRV
DXS_SYNJB       -------------------------------------ANSPVGCHLGPGLGVVELTLALYKTLDLDRDKV
DXS_BACCN       ------LTQIQNPSFLKDMSIXXXXXXXXDIRKFLIEELSQTGGHIAPNLGVVELTIALHTLFDSPKDKF
DXS_CLOPH       ----KILDEINQPNDIKKISAKKYTQLAAEIRRFLIANVSKTGGHLASNLGVVELTMALHLFLDFPEDKL
DXS_NEIMA       ---------IDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTVALHYVYNTPEDKL
DXS_NEIM0       ---------IDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKL
DXS_PROM4       ------LSELSHPNQLHGLTIAQLEDIACQIRERHLQVVSTSGGHLGPGLGVVELTIALYQTXXXXXXXX
DXS_EXIS2       ------LTEIQDPSFLKRMSVSELELFAGDIRRFLIEELATTGGHLAPNLGVVELTLALHREFDSPNDKF
DXS_NEIG1       ---------IDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKL
DXS_LISMO       ---YLDLLKIKDPSFMKRLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKF
DXS_NEIMB       ---------IDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKL
DXS_NEIG2       ---------IDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKL
DXS_CHRSD       ------------PAALHDFNATQLRQLADELRAYLLYSVGCTGGHFGAGLGVVELTVALHHILDTPYDRL
DXS_CLOTE       --------------DIKNMSLDELNLLSRELRNFIIESVSQNGGHLASNLGVVELTLSLYNVFDFSYDKL
DXS_LISMF       ---YLDLLKIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKF
DXS_LISMC       ---YLDLLKIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKF
DXS_AZOPC       ISDYSLLFKINSPEDLRKLAIEQVEQVCKELREYIIEVLSENPGHLGSNLGTVELTVALHYVFNTPYDRI
DXS_PROVI       ------LDTINSPRDLKKLSIRQLETLANECRHELINLISLNGGHFASSLGVTELSVALHHVYNTEKDRI
DXS_LEPBL       -QESTLLDKIDYPADLRNIPLEKLPQVCKEVRNYIIDTLSGVGGHFASNLGVVELTVALHYVFDTPKDRL
DXS_LEPBJ       -QESTLLDKIDYPADLRNIPLEKLPQVCKEVRNYIIDTLSGVGGHFASNLGVVELTVALHYVFDTPKDRL
DXS_PELLD       ---------------------------ADECRKELIELIAMNGGHFASSLGVTELTVALHHVYNTEEDRI
DXS_PARD8       ------LDSIHFPEDLRHLSQDKLEQVCADLRQYIIDVLSENPGHLGASLGTVELTVALHYVFNTPYDRI
DXS_BACV8       ---YNLLQSIDTPDDLRHLSADKLPEVCKELRQKIIDELSCNPGHFGSSLGVIELTVALHYVFNTPYDRI
DXS_TREDE       MTKNSLLSKIKGPEDIKLLSYNELKDLAVEIRKEILTVVGHNGGHLASNLGVIELTLAIHRVFSSPHDAV
DXS_LEPIN       -QELTLLDRINYPAELRNIPLEKLPQICKEVRNYIIDTLSGIGGHFASNLGVVELTVALHYVFDTPKDRL
DXS_LEPIC       -QELTLLDRINYPAELRNIPLEKLPQICKEVRNYIIDTLSGIGGHFASNLGVVELTVALHYVFDTPKDRL
DXS_NEIMF       ---------IDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKL
DXS_WOLSU       --------------NLKGKTLKELEEVSLSIRERILEVVSHNGGHLSSTLGAVELIVGMHAVFDSSRDPF
DXS_CAMFF       --------------DIKSKSLEELTDLCDTLRDKILKTVSSNGGHLSSNMGAVELSVAMHYVFDVSKDPF
DXS_BUCAP       ---------------LRLLSIEQLPQLCTELRKYLLDVVSITQGHFASGLGVIEITVALHYVYDTPFDNL
DXS_HELPH       LQNKTF--DLN-PNDIA-----GLELVCQTLRERILEVVSANGGHLSSSLGAVELIVGMHALFDCQKNPF
DXS_HELPJ       LQNKTF--DLN-PNDIA-----GLELVCQTLRNRILEVVSANGGHLSSSLGAVELIVGMHALFDCQKNPF
DXS_HELPG       LQNRTF--DLN-PNDIA-----GLELVCQTLRNRILEVVSANGGHLSSSLGAVELIVGMHALFDCQKNPF
DXS_ARCB4       --------------DIKDKSLKELEELSSQIRERIIDVVSRKGGHFSSTLGAVELTLGMHYVFDAYSDPF
DXS_HELPY       LQNKTF--DLN-PNDIA-----GLELVCQTLRNRILEVVSANGGHLSSSLGAVELIVGMHALFDCQKNPF
DXS_CAMHC       --------------DIKNKNLTELNELCKQIRERILEVVSQNGGHLSSNMGAVELIVAMHYVFDPDSDPF
DXS_BACFR       ---YSLLNAINYPKDLRQLSVDQLPEVCEELRQDIIKELSCNPGHFAASLGVVELTVALHYVYNTPYDRI
DXS_BACFN       ---YSLLNAINYPKDLRQLSVDQLPEVCEELRQDIIKELSCNPGHFAASLGVVELTVALHYVYNTPYDRI
DXS_HELHP       ---------------LSKFSPTQLKELATCIRHRILEVVSSNGGHLSSTLGAVDLIIGMHLVFDANTNPF
DXS_PORGI       ---------INSPADLRALKPEQLPQVCRELRRYILEVLSVTPGHLGSSLGAVDFTVALHYVFDTPYDRI
DXS_PORG3       ---------INSPADLRALKPEQLPQVCRELRRYILEVLSVTPGHLGSSLGAVDFTVALHYVFDTPYDRI
DXS_PARUW       ------LSNLNHPNDIKNLSYSDLKYLAHEIRQRIIEVLSVNGGHLASNLGVVELTLALHKVFESPDDKF
DXS_NITSB       --------------NIKNYTIEELEELSQKIRQRILEVVSKNGGHLSSTLGAVELIVSMHYVFDVEKDPF
DXS_CAMJE       ------------------------------MREKIIQVVSKNGGHLSSNLGAVELSIAMHLVFDAKKDPF
DXS_CAMJJ       ------------------------------MREKIIQVVSKNGGHLSSNLGAVELSIAMHLVFDAKKDPF
DXS_CAMJ8       ------------------------------MREKIIQVVSKNGGHLSSNLGAVELSIAMHLVFDAKKDPF
DXS_CAMJR       ------------------------------MREKIIQVVSKNGGHLSSNLGAVELSIAMHLVFDAKKDPF
DXS_CAMJD       ------------------------------MREKIIQVVSKNGGHLSSNLGAVELSIAMHLVFDAKKDPF
DXS_BACTN       ---YNLLNSINSPDDLRRLEVDQLPEVCDELRQDIIKELSCNPGHFAASLGTVELTVALHYVYNTPYDRI
DXS_BUCAT       ---YPILSFANSVENLRLLSVEQLPQLCFELREYLLDVVSISKGHFASGLGVVEITVALHYVYNTPFDNL
DXS_BUCA5       ---YPILSFANSVENLRLLSVEQLPQLCFELREYLLDVVSISKGHFASGLGVVEITVALHYVYNTPFDNL
DXS_BUCAI       ---YPILSFANSVENLRLLSVEQLPQLCFELREYLLDVVSISKGHFASGLGVVEITVALHYVYNTPFDNL
DXS_THEMA       --------------EIKRMSYDELKRLAEDIRKRITEVVLKNGGHLASNLGTIELTLALYRVFDPREDAI
DXS_THEP1       --------------EIKRMSYDELKRLAEDIRKKITEVVLKNGGHLASNLGTIELTLALYRVFDPREDAI
DXS_THESQ       --------------EIKRMSYDELKRLAEDIRKKITEVVLKNGGHLASNLGTIELTLALYRVFDPREDAI
DXS_PSYCK       ------LDSVDSPADLKTFSSAELITLADELRLFVLYSAGQSGGHFGANLGVIELTIALHYLLDTPQDQI
DXS_DEIRA       ------LDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVDIITALHYVLDSPRDRI
DXS_SULDN       ----------------------ELETLCKNIREEILRVVSKNGGHLSSTLGATEIIVAMHEVFDSKKDPF
DXS_DEIGD       ------LDRVNSPEDLKRLGRDQLPQLAAELREEIVRVCSVGGLHLASSLGATDLIVALHYVLHSPRDRI
DXS_FRASN       ------LSTIDSPQDVKRLDHEELVTLAAEIRDFLIHAVARTGGHLGPNLGAVELTLAIHRVFDSPFDRV
DXS_MYCA9       ------LDDIRGPGDLQGLSKRELDLLADEIREFLIHKVAATGGHLGPNLGVVELSLALHRVFESPYDPI
DXS_PSYA2       ------LDRVDSPADLKAFSTADLIALADELRLFVLYSAGQSGGHFGANLGVIELTIALHYLLDAPQDQI
DXS_RHOE4       ------LARIQGPDDLRQLSHAEMTELADEIREFLVLKVAATGGHLGPNLGVVELTLALHRIFDSPQDAI
DXS_TREPS       ------LRSLTGPHDLKSLSPEQVRALAQEVRQEILRVVSANGGHLASNLGVVELTIALHRVFSCPHDVV
DXS_TREPA       ------LRSLTGPHDLKSLSPEQVRALAQEVRQEILRVVSANGGHLASNLGVVELTIALHRVFSCPHDVV
DXS_RHOSR       ------LARIQTPDDLRQLNSAEMKQLAAEIREFLVQKVAATGGHLGPNLGVVELTLALHRIFDSPADPI
DXS2_STRAW      ------LTRIRGPRDLDRLSLEQLDQLAEEIRTFLVDAVSKTGGHLGPNLGVVELTIALHRVFDSPKDRV
DXS_MYCUA       ------LQQIRGPADLQHLSQAQLRELAQEIREFLVHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCTU       ------LQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCTA       ------LQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCBT       ------LQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCBP       ------LQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCBO       ------LQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCPA       ------LEQIRGPADLQHLSTHQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCA1       ------LEQIRGPADLQHLSTHQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_THET8       ------LDKVNSPEDLKXXXXXXXXXXXXXXXXXXXXVTAQNGGHLASSLGAVELVLALHRVFDSPRDRI
DXS_THET2       ------LDKVNSPEDLKXXXXXXXXXXXXXXXXXXXXVTAQNGGHLASSLGAVELVLALHRVFDSPRDRI
DXS_CHLPN       ------------PADLKKLSISQLPGLAEEIRYRIISVLSQTGGHLSSNLGIVELTIALHYVFSSPKDKF
DXS_FUSNN       ----------------------ELTQRCEEIRKNLIEVVSKNGGHLGSNLGVVELTVCLDEIFDFKEDIV
DXS2_KITGR      ------LTRIRGPRDLDRLTPAQLAELAEEIRAFLVEEVSKTGGHLGPNLGVVELTLAMHRVFDSPRDRI
DXS_CORJK       ------LDKVSSPADLKGLDADQLEQLAAEIREFLIQKVSATGGHLGPNLGVVELTIAMHRVFDSPSDPL
DXS_FRASC       ------LSTISSPQDVKRLDHEELATLAAEIRDFLIHAVARTGGHLGPNLGAVELTLAIHRVFDSPFDRI
DXS2_STRCO      ------LTRITGPRDLDRLSLEELTQLAEEIRTFLVDAVSKTGGHLGPNLGVVELTLALHRVFESPKDKV
DXS_MYCLE       ------LEQIRRPADLQHLSQQQLRDLAAEIRELLVHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCLB       ------LEQIRRPADLQHLSQQQLRDLAAEIRELLVHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_CORDI       ------LEHISSPADVKTLSYEQLDTLASEIREFLVEKVSATGGHLGPNLGVVELTLAIHRVFSSPSDPI
DXS_MYCS2       ------LEQVRGPADLQHLSQSQLRDLAQEIRQFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_MYCGI       ------LEQIRGPADLQHLSRAQMEDLAREIRDFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS_TROWT       -RQYGLLESIRSPRDLDSFTPHQLDELECQVRDFLIQSVAKTGGHLGSNLGVVELSIALHRSFRSPEDCI
DXS_TROW8       -RQYGLLESIRSPRDLDSFTPHQLDELECQVRDFLIQSVAKTGGHLGSNLGVVELSIALHRSFRSPEDCI
DXS_THEFY       ------LDSVHNPDDLKKLPDSQLPQLAAEIREFLISQVARTGGHLGPNLGVVELTIALHRVFDSPRDPI
DXS_MYCSS       ------LEQIRGPADLQHLSQSALSELAGEIRQFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPL
DXS_MYCSK       ------LEQIRGPADLQHLSQSALSELAGEIRQFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPL
DXS1_STRCO      ------LENIRGPRDLKALSEAELGELSDEIRDFLVHAVARTGGHLGPNLGVVELTVALHRVFESPDDRI
DXS_STRC1       ------LENIRQPRDLKALPEEQLHELSEEIRQFLVHAVTRTGGHLGPNLGVVELTIALHRVFESPVDRI
DXS_CORGB       ------LNSISTPADLKALNDEDLDALAKEIRTFLVDKVAATGGHLGPNLGVVELTIGLHRVFDSPQDPI
DXS_MYCSJ       ------LEQIRGPADLQHLSQSALSELAGEIRQFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPL
DXS_CORGL       ------LNSISTPADLKALNDEDLDALAKEIRTFLVDKVAATGGHLGPNLGVVELTIGLHRVFDSPQDPI
DXS_MYCVP       ------LEQIRGPADLQHLSQAQLEDLAHEIRDFLIHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPI
DXS1_STRAW      ------LENIRGPRDLKXXXXXXXXXXXXXIREFLVHAVARTGGHLGPNLGVVELSVALHRAFESPVDRI
DXS_NOCFA       ------LSRVDTPEDVRRLNVXXXXXXXXXXXXFLVRKVAATGGHLGPNLGVVELTIALHRVFDSPADPL
DXS_COREF       ------LNSISTPADLKALAEEDLEVLAGEIRSFLVDKVAATGGHLGPNLGVVELTIGLHRVFDSPREPI
DXS1_KITGR      ------LSRITGPADLRRLHPEQLPPLAAEIRAFLIDNVTRTGGHLGPNLGVVELSIALHRVFDSPHDRI
DXS_NOCSJ       ------LDSIASPADLRGLSDAQLEQLASEIRDLLIRTVATNTGHLGPNLGVVELTLAIHRVFDSPRDRV
DXS_STRGG       ------LTRIKGPRDLDRLSLGELDQLAQEIRTFLVDAVSKTGGHLGPNLGVVELTIALHRVFESPRDKV
DXS_CHLFF       ------------PTDLKNXXXXXXXXXXXQMRHKIISVLTNTGGHLASNLGIIEVTIALHYVFSSTEDKF
DXS_CHLAB       ------------PEDXXXXXXXXXXXXAEQIRHKIISVLIKTGGHLASNLGIIELTIALHYVFSSPEDKF
DXS_CHLCV       ------------PTDLKKFSLAELSLLAEQMRHKIISVLTNTGGHLASNLGIIELTIALHYVFSSTEDKF
DXS_PROAC       MPRMALLDDIGCPDDVRKLTTKQAEDLAEEIRAFLIDKVSRTGGHLGPNLGVVELTIALHRVFDSPHDPI
DXS_MYXXD       ----ELLSRIGSPSDVRALPEEALPLLCQELREDIISICGRVGGHLGASLGAVELIVALHRVFHSPQDAL
DXS_ARTS2       ------LDTIRNPQDLSKLTEEQLSQLAAEVRSFLIGNVSQTGGHLGPNLGVVELTMAVHRIFDSPRDSI
DXS_RHOBA       -QKHPLLAGLQDATPLANWSSTELSNAAVEIRDVLCNLLATRTAHFASNLGVVELCLALHSEFDFRTDRL
DXS_ARTAT       ------LETVKDPRDLAKLSGTELEQLAGEIREFLITNVAATGGHLGPNLGVVELTLAVHRNFDSPRDSI
DXS_ARTCA       ------LDTIRNPQDLNDXXXXXXXXXXXXIREFLITNVSQTGGHLGPNLGVVELTLAVHRIFDSPRDSI
DXS_CLAMS       ------LETITGPRDLDRLSREQMVELAAEIRQFLVAEVSKTGGHLGPNLGVVETTLAIHRVFDSPRDAI
DXS_SACEN       ------LESVQSPADVKRLEHGELAKLAAEIRSFLIEKVSRTGGHLGPNLGAIELTLAVHRVFDSPRDAV
DXS_CHLTB       ---YSLLPHIHSPQDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQF
DXS_CHLT2       ---YSLLPHIHSPQDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQF
DXS_CHLMU       ----------------------------DEIRNRIIATLSLTGGHLASNLGIVELTVALHYVFASPEDQF
DXS_CHLTR       ---YSLLPHIHSPQDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQF
DXS_CHLTA       ---YSLLPHIHSPQDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQF
DXS_KOCRD       ------LESIEGPEDLKGLDAAAMEQLAGEIRDFLISHVSATGGHLGPNLGVVELTLAVHRVFSSPRDSV
DXS_RENSM       ------LETIQHPADLARLSDEQLVQLAQEIRDFLISNVAQTGGHLGPNLCVVELTLAIHRVFDSPRDSI
DXS_LEIXX       ------LESVHGPRDLDRLTERELDQLAAEVRAFLVANVAKTGGHLGPNLGVVETTIAIHRVFDSPRDAI
DXS_MYCPE       --------------DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLI
Y4MN_RHISN      ----------------------------------------------------------------------
TKTC_METJA      ----------------------------------------------------------------------
TKTL2_MOUSE     ----------------------------------------------------------------------
TKT_MOUSE       -----------------------LKDTANRLRISSIQATTAAGGHPTSCCSAAEIMAVLFFHTNPHNDRF
TKT_BOVIN       -----------------------LKDTANRLRISSIQATTAAGGHPTSCCSAAEIMAVLFFHTNPHNDRF
TKT_RAT         -----------------------LKDTANRLRISSIQATTAAGGHPTSCCSAAEIMAVLFFHTNPHNDRF
TKT_PANTR       ----------------------------------------------------------------------
TKTL1_BOVIN     ----------------------------------------------------------------------
TKT_HUMAN       ----------------------------------------------------------------------
TKT_MACFA       -----------------------LKDTANRLRISSIQATTAAGGHPTSCCSAAEIMAVLRYKSQDPNDRF
TKT_PONAB       -----------------------LKDTANRLRISSIQATTAAGGHPTSCCSAAEIMAVLRYKSQDPNDRF
TKTL2_BOVIN     ----------------------------------------------------------------------
TKTL1_MACFA     ----------------------------------------------------------------------
TKTL2_HUMAN     ----------------------------------------------------------------------
TKTL1_HUMAN     ----------------------------------------------------------------------
ODPB_ZYMMO      ----------------------------------------------------------------------
TKTL1_MOUSE     ----------------------------------------------------------------------
ODPB_BOVIN      ----------------------------------------------------------------------
ODPB_PONAB      ----------------------------------------------------------------------
ODPB_MOUSE      ----------------------------------------------------------------------
ODPB_HUMAN      ----------------------------------------------------------------------
ODPB_RAT        ----------------------------------------------------------------------
ODBB_DICDI      ----------------------------------------------------------------------
ODPB_RHIME      ----------------------------------------------------------------------
ODBB_BACSU      ----------------------------------------------------------------------
ODPB_RICCN      ----------------------------------------------------------------------
OPDB_RICFE      ----------------------------------------------------------------------
ODPB_DICDI      ----------------------------------------------------------------------
ODPB_CYAME      ----------------------------------------------------------------------
ODPB_STAAW      ----------------------------------------------------------------------
ODPB_STAAU      ----------------------------------------------------------------------
ODPB_STAAS      ----------------------------------------------------------------------
ODPB_STAAR      ----------------------------------------------------------------------
ODPB_STAAN      ----------------------------------------------------------------------
ODPB_STAAM      ----------------------------------------------------------------------
ODPB_STAAC      ----------------------------------------------------------------------
ODPB_STAES      ----------------------------------------------------------------------
ODPB_STAEQ      ----------------------------------------------------------------------
OPDB_RICTY      ----------------------------------------------------------------------
ODPB_RICPR      ----------------------------------------------------------------------
ODPB_PORPU      ----------------------------------------------------------------------
ODPB_MESVI      ----------------------------------------------------------------------
TKT_BUCBP       ------------------------RKLANAIRALSIDAVQEASGHPGMPMGMADIAEVLWREFFKHNDRF
OPDB_RICBR      ----------------------------------------------------------------------
ACOB_BACSU      ----------------------------------------------------------------------
ODPB_YEAST      ----------------------------------------------------------------------
ODPB_PEA        ----------------------------------------------------------------------
ODPB_ACHLA      ----------------------------------------------------------------------
ACOB_RALEH      ----------------------------------------------------------------------
ODPB_ARATH      ----------------------------------------------------------------------
ODPB_PORYE      ----------------------------------------------------------------------
ODPB_LEIXX      ----------------------------------------------------------------------
ODPB_BACSU      ----------------------------------------------------------------------
TKT_BACSU       ----------------------------------------------------------------------
ODPB_GRATL      ----------------------------------------------------------------------
ODPB_SCHPO      ----------------------------------------------------------------------
TKT_PICST       ----------------------------------------------------------------------
TKT2_VIBPA      ----------------------DRKYLANAIRALSMDGVQQANGHPGAPMGMADIAEVLHLNHNPSNDRF
TKT1_KLULA      ----------------------------------------------------------------------
ODPB_CHAVU      ----------------------------------------------------------------------
ODBB_HUMAN      ----------------------------------------------------------------------
ODBB_PSEPU      ----------------------------------------------------------------------
TKT_RHOCA       ----------------------DHWKLATAIRVLAIDAVAANSGHPGMPMGMADVATVLHLKFDAPNDRF
TKT2_VIBVU      ----------------------DRKQLANAIRALSMDGVQKANGHPGAPMGMADIAEVLHLNHNPSNDRF
TKT1_VIBVY      ------------------------KHLANAIRALSMDGVQKANGHPGAPMGMADIAEVLHLNHNPSNDRF
TKT1_VIBVU      ------------------------KHLANAIRALSMDGVQKANGHPGAPMGMADIAEVLHLNHNPSNDRF
ODBB_THET2      ----------------------------------------------------------------------
ODPB_ASCSU      ----------------------------------------------------------------------
ODBB_THET8      ----------------------------------------------------------------------
TKT2_VIBVY      ----------------------DRKHLANAIRALSMDGVQKANGHPGAPMGMADIAEVLHLNHNPSNDRF
TKT_MYCGE       ------------------------------------------GGHVGMAIGASPILFSLHFHFDPDQDRF
ODPB_CHLAT      ----------------------------------------------------------------------
ODPB_BACST      ----------------------------------------------------------------------
ODBB_BOVIN      ----------------------------------------------------------------------
TKT_BUCAI       ----------------------------------------------------------------------
TKT1_VIBPA      ------------------------KHLANAIRALSMDGVQQANGHPGAPMGMADIAEVLHLNHNPANDRF
TKT_HAEIN       ------------------------RQLANAIRVLAMDSVQKASGHPGAPMGMADIAEVLWRDFLKHNDRF
TKT_AQUAE       ---HEVLKIFKTMPQLFKTSKKIDELVINTIRFLSVDMVERASGHPGMPLGASHIVYLLYYNPKNPNDRF
TKT_RHOSH       --------------------------MANAIRALAMDAVEKASGHPGMPMGMADVATVLFNRFLTVDDRF
TKT_MYCPN       ------------------------------------------GGHVGMALGASPILYTLHIQFN-PNDRL
TKT2_ECOLI      ----------------------------------------------------------------------
ODBB_PSEAE      ----------------------------------------------------------------------
TKT2_PASMU      ------------------------RELANAIRFLSMDAVQKASGHPGAPMGMADIAEVLWRDFLKHNDRF
TKT1_YEAST      ----------------------------------------------------------------------
TKT1_PASMU      ------------------------RELANAIRFLSMDAVQKASGHPGAPMGMADIAEVLWRDFLKHNDRF
ODPB_CHAGL      ----------------------------------------------------------------------
TKT2_VIBF1      ------------------------KHLANAIRALSMDGVQQANGHPGAPMGMADIAEVLHLNHNPANDRF
TKT_SINMW       ------------------------RNMADAIRFLSMDAVEKANGHPGMPMGMADAVTVLFNRFDWPDDRF
TKTN_METJA      ------------------LEIKDLEKIAKKVRYNIVKMVGAKSGHPGGSLSATDIIVALYFKLDNPRDRF
TKTC_MAIZE      -----------------------LEKSVNTIRFLAIDAVEKANGHPGLPMGCAPMGHVLYYWFN--RDRF
TKTA_CRAPL      ----------------------------NTIRFLAIDAVENVSGHPGMPMGCAPMG---HVLFDENRDRF
TKT_STRPN       ----------------------------NAIRFLGIDAINKANGHPGVVMGAAPMTKQLHINPAQPNDRF
ODBB_RAT        ----------------------------------------------------------------------
ODBB_MOUSE      ----------------------------------------------------------------------
TKT_RHIME       ------------------------RSMADAIRFLSMDAVEKANGHPGMPMGMADAVTVLFNRFDWPDDRF
ODPB_STAPU      ----------------------------------------------------------------------
ODPB_MYCGE      ----------------------------------------------------------------------
FAS3_RHOFA      ----------------------------------------------------------------------
TKT2_VIBCH      ------------------------KQLANAIRALSMDGVQKANGHPGAPMGMADIAEVLNHNPQNPNDRF
TKT1_VIBCH      ------------------------KQLANAIRALSMDGVQKANGHPGAPMGMADIAEVLNHNPQNPNDRF
TKT_ANASP       ------------------VATQSLEELSNAIRFLAVDAIEKASGHPGLPMGAAPMAFVLWNRFMRYNDRF
TKTP_RALEH      ---------------------------ANALRFLAADAVEARSGHPGAPMGMAEMAEVVHLRHNPANDRF
TKT2_YEAST      -------------SDIDKLAVSTLRLLS-------VDQVSAQSGHPGAPLGLAPVA---HVIFKNPNDRF
TKT1_VIBF1      ------------------------KHLANAIRALSMDGVQQANGHPGAPMGMADIAEVLHLNHNPQNDRF
DAS_CANBO       ----------------------------------VLDLVEQEGGHPGSAMGMVAMGIALKYSTNDPTDRF
ODBA_DICDI      ----------------------------------------------------------------------
TKTC_RALEH      ---------------------------ANALRFLAADAVEQASGHPGAPMGMAEMAEVLHLRHNPANDRF
ODPB_MYCPN      ----------------------------------------------------------------------
ODPA_RICFE      ----------------------------------------------------------------------
ODPA_ACHLA      ----------------------------------------------------------------------
TKT_BACHD       ----------------------------------------------------------------------
TKT7_CRAPL      ----------------------------------------------------------------------
ODPA_RICPR      ----------------------------------------------------------------------
ODPA_RICCN      ----------------------------------------------------------------------
ODPA_BACCE      ----------------------------------------------------------------------
ODPA_RICBR      ----------------------------------------------------------------------
TKTC_SPIOL      -------------TDIDQLVEKSV----NTIRFLAIDAVEKANGHPGLPMGCAPMGHILYYWFN--RDRF
ODPA_ZYMMO      -------------------------------------------------IGQEAVAVGLQAALQPGRDSV
ODPA_RICTY      ----------------------------------------------------------------------
TKT_PHYPO       -----------------------------------MDAVEKAAGHLGLPLGCAELGATLRYNPDKPEDIF
TKT_STAES       ----------------------------------------------------------------------
TKT1_ECOLI      ----------------------------------------------------------------------
ODPA_RHIME      ----------------------------------------------------------------------
Y4MO_RHISN      ----------------------------------------------------------------------
TKT_STAEQ       ----------------------------------------------------------------------
TKT_SCHPO       ----------------------------NTIRTLAVDTTAHASGHPGAPMG---LAPAAHVLFSRNRDRF
Y4304_PHOLL     ----------------------------------------------------------------------
TKT_BUCAP       ----------------------------------------------------------------------
TKT_STRP8       ----------------------------------------------------------------------
TKT_STRP6       ----------------------------------------------------------------------
TKT_XANFL       ----------------------------------------------------------------------
ODPA_BACSU      ----------------------------------------------------------------------
ODPA_BACST      ----------------------------------------------------------------------
TKTC_CRAPL      ----------------------------------------------------------------------
ODPA_MYCGE      ----------------------------------------------------------------------
BIOD_CLOTE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
DXS_PELUB       IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
DXS_BRASO       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRAESDYDPFGAAHSSTSISAGLGMAVARDLSGGKN
DXS_MESSB       IWDVGHQAYPHKILTGRRDRIRTLRQEDGLSGFTKRSESEYDPFGAAHSSTSISAGLGMAVARELSGGQR
DXS_BRASB       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDYDPFGAAHSSTSISAGLGMAVARDLSGGKN
DXS_RHOP5       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDHDPFGAGHSSTSISAGLGMAVASDLAGTKN
DXS_NITHX       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDYDPFGAAHSSTSISASLGMAVARDLSGGKN
DXS_BRAJA       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRSESDYDPFGAAHSSTSISAGLGMAVARDLSGGKN
DXS_RHOPB       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDYDPFGAAHSSTSISAGLGMAVARDLAGGKN
DXS_RHOP2       IWDVGHQAYPHKILTGRRDRIRTLRTAGGLSGFTKRTESDYDPFGAAHSSTSISAGLGMAVARDLAGGTN
DXS_RHOPT       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDHDPFGAGHSSTSISAGLGMAVASELAGKKN
DXS_RHOPA       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDHDPFGAGHSSTSISAGLGMAVASELAGKKN
DXS_NITWN       IWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRTESDYDPFGAAHSSTSISASLGMAVARDLSGGNN
DXS_RHOPS       IWDVGHQAYPHKILTGRRDRIRTLRTAGGLSGFTKRTESDYDPFGAAHSSTSISAGLGMAVARDLAGGNN
DXS_SPHWW       IWDVGHQAYPHKILTGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAALGFAVANKLANKEG
DXS_BRUO2       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BRUSU       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BRUC2       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_RHILO       IWDVGHQAYPHKILTGRRDRIRTLRQEGGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAAARDLSGGRN
DXS_RHOCS       IWDVGHQCYPHKILTGRRDRIRTLRMGGGLSGFTKRAESEYDPFGAGHSSTSISAALGMAVGRDQLGHKN
DXS_BRUME       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BRUMB       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BRUAB       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BRUA1       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BRUA2       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BEII9       IWDVGHQAYPHKXXXXXXXXXXXXXXAGGLSGFTKRSESVYDPFGTAHSSTSISAGLGMAAATTLSGGNN
DXS_BRUSI       IWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKR
DXS_BART1       IWDVGHQTYPHKILTGRREKIRTLRQEGGLSGFTKRVESVYDPFGAGHSSTSISAGLGMAVASALKEKKR
DXS_OCHA4       IWDVGHQAYPHKILTGRRDRIRTLRQTGGLSGFTKRTESEYDPFGAAHSSTSISAGLGMAVASDLSGEKR
DXS_MARMM       IWDVGHQCYPHKILTGRRDRIRTLRQPGGLSGFTKRSESEYDPFGAAHASTSISAALGFAVGRDLKDENR
DXS_BARQU       IWDVGHQTYPHKILTGRRDRIRTLRQEGGLSGFTKRSESVYDPFGAGHSSTSISAGLGMTVASALAEKRR
DXS_RHIEC       IFDVGHQCYPHKILTGRRDRIRTLRQENGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLEKTDR
DXS_BARHE       IWDVGHQAYPHKILTGRREKIRTLRQEGGLSGFTKRSESVYDPFGAGHSSTSISAGLGMAVASALAEKRR
DXS_ERYLH       IWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAGLGFAVANKLKGEPG
DXS_AGRVS       IFDVGHQCYPHKILTGRRERIRTLRQEHGLSGFTKRAESEYDPFGAAHSSTSISAGLGMAVAAELGQTDR
DXS_SPHAL       VWDVGHQCYPHKIITGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAALGFAIANKLKDEPG
DXS_RHIME       IFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAVAAELDGKSR
DXS_AGRRK       IFDVGHQCYPHKILTGRRDRIRTLRQEGGISGFTRRAESEYDPFGAAHSSTSISAGLGMAVAADLDKTDR
DXS_SILPO       IWDVGHQCYPHKILTERRDRIRTLRMKDGLSGFTKRSESPYDPFGAAHSSTSISAALGFAVARDLGGVLG
DXS_AZOC5       IWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTRRSESEYDPFGAAHSSTSISAGLGMAVARDLSGGDR
DXS1_JANSC      VWDVSHQCYPHKILTGRRDQMLTIRQKDGLSGFTKRSESPFDPFGAAHSSTSISAALGFAVARDLGGDSD
DXS2_ROSDO      IWDVGHQCYPHKILTERRDRIRTLRMKGGLSGFTKRSESPYDPFGAAHSSTSISAALGFAVARDLGGVLG
DXS_RHIL3       IFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKSDR
DXS_RHIE6       IFDVGHQCYPHKILTGRRDRIRTLRQENGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKNDR
DXS_RHILW       IFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKNDR
DXS_HYPNA       VWDVGHQCYPHKILTGRKDRMRTLRQGGGLSGFTKRSESEYDPFGAAHASTSISAGLGFAKSRDLQNKDN
DXS_SILST       IWDVSHQCYPHKILTGRRDRIRTLRMKDGLSGFTKRSESAFDPFGAAHSSTSISAALGFSVARDLGGVLG
DXS_AGRT5       IFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDDFGAGHSSTSISAGLGMAVAAGLDGSDR
DXS_BARBK       IWDVGHQAYPHKILTGRRDKIRTLRQEGGLSGFTKRSESIYDPFGAGHSSTSISAGLGMAMASALAEERR
DXS_GLUOX       IWDVGHQAYPHKILTGRRDRIRTLRQPEGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAVAHHLSYHER
DXS1_RHORT      IWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTLREESPYDPFGAGHSSTSISAGLGMAIGSALAGDAR
DXS2_RHORT      IWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTLREESPYDPFGAGHSSTSISAGLGMAIGSALAGDAR
DXS_XANP2       IWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAVARDLSGEER
DXS_MAGSA       IWDVGHQAYPHKILXXXXXXXXXXXXXXXLSGFTRRSESEYDPFGAGHSSTSISAALGMAVARDLKGATN
DXS_CAUSK       IWDVGHQAYPHKILTGRRDRIKTLRQGGGLSGFTKRAESVYDPFGXXXXXXXXXXXLGFCAARDAKGENN
DXS2_RHOS4      IWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTKRSESPYDCFGAGHSSTSISAAVGFAAAREMGGDTG
DXS_NOVAD       VWDVGHQAYPHKILTGRRDRIRTLRQAGGLSGFTKRSESEYDPFGTAHSSTSISAALGFAIANKLSGRLG
DXS_PHEZH       IWDVGHQAYPHKILTGRRDRIRTLRQGGGLSGFTKRAESDYDPFGXXXXXXXXXXXLGFCAARDREGRDN
DXS_CAUCR       IWDVGHQAYPHKILTGRRDRIRTLRQGGGLSGFTKRAESEYDPFGXXXXXXXXXXXLGFCAARDAKGEDN
DXS_CAUCN       IWDVGHQAYPHKILTGRRDRIRTLRQGGGLSGFTKRAESEYDPFGXXXXXXXXXXXLGFCAARDAKGEDN
DXS_CAPAN       LWDVGHQSYPHKILTGRREKMSTLRQTNGLAGFTKRSESEYDCFGTGHSSTTISAGLGMAVGRDLKGRNN
DXS_ORYSJ       LWDVGHQSYPHKILTGRRDKMPTMRQTNGLSGFTKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGGKN
DXS1_ROSDO      VWDVGHQCYPHKILTGRRKQMPTLRQGGGISGFTKRSESEYDPFGAAHSSTSISAALGFTISRDMGQPTG
DXS1_RHOS4      VWDVGHQCYPHKILTGRREQMRTLRQKGGLSGFTKRSESAYDPFGAAHSSTSISAALGFAMGRELGQPVG
DXS2_JANSC      VWDVGHQCYPHKVLTGRRDRIRTLRQKDGLSGFTKRSESEYDPFGAAHSSTSISAALGFAAAQDLGEATG
DXS_ARATH       LWDVGHQSYPHKILTGRRGKMPTMRQTNGLSGFTKRGESEHDCFGTGHSSTTISAGLGMAVGRDLKGKNN
DXS1_ZYMMO      VWDVGHQTYPHKXXXXXXXXXXXXXXXXXLSGFTQRAESEYDAFGAAHSSTSISAALGFAMASKLSDSDD
DXS2_ZYMMO      VWDVGHQTYPHKXXXXXXXXXXXXXXXXXLSGFTQRAESEYDAFGAAHSSTSISAALGFAMASKLSDSDD
DXS_RHOCA       IWDVGHQCYPHKILTGRRSRMLTLRQAGGISGFPKRSESPHDAFGAGHSSTSISAALGFAVGRELGQPVG
DXS_NITEU       IWDVGHQTYAHKILTGRRTGMARLRMQGGIAGFPRRDESEYDAFGTAHSSTSISAALGMAVAARLKGVKQ
DXS_NITEC       VWDVGHQTYAHKILTGRRTGMAHLRMQGGIAGFPRRDESEYDAFGTAHSSTSISAALGMAVAARINKIKQ
DXS_NATTJ       VWDVGHQSYIHKILTGRKEQFSTLRQFGGLSGFPKPEESRYDAFGTGHSSTSISAALGMAKARDLQGSNE
DXS_NITMU       VWDVGHQTYVHKILTGRREGMSKLRMRGGIAGFPRRDESEYDAFGTAHSSTSISAALGMAVASQWEGKKR
DXS_SERP5       VWDVGHQAYPHKILTGRRDKIATIRQKNGLHPFPWRAESEYDVLSVGHSSTSISAGLGMAVAAAREGKNR
DXS_SYNWW       IWDVGHQAYVHKILTGRREQMSTLRQYGGISGFPKVEESEYDAFNTGHSSTSISAALGMALARDLQGQSN
DXS2_GEOMG      IWDVGHQAYTHKILTGRRESFHTQRQYKGISGFPKRSESPHDAFGAGHSSTSISAGLGMAAAQDLKGSGS
DXS_HAEIG       IWDVGHQAYPHKILTGRREQMSTIRQKGGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENASR
DXS_ACTPJ       IWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPFPWREESLYDVLSVGHSSTSISAGVGIAVAAEKENAGR
DXS_ACTP7       IWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPFPWREESLYDVLSVGHSSTSISAGVGIAVAAEKENAGR
DXS_ACTP2       IWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPFPWREESLYDVLSVGHSSTSISAGVGIAVAAEKENAGR
DXS_LARHH       VWDVGHQTYPHKILTGRRDRMHTMRQKGGLAGFPKRDESEYDTFGVGHSSTSIGAALGMAVAARQTGSDR
DXS_HAEIE       IWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGR
DXS_MAGSM       VWDVGHQSYGHKVLTGRRDQLASIRQRHGLSGFTKRSESPYDPFGTGHSSTSISXXXXXXXXXXXNGIQR
DXS_PSEPG       VWDVGHQAYPHKILTGRRNRMLSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSAR
DXS_POLNA       VWDVGHQTYPHKILTGRRERMGTLRQLGGLSGFPRRDESEYDTFGTAHSSTSISAALGMALAAEFKGENR
DXS_HAEIN       IWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGR
DXS_PHOLL       VWDVGHQAYPHKILTGRRDRIDTIRQKNGLHPFPWRDESEYDTLCVGHSSTSISAGLGMAIAAQREGKGR
DXS_PASMU       IWDVGHQAYPHKILTGRRDQMSTIRQKNGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAQRENAGR
DXS_PECCP       VWDVGHQAYPHKILTGRRDRISTIRQKGGLHPFPWRDESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_HAEI8       IWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGR
DXS_PSEPK       VWDVGHQAYPHKILTGRRNRMLSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSAR
DXS_PSEP1       VWDVGHQAYPHKILTGRRNRMLSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSAR
DXS_ERWCT       VWDVGHQAYPHKILTGRRDRISTIRQKGGLHPFPWRDESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_PROMH       IWDVGHQAYPHKILTGRRDRIDTIRQKNGLHPFPWRDESEYDKLCVGHSSTSISAGLGMAVAAEQENLGR
DXS_CUPTR       VWDVGHQSYPHKILTGRRERMRTLRQWGGISGFPRRSESEYDTFGTAHSSTSISAALGMALGARTLGQKR
DXS_ACIAC       VWDVGHQTYPHKILTGRRDRMPTLRQLGGLSGFPQRTESEYDTFGTAHSSTSISAALGMAMAARQRGEDR
DXS_PSEPW       VWDVGHQAYPHKILTGRRNRMLSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSAR
DXS_PSEMY       VWDVGHQAYPHKILTGRRERMGSLRQKDGLAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLKGEKR
DXS_BURCJ       VWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_BURS3       VWDVGHQTYPHKILTGRRDQMHSLRQQDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_METPP       VWDVGHQTYPHKILTGRRDRMAGLRQLGGISGFPRRDESEYDTFGTAHSSTSISAALGMALAAKIKGEDR
DXS_HALOH       IWDVGHQSYTHKILTGRKKKFHTIRQYKGLSGFPKYSESIHDVIETGHSSTSISAALGLALARDLKNRND
DXS_RALEJ       VWDVGHQSYPHKILTGRRERMNTLRQFGGISGFPRRSESQYDTFGTAHSSTSISAALGMALGARTLGEQR
DXS_DIAST       VWDVGHQTYPHKILTGRRDRMPSLRQLGGLSGFPQRAESEYDTFGTAHSSTSISAALGMALAAKQRGDER
DXS_BURP6       VWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDR
DXS1_GEOSL      VWDVGHQAYTHKILTGRRDRFHTQRQYGGISGFPKRSESSHDAFDTGHSSTSISAGLGMAMARELRGGSN
DXS_THETN       IWDVGHQCYVHKMITGRRDKFDTLRQFNGLSGYTKRTESIHDIFGAGHSSTSLSAALGIATARDLKGEKY
DXS_COLP3       IWDVGHQAYPHKILTGRRDQLHTIRQKGGLHPFPWREESEYDTLSVGHSSTSISAALGLAVAAEKEAKNR
DXS_POLSJ       VWDVGHQTYPHKILTGRRDRMGSLRQFGGLSGFPRRDESPYDTFGTAHSSTSISAALGMALAAHQQGEDR
DXS_BURCM       VWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_RALME       VWDVGHQSYPHKILTGRRDRMSTLRQYGGISGFPRRAESEYDTFGTAHSSTSISAALGMALGARTRGEKR
DXS_PSEU2       VWDVGHQAYPHKILTGRRARMSTLRQKEGVAAFPRRSESEYDTFGVGHSSTSISAALGMAIASRLQGSER
DXS_DESAP       VWDVGHQCYVHKILTGRKSQFHTLRQFEGLSGFPNRNESEYDCFGTGHSSTSISAALGMALARDLSGEDR
DXS_BURPS       VWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDR
DXS_BURP1       VWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDR
DXS_BURP0       VWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDR
DXS_BURMA       VWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDR
DXS_BURA4       VWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_PSEFS       VWDVGHQAYPHKILTGRREQMGTLRQKDGIAAFPRRAESEYDTFGVGHSSTSISAALGMAIAARLQGSDR
DXS_HAEDU       IWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPFPWREESPYDVLSVGHSSTSISAGLGIAVAAQKENAGR
DXS_PSESM       VWDVGHQAYPHKILTGRRARMSTLRQKDGVAAFPRRSESEYDTFGVGHSSTSISAALGMAIASRLQGSER
DXS_CHRVO       VWDVGHQTYPHKILTGRRERMHTMRQHNGLAGFPKREESEYDTFGVGHSSTSIGAALGMAVAAKTLGVDR
DXS_YERE8       VWDVGHQAYPHKILTGRREQIGTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_BURTA       VWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDR
DXS_BURCH       VWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_BURCC       VWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_BURCA       VWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDR
DXS_PELCD       VWDVGHQAYAHKLLTGRLDRFDTLRQLGGISGFPKREESPYDAFDVGHSSTSISAALGMAAARDCKNGKE
DXS_PELTS       IWDVGHQSYVHKLITGRYKEFYTLRQFGGISGFPRPSESVHDAFGTGHSSTSISAALGMAIARDLKGEKY
DXS_BURXL       VWDVGHQTYPHKILTGRRDQMHTLRQLGGISGFPKRDESEYDTFGTAHSSTSISAALGMAVASKLKGDNR
DXS_PSEPF       VWDVGHQAYPHKILTGRRERMETLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSDR
DXS_PSEF5       VWDVGHQAYPHKILTGRREQMASLRQKDGLAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSER
DXS_HAEPS       IWDVGHQAYPHKILTGRRDQMHTIRQKDGLHPFPWREESPFDVLSVGHSSTSISAGLGIAVAAEKENAGR
DXS_YERPS       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_YERPB       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_METFK       VWDVGHQTYPHKILTGRRKDMGNLRRPGGIAGFPRRDESIYDTFGTGHSSTSISAALGMAVAAQKTGSDR
DXS_PSEE4       VWDVGHQAYPHKILTGRRDRMLSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNDPR
DXS_YERPY       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_YERP3       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_PSE14       VWDVGHQAYPHKILTGRRARMSTLRQKDGVAAFPRRSESEYDTFGVGHSSTSISAALGMAIASRLQGSER
DXS_BURP8       VWDVGHQTYPHKILTGRRDQMSTLRQLGGISGFPKRDESPYDTFGTAHSSTSISAALGMAIGSKLRGDDR
DXS_SODGM       IWDVGHQAYPHKILTGRRDRIATIRQRNGLHPFPWRGESEYDQLSVGHSSTSISAGLGMAVAAEHEGLGR
DXS_ALTMD       LWDVGHQAYPHKILTGRAERMSTIRQKNGLHPFPWPPESEYDTFAVGHSSTSISAALGMAVAAEKEGKDR
DXS_LEPCP       VWDVGHQTYPHKILTGRRDRMSTLRQLGGLSGFPRRDESEYDTFGTAHSSTSISAALGMALAAQQKGEKR
DXS_BREBN       IWDVGHQAYVHKMLTGRREMFPTLRQYKGLCGFPKMVESPHDVWETGHSSTSLSAAMGMATARDLKKEKN
DXS_PHOPR       IWDVGHQAYPHKILTGRRDQMSTIRQKDGIHPFPWRGESEYDVLSVGHSSTSISAGLGMAIAANKEGLGR
DXS_ESCF3       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_BACHD       IWDVGHQAYVHKILTGRAGQFDQLRQYKGLCGFPKRDESEHDVWETGHSSTSLSAAMGMATARDLKGTDE
DXS_AZOSE       VWDVGHQTYGHKILTGRREAMSRLRQFGGISGFPRRSESSYDTFGTAHSSTSISAALGMAVAARNRGEQR
DXS_YERPP       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_YERPN       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_YERPG       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_YERPE       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_YERPA       IWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGR
DXS_ERWT9       IWDVGHQAYPHKILTGRRDRIGTIRQKNGLHPFPWRDESEYDVLNVGHSSTSISAGLGMAVAAGKEAQGR
DXS_SHISS       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHXXXXXXXXXXXXVTAEKEGKNR
DXS_CITK8       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKDR
DXS_ACISJ       VWDVGHQTYPHKILTGRRDRMPSLRQLGGLSGFPQRAESEYDTFGTAHSSTSISAALGMALAAKQRGDER
DXS_IDILO       VWDVGHQAYPHKILTGRKQRLHSIRQKDGLHPFPWREESEYDVLSVGHSSTSISAALGMAVAAQRQSLRQ
DXS_RALEH       VWDVGHQSYPHKILTGRRERMGTLRQWGGISGFPRRSESEYDTFGTAHSSTSISAALGMALGARTLGEKR
DXS_SHIDS       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_PSEA7       VWDVGHQAYPHKILTERRELMGTLRQKDGLAAFPRRAESEYDTFGVGHSSTSISAALGMAIAARLQGKER
DXS_DESPS       VWDVGHQSYAHKILTGRRKQFDTLRQYRGMSGFPKRGESDYDAFETGHSSTSISAALGMTLAMDLLQQDN
DXS_KLEP3       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHXXXXXXXXXXXXXXXXKEDKQR
DXS_ECOLI       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECODH       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOBW       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_SHIBS       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_SHIB3       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_KLEP7       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHXXXXXXXXXXXXXXXXKEDKQR
DXS_ECOUT       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOSM       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOL6       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOK1       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO81       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO7I       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO5E       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO57       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO45       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_HAES2       LWDVGHQAYPHKILTGRRDKMSTIRQKGGLHPFPWREESEFDVLSVGHXXXXXXXXXXXXXXXQKENLGR
DXS_HAES1       LWDVGHQAYPHKILTGRRDKMSTIRQKGGLHPFPWREESEFDVLSVGHXXXXXXXXXXXXXXXQKENLGR
DXS_VIBPA       IWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAGLGLAISAQKEGKGR
DXS_VIBF1       IWDVGHQAYPHKILTGRREQLSTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAALGLAICAEKEQENR
DXS_SHIFL       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOSE       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOLC       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOL5       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECOHS       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO8A       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_ECO24       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_VIBSL       VWDVGHQAYPHKILTGRRDRLSTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAISAKKEGKNR
DXS_VIBCM       IWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAGKEGKDR
DXS_VIBCH       IWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAGKEGKDR
DXS_VIBC3       IWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAGKEGKDR
DXS_MANSM       IWDVGHQAYPHKILTGRRERMTTIRQKDGIHPFPWREESEFDVLSVGHXXXXXXXXXXXXXXXEKENAGR
DXS_ECOLU       IWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVXXXXXXXXXXXXXXXXXEKEGKNR
DXS_DESHY       IWDVGHQSYVHKLVTGRQKEFKSLRLYKGLSGFPKRCESPHDCFETGHSSTSISAAVGFAKARDLRKEKN
DXS_AZOSB       VWDVGHQTYGHKILTGRREAMSGLRHWGGISGFPRRCESEYDTFGTAHSSTSISAALGMAVAARDRGEDR
DXS_VIBFM       IWDVGHQAYPHKILTGRREQLSTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAALGLAICAEKEQENR
DXS_RHOFD       VWDVGHQTYPHKILTGRRERMATLRQLGGLSGFPQRGESEYDDFGTAHSSTSISAALGMALAAKIRGEER
DXS_PSEAE       VWDVGHQAYPHKILTERRELMGTLRQKNGLAAFPRRAESEYDTFGVGHSSTSISAALGMAIAARLQGKER
DXS_PSEAB       VWDVGHQAYPHKILTERRELMGTLRQKNGLAAFPRRAESEYDTFGVGHSSTSISAALGMAIAARLQGKER
DXS_PSEA8       VWDVGHQAYPHKILTERRELMGTLRQKNGLAAFPRRAESEYDTFGVGHSSTSISAALGMAIAARLQGKER
DXS_DECAR       VWDVGHQCYAHKVLTGRREGMSTLRMHGGVSGFPKRAESPYDTFGVGHSSTSISAALGMALAAKHKGEDR
DXS_CARHZ       IWDVGHQAYAHKILTGRKKQFKTLRTFGGLSGFPKRDE