[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21453.1

[Show Plain Result]


## Summary of Sequence Search
    1::430
   30::156     1e-05  27%  590 aa  NU5M_TRYBB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  414::462     0.001  35%  514 aa  MVIN_BUCAP RecName: Full=Virulence factor mviN homolog;
    1::430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NU5M_TRYBB      ----------------------------------------------------------------------
MVIN_BUCAP      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxLSLISVLLLEGIYFYNFTTPEFNVNVCQLPFWSLCVYYSWKIFDKK
NU5M_TRYBB      ------------------------LSLVMIIFIVLCMIFSFLM----VSVCLYGYY----YYDFCL----
MVIN_BUCAP      --------------------------------------------------CSIASWINFFLLYWKLYQKG


                         +         .         .         .         .         *         .:210
query           VINFKHCFLLGVFAAVGFLSKYLFVYLLISIVLLFFYIIFVKKYQKFDFKYLISFEVFIVLLIPHLIWLT
NU5M_TRYBB      ILMLDFCFIWLTYVCSGF---YMFIMLLINMVFCFFYAFYYMYFDMLLGRFLIIFWIFVVCM---NLFIL
MVIN_BUCAP      IINFK-------------LNDFIFIFLLIAVLVMTFFLIFM-----------------------------


                         .         .         .         +         .         .         .:280
query           NNDYITITYGLARTGLETSSLLDHITYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NU5M_TRYBB      SYDFLTAYCGWELLGLFSFFLISYFWY-------------------------------------------
MVIN_BUCAP      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NU5M_TRYBB      ----------------------------------------------------------------------
MVIN_BUCAP      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NU5M_TRYBB      ----------------------------------------------------------------------
MVIN_BUCAP      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxx
NU5M_TRYBB      ----------
MVIN_BUCAP      ----------