[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21456.1

[Show Plain Result]


## Summary of Sequence Search
    1::131
   16::136     2e-21  41%  146 aa  MUCA_SALTY RecName: Full=Protein mucA;       
   16::136     2e-21  41%  146 aa  MUCA_ECOLX RecName: Full=Protein mucA;       
   20::141     1e-20  46%  145 aa  IMPA_SHIFL RecName: Full=Protein impA;       
   20::141     1e-20  46%  145 aa  IMPA_SALTY RecName: Full=Protein impA;       
   20::141     1e-20  46%  145 aa  IMPA_SALCH RecName: Full=Protein impA;       
   20::141     1e-20  46%  145 aa  IMPA_ECOLX RecName: Full=Protein impA;       
   15::136     3e-19  39%  140 aa  SAMA_SALTY RecName: Full=Protein samA;       
   13::135     4e-19  37%  139 aa  UMUD_SALTY RecName: Full=Protein umuD;       
  102::228     1e-14  32%  231 aa  LEXA_LEPCP RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::190     7e-13  35%  204 aa  LEXA_CLONN RecName: Full=LexA repressor;         EC=3.4.21.88;
   96::221     2e-12  34%  224 aa  LEXA_RHOFD RecName: Full=LexA repressor;         EC=3.4.21.88;
  104::222     2e-12  30%  225 aa  LEXA_METPP RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::200     2e-12  35%  202 aa  LEXA_AZOVD RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::211     3e-12  32%  216 aa  LEXA_RALSO RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::211     3e-12  29%  216 aa  LEXA_BURP8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::200     3e-12  34%  202 aa  LEXA1_PSESM RecName: Full=LexA repressor 1;         EC=3.4.21.88;
   87::211     4e-12  32%  216 aa  LEXA_RALPJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::167     4e-12  42%  209 aa  LEXA_PSYIN RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::200     4e-12  34%  202 aa  LEXA_PSEPU RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::202     4e-12  31%  204 aa  LEXA_PSEMY RecName: Full=LexA repressor;         EC=3.4.21.88;
  106::218     4e-12  35%  234 aa  LEXA_POLNA RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::207     4e-12  31%  211 aa  LEXA_COLP3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::172     4e-12  33%  204 aa  LEXA_CLOAB RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::200     4e-12  34%  202 aa  LEXA1_PSEPK RecName: Full=LexA repressor 1;         EC=3.4.21.88;
   85::164     5e-12  40%  202 aa  LEXA_PSECL RecName: Full=LexA repressor;         EC=3.4.21.88;
   84::202     6e-12  32%  205 aa  LEXA_PRORE RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::177     6e-12  39%  200 aa  LEXA_HAHCH RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::185     6e-12  36%  202 aa  LEXA_CLOK5 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::185     6e-12  36%  202 aa  LEXA_CLOK1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::187     6e-12  33%  204 aa  LEXA_ALCBS RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::206     8e-12  31%  210 aa  LEXA_HAES2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::206     8e-12  31%  210 aa  LEXA_HAES1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   74::186     8e-12  38%  202 aa  LEXA_CALS8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::216     1e-11  27%  218 aa  LEXA_RALME RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::216     1e-11  27%  218 aa  LEXA_RALEU RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::231     1e-11  33%  234 aa  LEXA_POLSJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     1e-11  28%  215 aa  LEXA_BURS3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     1e-11  28%  215 aa  LEXA_BURCM RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     1e-11  28%  215 aa  LEXA_BURA4 RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::211     1e-11  28%  216 aa  LEXA_BURXL RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     1e-11  28%  215 aa  LEXA_BURVG RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     1e-11  35%  206 aa  LEXA_BACCN RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::202     2e-11  34%  204 aa  LEXA_PSEAE RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::202     2e-11  34%  204 aa  LEXA_PSEAB RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::202     2e-11  34%  204 aa  LEXA_PSEA8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::199     2e-11  37%  203 aa  LEXA_PROMH RecName: Full=LexA repressor;         EC=3.4.21.88;
   80::157     2e-11  41%  201 aa  LEXA_PHOLL RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::187     2e-11  34%  203 aa  LEXA_CLOPE RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::187     2e-11  34%  203 aa  LEXA_CLOP1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::196     2e-11  33%  200 aa  LEXA_THIDA RecName: Full=LexA repressor;         EC=3.4.21.88;
   98::202     2e-11  34%  213 aa  LEXA_CLOTH RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::187     2e-11  34%  203 aa  LEXA_CLOPS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     2e-11  37%  202 aa  LEXA_CITK8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::211     2e-11  27%  216 aa  LEXA_BURPP RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     2e-11  28%  215 aa  LEXA_BURM1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     2e-11  28%  215 aa  LEXA_BURCJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     2e-11  28%  215 aa  LEXA_BURCH RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     2e-11  28%  215 aa  LEXA_BURCC RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::212     2e-11  28%  215 aa  LEXA_BURCA RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACHK RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACCZ RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACCR RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACCQ RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACC1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACC0 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACAN RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::189     2e-11  34%  206 aa  LEXA_BACAH RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::162     2e-11  41%  208 aa  LEXA_ALHEH RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::203     2e-11  31%  207 aa  LEXA_AERS4 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::193     2e-11  35%  201 aa  LEXA1_GEOSL RecName: Full=LexA repressor 1;         EC=3.4.21.88;
   81::198     3e-11  32%  202 aa  LEXA_SODGM RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::216     3e-11  28%  218 aa  LEXA_RALEJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::202     3e-11  34%  204 aa  LEXA_PSEA7 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     3e-11  37%  202 aa  LEXA_ENTS8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::184     3e-11  33%  200 aa  LEXA_CLOTE RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::212     3e-11  29%  216 aa  LEXA_BORPE RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::212     3e-11  29%  216 aa  LEXA_BORBR RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::209     4e-11  29%  213 aa  LEXA_MANSM RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::175     4e-11  35%  216 aa  LEXA_BORPA RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPY RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPP RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPN RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPG RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPE RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPB RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERPA RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  36%  202 aa  LEXA_YERP3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     5e-11  35%  202 aa  LEXA_YERE8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   80::162     5e-11  37%  200 aa  LEXA_TERTT RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_SHISS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_SHIFL RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_SHIF8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_SHIDS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_SHIBS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_SHIB3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::215     5e-11  31%  217 aa  LEXA_RALEH RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::196     5e-11  34%  202 aa  LEXA_MARAV RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::180     5e-11  38%  219 aa  LEXA_JANMA RecName: Full=LexA repressor;         EC=3.4.21.88;
   95::174     5e-11  39%  226 aa  LEXA_HALHL RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ESCF3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOUT RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOSM RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOSE RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOLU RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOLI RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOLC RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOL6 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOL5 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOK1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOHS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECODH RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECOBW RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO8A RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO81 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO7I RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO5E RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO57 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO55 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO45 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO27 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     5e-11  38%  202 aa  LEXA_ECO24 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURTA RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURPS RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURP6 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURP1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURP0 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURMS RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURMA RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURM9 RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::210     5e-11  28%  215 aa  LEXA_BURM7 RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::187     5e-11  33%  204 aa  LEXA_BACWK RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     7e-11  35%  202 aa  LEXA_EDWI9 RecName: Full=LexA repressor;         EC=3.4.21.88;
  103::204     7e-11  35%  215 aa  LEXA_CLOCE RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::209     7e-11  30%  213 aa  LEXA_BORA1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     9e-11  37%  202 aa  LEXA_SERP5 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALTY RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALTI RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALSV RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALPK RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALPC RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALPB RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALPA RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALNS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALHS RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALG2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALEP RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALDC RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALCH RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALAR RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     9e-11  36%  202 aa  LEXA_SALA4 RecName: Full=LexA repressor;         EC=3.4.21.88;
   80::178     9e-11  35%  201 aa  LEXA_SACD2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::199     9e-11  35%  201 aa  LEXA_GEOUR RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::170     9e-11  39%  204 aa  LEXA_DESHY RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::170     9e-11  39%  204 aa  LEXA_DESHD RecName: Full=LexA repressor;         EC=3.4.21.88;
   99::224     1e-10  31%  227 aa  LEXA_VARPS RecName: Full=LexA repressor;         EC=3.4.21.88;
   84::201     1e-10  28%  205 aa  LEXA_SHELP RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::193     1e-10  34%  207 aa  LEXA_MARMS RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::215     1e-10  30%  217 aa  LEXA_CUPTR RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::165     1e-10  39%  207 aa  LEXA_AERHH RecName: Full=LexA repressor;         EC=3.4.21.88;
   84::161     2e-10  38%  205 aa  LEXA_IDILO RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     2e-10  35%  202 aa  LEXA_ENT38 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     2e-10  33%  201 aa  LEXA_CLOBM RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     2e-10  33%  201 aa  LEXA_CLOBL RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     2e-10  33%  201 aa  LEXA_CLOBK RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     2e-10  33%  201 aa  LEXA_CLOBJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     2e-10  33%  201 aa  LEXA_CLOB6 RecName: Full=LexA repressor;         EC=3.4.21.88;
  110::183     2e-10  38%  224 aa  LEXA_BORPD RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::163     2e-10  36%  202 aa  LEXA_AZOSB RecName: Full=LexA repressor;         EC=3.4.21.88;
   13::135     2e-10  28%  139 aa  UMUD_SHIFL RecName: Full=Protein umuD;       
   13::135     2e-10  28%  139 aa  UMUD_ECOLI RecName: Full=Protein umuD;       
   13::135     2e-10  28%  139 aa  UMUD_ECO57 RecName: Full=Protein umuD;       
   85::171     2e-10  34%  206 aa  LEXA_SHEHH RecName: Full=LexA repressor;         EC=3.4.21.88;
  104::187     2e-10  36%  224 aa  LEXA_DELAS RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::174     2e-10  40%  207 aa  LEXA_BACHD RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::206     2e-10  31%  210 aa  LEXA_ACTSZ RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::199     3e-10  34%  202 aa  LEXA_PECCP RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     3e-10  36%  202 aa  LEXA_KLEP3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::180     3e-10  36%  219 aa  LEXA_HERAR RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::203     3e-10  35%  206 aa  LEXA_ALKMQ RecName: Full=LexA repressor;         EC=3.4.21.88;
   76::162     5e-10  39%  203 aa  LEXA_AZOSE RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::171     6e-10  33%  206 aa  LEXA_SHEPA RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::188     6e-10  34%  211 aa  LEXA_PASMU RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::180     6e-10  35%  202 aa  LEXA_KLEP7 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     6e-10  32%  201 aa  LEXA_CLOBH RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::190     6e-10  32%  201 aa  LEXA_CLOB1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   80::197     6e-10  34%  200 aa  LEXA_CELJU RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::192     6e-10  36%  206 aa  LEXA_ALKOO RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::195     6e-10  32%  203 aa  LEXA2_GEOSL RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   85::188     8e-10  35%  207 aa  LEXA_HAEIG RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::188     8e-10  35%  207 aa  LEXA_HAEIE RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::188     8e-10  35%  207 aa  LEXA_HAEI8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::190     8e-10  33%  207 aa  LEXA_GEOSW RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::198     8e-10  34%  202 aa  LEXA_ERWT9 RecName: Full=LexA repressor;         EC=3.4.21.88;
   82::157     1e-09  38%  202 aa  LEXA_METCA RecName: Full=LexA repressor;         EC=3.4.21.88;
   96::221     1e-09  30%  224 aa  LEXA_DIAST RecName: Full=LexA repressor;         EC=3.4.21.88;
  100::210     1e-09  37%  215 aa  LEXA_CLOD6 RecName: Full=LexA repressor;         EC=3.4.21.88;
   96::221     1e-09  30%  224 aa  LEXA_ACISJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   84::202     1e-09  31%  206 aa  LEXA_TOLAT RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::188     1e-09  36%  207 aa  LEXA_HAEIN RecName: Full=LexA repressor;         EC=3.4.21.88;
   96::184     1e-09  31%  224 aa  LEXA_ACIAC RecName: Full=LexA repressor;         EC=3.4.21.88;
  104::221     2e-09  30%  224 aa  LEXA_VEREI RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::199     2e-09  29%  202 aa  LEXA_PECCC RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::171     2e-09  33%  203 aa  LEXA_LEPIN RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::171     2e-09  33%  203 aa  LEXA_LEPIC RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::170     2e-09  36%  202 aa  LEXA_LEPBP RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::170     2e-09  36%  202 aa  LEXA_LEPBA RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::199     2e-09  29%  202 aa  LEXA_ERWCT RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::193     2e-09  31%  201 aa  LEXA_DECAR RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::191     2e-09  34%  208 aa  LEXA_BACSK RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::199     3e-09  34%  201 aa  LEXA_GEOMG RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::175     4e-09  39%  211 aa  LEXA_XYLFT RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::175     4e-09  39%  211 aa  LEXA_XYLF2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  110::193     5e-09  33%  230 aa  LEXA_SORC5 RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::179     5e-09  36%  222 aa  LEXA_MYXXD RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::175     7e-09  39%  211 aa  LEXA_XYLFM RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::190     9e-09  33%  205 aa  LEXA_SYMTH RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::171     9e-09  32%  203 aa  LEXA_LEPBL RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::171     9e-09  32%  203 aa  LEXA_LEPBJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::199     9e-09  33%  208 aa  LEXA_LACCB RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::199     9e-09  33%  208 aa  LEXA_LACC3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::175     1e-08  39%  211 aa  LEXA_XYLFA RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::167     1e-08  46%  212 aa  LEXA_CHRSD RecName: Full=LexA repressor;         EC=3.4.21.88;
  110::213     2e-08  36%  224 aa  LEXA_LEIXX RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::166     2e-08  38%  204 aa  LEXA_EXIS2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   80::193     2e-08  30%  204 aa  LEXA_CARHZ RecName: Full=LexA repressor;         EC=3.4.21.88;
   82::166     2e-08  36%  201 aa  LEXA1_XANCP RecName: Full=LexA repressor 1;         EC=3.4.21.88;
   91::175     2e-08  35%  211 aa  LEXA_STRM5 RecName: Full=LexA repressor;         EC=3.4.21.88;
  112::225     2e-08  36%  226 aa  LEXA_CLAMS RecName: Full=LexA repressor;         EC=3.4.21.88;
   82::163     2e-08  39%  205 aa  LEXA_ACIF5 RecName: Full=LexA repressor;         EC=3.4.21.88;
   82::163     2e-08  39%  205 aa  LEXA_ACIF2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::196     3e-08  33%  205 aa  LEXA_LYSSC RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::190     3e-08  32%  207 aa  LEXA_GEOKA RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::190     4e-08  31%  207 aa  LEXA_GEOTN RecName: Full=LexA repressor;         EC=3.4.21.88;
  112::225     4e-08  36%  226 aa  LEXA_CLAM3 RecName: Full=LexA repressor;         EC=3.4.21.88;
  135::248     4e-08  34%  249 aa  LEXA_ARTCA RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::195     7e-08  35%  206 aa  LEXA_STAEQ RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::188     7e-08  34%  205 aa  LEXA_MOOTA RecName: Full=LexA repressor;         EC=3.4.21.88;
   84::178     7e-08  34%  203 aa  LEXA_DESAA RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::205     9e-08  26%  209 aa  LEXA_HAEPS RecName: Full=LexA repressor;         EC=3.4.21.88;
  135::248     9e-08  34%  249 aa  LEXA_ARTS2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::174     1e-07  37%  207 aa  LEXA_STAHJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   75::144     1e-07  34%  205 aa  LEXA_SHEDO RecName: Full=LexA repressor;         EC=3.4.21.88;
  133::246     1e-07  34%  247 aa  LEXA_ARTAT RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::163     2e-07  31%  197 aa  LEXA_THEP1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::186     2e-07  27%  207 aa  LEXA_THENN RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::186     2e-07  27%  197 aa  LEXA_THENE RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::195     2e-07  23%  199 aa  LEXA_THEM4 RecName: Full=LexA repressor;         EC=3.4.21.88;
  136::224     2e-07  34%  252 aa  LEXA_THEFY RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAW RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAS RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAR RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAN RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAM RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAE RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAC RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAAB RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAA8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAA3 RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::187     2e-07  34%  207 aa  LEXA_STAA1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::175     2e-07  33%  208 aa  LEXA_FINM2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::174     2e-07  35%  207 aa  LEXA_BREBN RecName: Full=LexA repressor;         EC=3.4.21.88;
  109::185     2e-07  32%  230 aa  LEXA_ANASK RecName: Full=LexA repressor;         EC=3.4.21.88;
  108::184     2e-07  32%  229 aa  LEXA_ANADE RecName: Full=LexA repressor;         EC=3.4.21.88;
  107::183     2e-07  32%  228 aa  LEXA_ANAD2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  161::264     2e-07  33%  275 aa  LEXA_ACIC1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::177     3e-07  33%  213 aa  LEXA_XANCI RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::177     3e-07  33%  213 aa  LEXA_XANCA RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::172     3e-07  33%  204 aa  LEXA_SYNWW RecName: Full=LexA repressor;         EC=3.4.21.88;
  112::159     3e-07  46%  206 aa  LEXA_SYNFM RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::174     3e-07  37%  207 aa  LEXA_STACT RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::189     3e-07  33%  207 aa  LEXA_LACJO RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::189     3e-07  33%  207 aa  LEXA_LACGA RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::177     3e-07  33%  213 aa  LEXA2_XANOR RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   93::177     3e-07  33%  213 aa  LEXA2_XANCP RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   93::177     3e-07  33%  213 aa  LEXA2_XANAC RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   85::193     4e-07  35%  201 aa  LEXA_GEOSM RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::193     4e-07  35%  201 aa  LEXA_GEOBB RecName: Full=LexA repressor;         EC=3.4.21.88;
   78::194     4e-07  32%  202 aa  LEXA2_PSEPK RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   89::170     5e-07  32%  206 aa  LEXA_BACA2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::163     6e-07  30%  197 aa  LEXA_THESQ RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::163     6e-07  30%  197 aa  LEXA_THEMA RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::199     6e-07  33%  232 aa  LEXA_MYCGI RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::182     6e-07  33%  214 aa  LEXA_DESRM RecName: Full=LexA repressor;         EC=3.4.21.88;
   84::201     8e-07  23%  205 aa  LEXA_SHEWM RecName: Full=LexA repressor;         EC=3.4.21.88;
  106::214     8e-07  34%  225 aa  LEXA_PELUB RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::199     8e-07  33%  232 aa  LEXA_MYCVP RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::197     8e-07  33%  230 aa  LEXA_MYCSS RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::197     8e-07  33%  230 aa  LEXA_MYCSK RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::197     8e-07  33%  230 aa  LEXA_MYCSJ RecName: Full=LexA repressor;         EC=3.4.21.88;
  156::239     8e-07  39%  267 aa  LEXA_CORJK RecName: Full=LexA repressor;         EC=3.4.21.88;
  108::186     8e-07  32%  231 aa  LEXA_ANADF RecName: Full=LexA repressor;         EC=3.4.21.88;
   81::195     1e-06  24%  198 aa  LEXA_THEAB RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     1e-06  34%  206 aa  LEXA_SHEPW RecName: Full=LexA repressor;         EC=3.4.21.88;
  115::222     1e-06  27%  233 aa  LEXA_ROSDO RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::203     1e-06  30%  203 aa  LEXA_PELTS RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::173     1e-06  34%  207 aa  LEXA_BACLD RecName: Full=LexA repressor;         EC=3.4.21.88;
  127::209     1e-06  34%  243 aa  LEXA2_NOCFA RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   71::126     1e-06  39%  192 aa  LEXA_PHOPR RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::188     1e-06  31%  206 aa  LEXA_LACDB RecName: Full=LexA repressor;         EC=3.4.21.88;
   91::188     1e-06  31%  206 aa  LEXA_LACDA RecName: Full=LexA repressor;         EC=3.4.21.88;
  113::217     1e-06  29%  228 aa  LEXA_JANSC RecName: Full=LexA repressor;         EC=3.4.21.88;
  105::205     1e-06  32%  216 aa  LEXA1_NOCFA RecName: Full=LexA repressor 1;         EC=3.4.21.88;
   86::146     2e-06  34%  207 aa  LEXA_VIBVY RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::146     2e-06  34%  207 aa  LEXA_VIBVU RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::140     2e-06  38%  206 aa  LEXA_VIBHB RecName: Full=LexA repressor;         EC=3.4.21.88;
   79::142     2e-06  36%  208 aa  LEXA_VIBFM RecName: Full=LexA repressor;         EC=3.4.21.88;
   79::142     2e-06  36%  208 aa  LEXA_VIBF1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::174     2e-06  34%  207 aa  LEXA_STAS1 RecName: Full=LexA repressor;         EC=3.4.21.88;
  113::201     2e-06  33%  237 aa  LEXA_RHOCS RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::146     2e-06  38%  207 aa  LEXA_PSEA6 RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::174     2e-06  31%  207 aa  LEXA_OCEIH RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::169     2e-06  33%  205 aa  LEXA_BACSU RecName: Full=LexA repressor;       
   87::147     2e-06  38%  208 aa  LEXA_ALTMD RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::140     2e-06  38%  206 aa  LEXA_VIBPA RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::174     2e-06  32%  208 aa  LEXA_LACH4 RecName: Full=LexA repressor;         EC=3.4.21.88;
   78::187     2e-06  30%  202 aa  LEXA2_PSESM RecName: Full=LexA repressor 2;         EC=3.4.21.88;
   85::140     3e-06  38%  206 aa  LEXA_VIBSL RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::143     3e-06  33%  204 aa  LEXA_SHEFN RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::146     3e-06  34%  207 aa  LEXA_SHEAM RecName: Full=LexA repressor;         EC=3.4.21.88;
  127::210     3e-06  32%  243 aa  LEXA_MYCS2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  108::190     3e-06  33%  224 aa  LEXA_MYCA9 RecName: Full=LexA repressor;         EC=3.4.21.88;
   83::150     3e-06  34%  211 aa  LEXA_HAEDU RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::223     3e-06  30%  235 aa  LEXA_CAUSK RecName: Full=LexA repressor;         EC=3.4.21.88;
  132::243     4e-06  32%  246 aa  LEXA_NOCSJ RecName: Full=LexA repressor;         EC=3.4.21.88;
  124::177     4e-06  42%  211 aa  LEXA_LEUCK RecName: Full=LexA repressor;         EC=3.4.21.88;
  118::204     4e-06  32%  232 aa  LEXA_COREF RecName: Full=LexA repressor;         EC=3.4.21.88;
  143::220     4e-06  32%  257 aa  LEXA_BIFAA RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::170     4e-06  32%  206 aa  LEXA_BACP2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::148     5e-06  33%  209 aa  LEXA_VIBCM RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::148     5e-06  33%  209 aa  LEXA_VIBCH RecName: Full=LexA repressor;         EC=3.4.21.88;
   88::148     5e-06  33%  209 aa  LEXA_VIBC3 RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::219     5e-06  28%  238 aa  LEXA_GLUOX RecName: Full=LexA repressor;         EC=3.4.21.88;
  115::222     5e-06  30%  234 aa  LEXA_CAUCR RecName: Full=LexA repressor;         EC=3.4.21.88;
  127::209     5e-06  33%  241 aa  LEXA_BIFLO RecName: Full=LexA repressor;         EC=3.4.21.88;
  127::209     5e-06  33%  241 aa  LEXA_BIFLI RecName: Full=LexA repressor;         EC=3.4.21.88;
  127::209     5e-06  33%  241 aa  LEXA_BIFLD RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::141     5e-06  36%  207 aa  LEXA_ALISL RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::149     5e-06  34%  210 aa  LEXA_ACTPJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::149     5e-06  34%  210 aa  LEXA_ACTP7 RecName: Full=LexA repressor;         EC=3.4.21.88;
   89::149     5e-06  34%  210 aa  LEXA_ACTP2 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     7e-06  31%  206 aa  LEXA_SHESH RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::168     7e-06  31%  204 aa  LEXA_LISIN RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::231     7e-06  29%  242 aa  LEXA_GRABC RecName: Full=LexA repressor;         EC=3.4.21.88;
  118::204     7e-06  32%  232 aa  LEXA_CORGL RecName: Full=LexA repressor;         EC=3.4.21.88;
  139::225     7e-06  32%  253 aa  LEXA_CORGB RecName: Full=LexA repressor;         EC=3.4.21.88;
  132::215     9e-06  31%  251 aa  LEXA_RHORT RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::168     9e-06  31%  204 aa  LEXA_LISW6 RecName: Full=LexA repressor;         EC=3.4.21.88;
  125::178     9e-06  40%  212 aa  LEXA_LEUMM RecName: Full=LexA repressor;         EC=3.4.21.88;
  128::210     1e-05  31%  244 aa  LEXA_MYCUA RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     1e-05  31%  217 aa  LEXA_MYCPA RecName: Full=LexA repressor;         EC=3.4.21.88;
   86::176     1e-05  32%  209 aa  LEXA_ENTFA RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     2e-05  31%  206 aa  LEXA_SHEON RecName: Full=LexA repressor;         EC=3.4.21.88;
  113::227     2e-05  28%  238 aa  LEXA_RHOCA RecName: Full=LexA repressor;         EC=3.4.21.88;
  128::210     2e-05  31%  244 aa  LEXA_MYCMM RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::198     2e-05  31%  232 aa  LEXA_MYCA1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::168     2e-05  30%  204 aa  LEXA_LISMO RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::168     2e-05  30%  204 aa  LEXA_LISMH RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::168     2e-05  30%  204 aa  LEXA_LISMF RecName: Full=LexA repressor;         EC=3.4.21.88;
   87::168     2e-05  30%  204 aa  LEXA_LISMC RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::220     2e-05  28%  231 aa  LEXA_SILPO RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     2e-05  31%  206 aa  LEXA_SHESA RecName: Full=LexA repressor;         EC=3.4.21.88;
  111::224     2e-05  30%  235 aa  LEXA_MAGSA RecName: Full=LexA repressor;         EC=3.4.21.88;
  131::242     2e-05  28%  253 aa  LEXA_GLUDA RecName: Full=LexA repressor;         EC=3.4.21.88;
  136::219     2e-05  32%  250 aa  LEXA_FRASN RecName: Full=LexA repressor;         EC=3.4.21.88;
   94::166     2e-05  34%  207 aa  LEXA_DESDG RecName: Full=LexA repressor;         EC=3.4.21.88;
  122::228     2e-05  29%  240 aa  LEXA_AGRRK RecName: Full=LexA repressor;         EC=3.4.21.88;
  107::220     2e-05  27%  231 aa  LEXA_ACICJ RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHESW RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHESR RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHESM RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHEPC RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHEB9 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHEB8 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHEB5 RecName: Full=LexA repressor;         EC=3.4.21.88;
   85::145     3e-05  31%  206 aa  LEXA_SHEB2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     3e-05  31%  217 aa  LEXA_MYCTU RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     3e-05  31%  217 aa  LEXA_MYCTA RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     3e-05  31%  217 aa  LEXA_MYCLE RecName: Full=LexA repressor;         EC=3.4.21.88;
  119::201     3e-05  31%  235 aa  LEXA_MYCLB RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     3e-05  31%  217 aa  LEXA_MYCBT RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     3e-05  31%  217 aa  LEXA_MYCBP RecName: Full=LexA repressor;         EC=3.4.21.88;
  101::183     3e-05  31%  217 aa  LEXA_MYCBO RecName: Full=LexA repressor;         EC=3.4.21.88;
   90::166     3e-05  33%  206 aa  LEXA_EXISA RecName: Full=LexA repressor;         EC=3.4.21.88;
   93::174     3e-05  32%  208 aa  LEXA_LACAC RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::223     4e-05  29%  234 aa  LEXA_STRCO RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::223     4e-05  30%  234 aa  LEXA_STRAW RecName: Full=LexA repressor;         EC=3.4.21.88;
   95::218     4e-05  33%  218 aa  LEXA_ROSS1 RecName: Full=LexA repressor;         EC=3.4.21.88;
  122::228     4e-05  30%  239 aa  LEXA_OCHA4 RecName: Full=LexA repressor;         EC=3.4.21.88;
  105::196     4e-05  34%  204 aa  LEXA_LACSS RecName: Full=LexA repressor;         EC=3.4.21.88;
  125::228     6e-05  29%  239 aa  LEXA_STRCL RecName: Full=LexA repressor;         EC=3.4.21.88;
  141::213     6e-05  30%  229 aa  LEXA_PHEZH RecName: Full=LexA repressor;         EC=3.4.21.88;
  114::231     6e-05  26%  232 aa  LEXA_PARDP RecName: Full=LexA repressor;         EC=3.4.21.88;
  144::220     6e-05  33%  232 aa  LEXA_MARMM RecName: Full=LexA repressor;         EC=3.4.21.88;
  137::222     6e-05  33%  253 aa  LEXA_FRAAA RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::222     7e-05  24%  237 aa  LEXA_BEII9 RecName: Full=LexA repressor;         EC=3.4.21.88;
  123::204     1e-04  32%  241 aa  LEXA_SILST RecName: Full=LexA repressor;         EC=3.4.21.88;
  110::191     1e-04  32%  228 aa  LEXA_RHOS5 RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::227     1e-04  28%  239 aa  LEXA_RHILW RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::227     1e-04  28%  239 aa  LEXA_RHIL3 RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::227     1e-04  28%  239 aa  LEXA_RHIEC RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::227     1e-04  28%  239 aa  LEXA_RHIE6 RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::189     1e-04  29%  206 aa  LEXA_LACS1 RecName: Full=LexA repressor;         EC=3.4.21.88;
   76::134     1e-04  36%  210 aa  LEXA_DEIRA RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     1e-04  33%  240 aa  LEXA_BRUME RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::228     1e-04  29%  240 aa  LEXA_AGRT5 RecName: Full=LexA repressor;         EC=3.4.21.88;
  140::225     2e-04  31%  256 aa  LEXA_FRASC RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUSU RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUSI RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUO2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUMB RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUC2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUAB RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUA2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::229     2e-04  33%  240 aa  LEXA_BRUA1 RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::227     2e-04  26%  239 aa  LEXA_RHIRD RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::226     2e-04  26%  238 aa  LEXA_RHIME RecName: Full=LexA repressor;         EC=3.4.21.88;
  116::187     2e-04  31%  233 aa  LEXA_NITWN RecName: Full=LexA repressor;         EC=3.4.21.88;
  152::224     2e-04  27%  239 aa  LEXA_METS4 RecName: Full=LexA repressor;         EC=3.4.21.88;
  153::225     2e-04  27%  240 aa  LEXA_METNO RecName: Full=LexA repressor;         EC=3.4.21.88;
  138::221     2e-04  29%  231 aa  LEXA_MAGSM RecName: Full=LexA repressor;         EC=3.4.21.88;
  115::186     2e-04  31%  232 aa  LEXA_BRASO RecName: Full=LexA repressor;         EC=3.4.21.88;
  115::186     2e-04  31%  232 aa  LEXA_BRASB RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::226     3e-04  25%  238 aa  LEXA_SINMW RecName: Full=LexA repressor;         EC=3.4.21.88;
  128::234     3e-04  27%  245 aa  LEXA_RHILO RecName: Full=LexA repressor;         EC=3.4.21.88;
  120::178     3e-04  38%  212 aa  LEXA_OENOB RecName: Full=LexA repressor;         EC=3.4.21.88;
  145::199     3e-04  31%  233 aa  LEXA_ERYLH RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::227     3e-04  26%  239 aa  LEXA_AGRVS RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::173     4e-04  33%  208 aa  LEXA_LACRJ RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::173     4e-04  33%  208 aa  LEXA_LACRD RecName: Full=LexA repressor;         EC=3.4.21.88;
  146::187     5e-04  38%  233 aa  LEXA_NITHX RecName: Full=LexA repressor;         EC=3.4.21.88;
  155::227     5e-04  25%  242 aa  LEXA_METRJ RecName: Full=LexA repressor;         EC=3.4.21.88;
  119::225     5e-04  26%  236 aa  LEXA_MESSB RecName: Full=LexA repressor;         EC=3.4.21.88;
  110::191     6e-04  31%  228 aa  LEXA_RHOS4 RecName: Full=LexA repressor;         EC=3.4.21.88;
  109::190     6e-04  31%  227 aa  LEXA_RHOS1 RecName: Full=LexA repressor;         EC=3.4.21.88;
  147::197     6e-04  38%  234 aa  LEXA_RHOP2 RecName: Full=LexA repressor;         EC=3.4.21.88;
  145::195     6e-04  38%  232 aa  LEXA_OLICO RecName: Full=LexA repressor;         EC=3.4.21.88;
  121::173     6e-04  33%  208 aa  LEXA_LACF3 RecName: Full=LexA repressor;         EC=3.4.21.88;
  144::185     6e-04  38%  231 aa  LEXA_BRAJA RecName: Full=LexA repressor;         EC=3.4.21.88;
  148::198     8e-04  36%  235 aa  LEXA_RHOPS RecName: Full=LexA repressor;         EC=3.4.21.88;
  139::215     8e-04  30%  227 aa  LEXA_HYPNA RecName: Full=LexA repressor;         EC=3.4.21.88;
   92::163     8e-04  31%  210 aa  LEXA_ACIBL RecName: Full=LexA repressor;         EC=3.4.21.88;
    1::131

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLTIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKP
MUCA_SALTY      ---SIPFYLQRISAGFPSPAQGYEKQELNLHEYCVRHPSATYFLRVSGSSMEDGRIHDGDVLVVDRSLTA
MUCA_ECOLX      ---SIPFYLQRISAGFPSPAQGYEKQELNLHEYCVRHPSATYFLRVSGSSMEDGRIHDGDVLVVDRSLTA
IMPA_SHIFL      -----PLFADRCQAGFPSPATDYAEQELDLNSYCISRPAATFFLRASGESMNQAGVQNGDLLVVDRAEKP
IMPA_SALTY      -----PLFADRCQAGFPSPATDYAEQELDLNSYCISRPAATFFLRASGESMNQAGVQNGDLLVVDRAEKP
IMPA_SALCH      -----PLFADRCQAGFPSPATDYAEQELDLNSYCISRPAATFFLRASGESMNQAGVQNGDLLVVDRAEKP
IMPA_ECOLX      -----PLFADRCQAGFPSPATDYAEQELDLNSYCISRPAATFFLRASGESMNQAGVQNGDLLVVDRAEKP
SAMA_SALTY      ---TAPLFTERCPAGFPSPAADYTEEELDLNAYCIRRPAATFFVRAIGDSMKEMGLHSGDLMVVDKAEKP
UMUD_SALTY      --IPLPFFSYLVPCGFPSPAADYIEQRIDLNELLVSHPSSTYFVKASGDSMIEAGISDGDLLVVDSSRNA
LEXA_LEPCP      -QLTLPL-VGRVAAGSPILAQQHIDQSYTFEAHMFSRKP-DFLLKVRGMSMRDAGILDGDLIAVQRASEA
LEXA_CLONN      --------LGKVTAGTPILAVENIEDTFPISLNFIPSNKDLFMLKISGESMIDAGILDGDLAIIEKTNTA
LEXA_RHOFD      -QLMLPL-IGRVAAGSPILAQEHIDQTYYVESSLFQRKP-DYLLKVRGMSMRDAGIMDGDLLAVQSTRDA
LEXA_METPP      ----------RVAAGSPILAQEHIDQSYAIEASMFPRRP-DYLLKVRGMSMRDAGILDGDLLAVQKAREA
LEXA_AZOVD      ----------RVAAGAPILAQQHIEETCQIDPGFF-HPRADYLLRVRGMSMKDVGIYDGDLLAVHTCREA
LEXA_RALSO      MQLTLPL-VGRVAAGSPILAAEHIDRQYQVDPSLFSSRP-DFLLKVRGMSMRDAGILDGDLLAVQRAAEA
LEXA_BURP8      MQLSLPL-VGRVAAGSPILAQEHISQTYMCDPSLFSSKP-DYLLKVRGLSMRDAGIFDGDLLAVQKKSEA
LEXA1_PSESM     ----------RVAAGAPILAQQHIEESCNINPSFF-HPSANYLLRVHGMSMKDVGILDGDLLAVHTTREA
LEXA_RALPJ      MQLTLPL-VGRVAAGSPILAAEHIDRQYQVDPSLFSAQP-DFLLKVRGMSMRDAGILDGDLLAVQRASEA
LEXA_PSYIN      ----------QVAAGEPILAQQHIETYYDVDPALF-HPSADFLLRVQGESMKDIGIMDGDLLAVHKTQDI
LEXA_PSEPU      ----------RVAAGAPILAEQHIEQSCNINPAFF-HPQADYLLRVHGMSMKDVGIFDGDLLAVHTCREA
LEXA_PSEMY      ----------RVAAGAPILAQQHVEESCQINPAFF-HPKADYLLRVRGMSMKDIGIFDGDLLAVHTTREA
LEXA_POLNA      -QLTLPL-VGRVAAGSPILAQEHIERTYFFESRLFEQQP-DYLLKVRGMSMRDIGIMDGDLLAVKQAREA
LEXA_COLP3      ----------RVAAGEPILAQEHIEEHYKMDGNLF-HPAADYLLRVNGESMKDIGILDGDLLAVHQTTEV
LEXA_CLOAB      ----------KVQAGQPILAVENIDDYLTIPLNFVRNTNDLFILKISGNSMIEAGIYDGDLAIIEKTNYA
LEXA1_PSEPK     ----------RVAAGAPILAEQHIEQSCNINPAFF-HPQADYLLRVHGMSMKDVGIFDGDLLAVHTCREA
LEXA_PSECL      ----------RVAAGAPILAEQHIEESCNINPAFF-HPRADYLLRVHGMSMKDIGIFDGDLLAVHTTREA
LEXA_PRORE      ----------RVAAGEPLLAQEHIESHYQVDPELFKP-HADFLLRVNGMSMKDIGIMDGDLLAVHKTQNV
LEXA_HAHCH      ----------QVAAGYPILAQENIEEYCELPPSFF-TPSADYFLRVKGMSMKDVGILDGDLLAVHRTTDI
LEXA_CLOK5      -------------AGMPIIAVENIEDYFPLPMDYIKNKREIFMLRVKGESMVDAGILDGDLSLIEKVHSA
LEXA_CLOK1      -------------AGMPIIAVENIEDYFPLPMDYIKNKREIFMLRVKGESMVDAGILDGDLSLIEKVHSA
LEXA_ALCBS      ----------KVAAGIPIEAIENVERTVPVPQGLFKQRP-TYLLKVQGDSMVDAGIFDGDLIAVRKSNVA
LEXA_HAES2      ----------RVAAGEPILAEQHIEATYQVDANMFKP-QADFLLKVYGQSMKDIGILDGDLLAVHSTKDI
LEXA_HAES1      ----------RVAAGEPILAEQHIEATYQVDANMFKP-QADFLLKVYGQSMKDIGILDGDLLAVHSTKDI
LEXA_CALS8      ------FYVHKVTAGEPILAVENIEDTITLPYDLVGTEDA-FLLRVKGDSMIDAGIFDNDIIIVKRQNVA
LEXA_RALME      LQLTLPL-VGRVAAGSPILAAEHIDRQYQVDASVFDERP-DYLLRVRGLSMRDAGILDGDLLAVKKASEA
LEXA_RALEU      LQLTLPL-VGRVAAGSPILAAEHIDRQYQVDASVFDERP-DYLLRVRGLSMRDAGILDGDLLAVKKASEA
LEXA_POLSJ      ----------RVAAGSPILAQEHIEQTYYFESSLFQRQP-DYLLKVRGMSMRDAGIIDGDLLAVKQAKEA
LEXA_BURS3      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURCM      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURA4      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURXL      MQLSLPL-IGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGIFDGDLLAVQKKSEA
LEXA_BURVG      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BACCN      ----------KVTAGLPITAVESVEEHFPLPASIIAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQHSA
LEXA_PSEAE      ----------RVAAGAPILAEQNIEESCRINPAFF-NPRADYLLRVRGMSMKDIGILDGDLLAVHVTREA
LEXA_PSEAB      ----------RVAAGAPILAEQNIEESCRINPAFF-NPRADYLLRVRGMSMKDIGILDGDLLAVHVTREA
LEXA_PSEA8      ----------RVAAGAPILAEQNIEESCRINPAFF-NPRADYLLRVRGMSMKDIGILDGDLLAVHVTREA
LEXA_PROMH      -------------AGEPLLAQEHIESHYQVDPMLFKP-SADFLLRVNGMSMKDIGIMDGDLLAVHKTQDV
LEXA_PHOLL      ----------RVAAGEPLLAQEHIESHYQVDPALFKP-SADFLLRVSGMSMKDVGIMDGDLLAVHKTQNV
LEXA_CLOPE      ----------KVTAGMPILATENIEDMFQMPINYVKHNNDLFILKVTGDSMIEAGILDGDLAIIEQKNVA
LEXA_CLOP1      ----------KVTAGMPILATENIEDMFQIPINYVKHNNDLFILKVTGDSMIEAGILDGDLAIIEQKNVA
LEXA_THIDA      ----------------PILAQENIERHVQVDTALF-SPRADYLLKVRGQSMKDIGILDGDLLAVHRSAEA
LEXA_CLOTH      ----------KVTAGQPILAVENIEDTFPLPLDFVQN-STVFMLRVQGDSMIEAGIFDNDYIVVKQQSTA
LEXA_CLOPS      ----------KVTAGMPILATENIEDMFQIPINYVKHNNDLFILKVTGDSMIEAGILDGDLAIIEQKNIA
LEXA_CITK8      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_BURPP      MQLSLPL-IGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGIFDGDLLAVQKRSEA
LEXA_BURM1      MQLSLPL-VGRVAAGSPILAQEHISQHFACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURCJ      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURCH      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURCC      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURCA      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFTSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BACHK      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACCZ      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACCR      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACCQ      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACC1      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACC0      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACAN      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_BACAH      ----------KVTAGLPITAVESVEEHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_ALHEH      ----------RVAAGSPILAEAHIDRHYRVDTHLFSPRP-DYLLRVRGMSMRDAGILDGDLLVVHRTHEA
LEXA_AERS4      ----------KVAAGEPILAQEHIESHYQVDPALF-HPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEV
LEXA1_GEOSL     -------------AGLPQPAVEDIEEYFAIDRSMVRG--GTFFLRVKGDSMINAAIVEGDLALVRPQATA
LEXA_SODGM      ----------RVAAGEPLLATQHIESHYQVDPALFKP-HADFLLRVSGMSMKDIGIMDGDLLAVHKTQDA
LEXA_RALEJ      MQLTLPL-VGRVAAGSPILAAEHIDRQYQVDASVFDERP-DYLLRVRGLSMRDAGILDGDLLAVRKASEA
LEXA_PSEA7      ----------RVAAGAPILAEQNIEESCRINPAFF-NPRADYLLRVRGMSMKDIGILDGDLLAVHVTREA
LEXA_ENTS8      ----------RVAAGEPLLAQQHIEGHYQVDPGLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_CLOTE      -------------AGKPILAVENIEDTFALPINYVRNKKQLFALKIKGDSMIDTGILDGDLAIVEKNNSV
LEXA_BORPE      -QLVLPL-VGRVAAGSPILASEHVEREVGVDPGLFAQTP-DYLLKVRGMSMRDAGILEGDLLAVKRAAEA
LEXA_BORBR      -QLVLPL-VGRVAAGSPILASEHVEREVGVDPGLFAQTP-DYLLKVRGMSMRDAGILEGDLLAVKRAAEA
LEXA_MANSM      ----------RVAAGEPILAEQHIEGTYKVDADMFKP-QADFLLKVYGQSMKDIGILDGDLLAVHSTKDV
LEXA_BORPA      -QLVLPL-VGRVAAGSPILASEHVEREVGVDPGLFTQTP-DYLLKVRGMSMRDAGILEGDLLAVKRAAEA
LEXA_YERPY      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPS      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPP      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPN      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPG      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPE      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPB      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERPA      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERP3      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_YERE8      ----------RVAAGEPLLAQQHIEGHYKVDPSMFKP-SADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_TERTT      ----------RVAAGSPILAQEHIEDYCDIP-HNFFSPKADFLLTVHGMSMKDIGILDGDLLAVHKTDQV
LEXA_SHISS      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SHIFL      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SHIF8      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SHIDS      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SHIBS      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SHIB3      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_RALEH      MQLTLPL-VGRVAAGSPILAAEHIDRQYQVDASVFDERP-DYLLRVRGLSMRDAGILDGDLLAVRRASEA
LEXA_MARAV      ----------QVAAGSPILAQEHIEDHCTLQPGFF-SPSADYLLRVRGMSMKDIGILDGDLLAVHSTQDV
LEXA_JANMA      MQLSLPL-VGRVAAGSPILAQEHIEATYDVDRSLFSAKP-DFLLKVRGMSMRDAGILDGDLLAVKKIDTA
LEXA_HALHL      ----------RVAAGSPLLAEESIERYCQVDASLF-SPPADYLLRVRGESMRDAGILDGDLLAVRRDTEA
LEXA_ESCF3      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOUT      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOSM      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOSE      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOLU      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOLI      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOLC      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOL6      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOL5      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOK1      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOHS      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECODH      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECOBW      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO8A      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO81      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO7I      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO5E      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO57      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO55      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO45      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO27      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_ECO24      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-NADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_BURTA      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRAEA
LEXA_BURPS      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURP6      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURP1      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURP0      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURMS      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURMA      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURM9      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BURM7      MQLSLPL-VGRVAAGSPILAQEHISQHYACDPALFSSKP-DYLLKVRGLSMRDAGILDGDLLAVQKRTEA
LEXA_BACWK      ----------KVTAGLPITAVESVEDHFPLPASIVAGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSA
LEXA_EDWI9      ----------QVAAGEPLLAQQHIEGFYQIDPSLFKP-GADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_CLOCE      -------------AGQPILAVENITDTFPLPVDFVQNSDA-FMLRIQGESMIDAGILDKDFVLVRQQSSA
LEXA_BORA1      ----------RVAAGSPILAAEHVEREVGVDPSLFSQAP-DYLLKVRGMSMRDAGILEGDLLAVKKSSEA
LEXA_SERP5      ----------RVAAGEPLLAQQHIEGHYKVDPSLFKP-SADFLLRVNGMSMRDIGILDGDLLAVHKTQDV
LEXA_SALTY      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALTI      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALSV      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALPK      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALPC      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALPB      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALPA      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALNS      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALHS      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALG2      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALEP      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALDC      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALCH      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALAR      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SALA4      ----------RVAAGEPLLAQQHIEGHYQVDPSLFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTQDV
LEXA_SACD2      ----------RVAAGNPILAEQNIEDYCDVPPDFFYP-QANYLLKVQGMSMRDAGILDGDLLAVHSTTQV
LEXA_GEOUR      -------------AGALQPAIEDIEGYFAVDRALVKGADC-FFLRVKGDSMIEAGIRSGDLALVRPQATA
LEXA_DESHY      ----------KVTAGQPILAQENIEDTFPLPVDVV-NSDTVFMLRVKGESMIDAGIMDGDLILVRQQKVA
LEXA_DESHD      ----------KVTAGQPILAQENIEDTFPLPVDVV-NSDTVFMLRVKGESMIDAGIMDGDLILVRQQKVA
LEXA_VARPS      -QLALPL-IGRVAAGSPILAQEHVDQTYYVENTLFQRQP-DYLLKVRGMSMRDAGIMDGDLLAVQATKEA
LEXA_SHELP      ----------QVAAGEPILAQEHVEQHYQVDPSMFRP-SADFLLRVRGDSMKDIGILEGDLLAVHKVEQA
LEXA_MARMS      ----------KVAAGYPILAQENIASHVNIPANMF-SPQADYFLSVSGTSMKDIGIMEGDLLAVHKTTTV
LEXA_CUPTR      LQLTLPL-VGRVAAGSPILAAEHIDRQYQVDASVFDERP-DYLLRVRGLSMRDAGILDGDLLAVRRASEA
LEXA_AERHH      ----------KVAAGEPILAQEHIESHYQVDPALF-HPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEV
LEXA_IDILO      ----------QVAAGEPLLAEQHVEGHYKIDESLF-HPAASFLLKVNGMSMRDIGILDGDLLAVHKTEQA
LEXA_ENT38      ----------RVAAGEPLLAQQHIEGHYQVDPGMFKP-SADFLLRVSGMSMKDIGILDGDLLAVHKTQDV
LEXA_CLOBM      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILDGDLAIIEKTDSA
LEXA_CLOBL      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILDGDLAIIEKTDSA
LEXA_CLOBK      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILDGDLAIIEKTDSA
LEXA_CLOBJ      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILDGDLAIIEKTDSA
LEXA_CLOB6      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILDGDLAIIEKTDSA
LEXA_BORPD      ----------------PILAAEHVEREVGVDVDLFAQTP-DYLLKVRGMSMRDAGILEGDLLAVKRAAEA
LEXA_AZOSB      ----------RVAAGNPILAAEHVEARIQFDPALF-SPRADYLLRVRGMSMRDAGILDGDLIAVHRSHEA
UMUD_SHIFL      --VTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXXVDSAITA
UMUD_ECOLI      --VTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXXVDSAITA
UMUD_ECO57      --VTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKAXXXXXXXXXXXXXXXXXVDSAITA
LEXA_SHEHH      ----------QVAAGEPILAQEHVEQHYKVDPAMFKP-SADFLLRVRGDSMKNIGILEGDLLAVHKIQQA
LEXA_DELAS      ----------RVAAGSPILAQEHIDQTYSVEPSLFQTRP-DYLLRVRGMSMRDAGIMDGDLLAVQSAHEA
LEXA_BACHD      ----------KVTAGLPITAVENVEEYFPLPEQLTAN-DNTYALRIQGDSMIEAGIFDGDLVIVRQQQTA
LEXA_ACTSZ      ----------QVAAGEPILAEQHIEGTYRVDPDMFKP-QADFLLKVNGQSMKNIGILDGDLLAVHSTKDV
LEXA_PECCP      ----------RVAAGEPLLAQEHIECHYQVDPAMFKP-SADFLLRVSGMSMKDIGIMDGDLLAVHKTEDV
LEXA_KLEP3      ----------RVAAGEPLLAQQHIEGHYQVDPSMFKP-NADFLLRVSGMSMKDIGILDGDLLAVHKTQDV
LEXA_HERAR      MQLNLPL-VGRVAAGSPILAQEHIEATYNVDKSLFSAKP-DFLLKVRGMSMRDAGILDGDLLAVKKIDSA
LEXA_ALKMQ      ----------KVTAGQPILAVENIEDTFPLPIDFVDS-ESTFILTVKGDSMIDDGIHENDYVVVRQQSDA
LEXA_AZOSE      --LGLPLVGHVA-AGRPMLAVEHIEARYQIDSALF-SPRADYLLRVRGMSMRDAGIIDSDLLAVHRTPQV
LEXA_SHEPA      ----------QVAAGEPILAQEHVEQHYKVDPAMFRP-SADFLLRVRGDSMKNIGILEGDLLAVHKIEQA
LEXA_PASMU      ----------RVAAGEPILAEQHIEGTYQVDANMFKP-QANFLLKVYGQSMKNIGILDGDLLAVHSTKDV
LEXA_KLEP7      ----------RVAAGEPLLAQQHIEGHYQVDPSMFKP-NADFLLRVSGMSMKDIGILDGDLLAVHKTQDV
LEXA_CLOBH      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILNGDLAIIEKTDSA
LEXA_CLOB1      -------------AGNPILAIENIEDVFPLPIDYVKNTKDLFMLKVSGESMIEAGILNGDLAIIEKTDSA
LEXA_CELJU      ----------RVAAGNPILAQEHIEDYCNIPNSFF-SPSADYFLRVHGMSMKDAGILDGDLLAVHRTDQV
LEXA_ALKOO      ----------KVTAGQPILATENIEDTFPLPLNFIDH-GNTFILNVKGESMIEAGILDNDYVVIRQQSTA
LEXA2_GEOSL     -------------AGVPQIATEEIEEHISIDQSLVKG--GAFFLRVKGDSMINAAIIEGDLALVRPQQTA
LEXA_HAEIG      ----------RVAAGEPILAEQHIEATYRVDADMFKP-QADFLLKVYGLSMKNVGILDGDLLAVHSTKDV
LEXA_HAEIE      ----------RVAAGEPILAEQHIEATYRVDADMFKP-QADFLLKVYGLSMKNVGILDGDLLAVHSTKDV
LEXA_HAEI8      ----------RVAAGEPILAEQHIEATYRVDADMFKP-QADFLLKVYGLSMKNVGILDGDLLAVHSTKDV
LEXA_GEOSW      --ISVPI-IGKVTAGQPITAIENIEDYFPLPKRLVSSEDHVFMLEVMGDSMIEAGILDGDYVIVRQQQSA
LEXA_ERWT9      ----------RVAAGEPLLAEQHIEGHYQVDPGLFKP-GADFLLRVSGMSMKNIGIMDGDLLAVHKTEDV
LEXA_METCA      ----------KVAAGRPLLTEAQVERYCQLGPELFEH-KGDYLLRVQGMSMRDAGIIDGDLLVVQQAQEA
LEXA_DIAST      -QLTLPL-VGRVAAGSPILAQEHVDQTYTVEGSLFAHKP-DYLLKVRGMSMRDAGIMDGDLLAVQATREA
LEXA_CLOD6      -------------AGEPILAQQNIEEYIPFPASLVKG-SNNFVLRVKGESMINAGILDEDYVVVDKKNTA
LEXA_ACISJ      -QLTLPL-VGRVAAGSPILAQEHVDQTYTVEGSLFAHKP-DYLLKVRGMSMRDAGIMDGDLLAVQATREA
LEXA_TOLAT      ----------RVAAGEPILAQQHIETHYQIDGSLF-HPRADFLLRVHGMSMKNIGILDGDLLAVHKTTQA
LEXA_HAEIN      -------------AGEPILAEQHIEATYRVDADMFKP-QADFLLKVYGLSMKNVGILDGDLLAVHSTKDV
LEXA_ACIAC      -QLMLPL-IGRVAAGSPILAEEHVDQTYSVEGSLFQHKP-DYLLKVRGMSMRDAGIMDGDLLAVQSTREA
LEXA_VEREI      ----------RVAAGSPILAQEHVEQTYSVENGLFQHKP-DYLLKVRGMSMRDAGIIDGDLLAVQATREA
LEXA_PECCC      ----------RVAAGEPLLAQEHIECRYQVDPAMFKP-SADFLLRVSGMSMKNIGIMDGDLLAVHKTEDV
LEXA_LEPIN      ----------QVAAGLPIFAEENIESYIPVPDEMAKGNVPMYALRVQGDSMIEVGINDGDIAIIEKRDIA
LEXA_LEPIC      ----------QVAAGLPIFAEENIESYIPVPDEMAKGNVPMYALRVQGDSMIEVGINDGDIAIIEKRDIA
LEXA_LEPBP      --------LGQVAAGAPILAEENIEEYIAVPDDLATK-PGTFALRVKGDSMVEAGISDGDIAIIQKKDTA
LEXA_LEPBA      --------LGQVAAGAPILAEENIEEYIAVPDDLATK-PGTFALRVKGDSMVEAGISDGDIAIIQKKDTA
LEXA_ERWCT      ----------RVAAGEPLLAQEHIECRYQVDPAMFKP-SADFLLRVSGMSMKNIGIMDGDLLAVHKTEDV
LEXA_DECAR      -------------AGSPILAVENMQGRYALDASLFAP-KADFLLKVRGLSMIDVGIFDGDLLAVHKTNQA
LEXA_BACSK      ----------KVTAGVPITAVENVEDYLPLPDHLAA-YDNTYALVIQGESMIEAGIYDGDQVIVRQQQTA
LEXA_GEOMG      -------------AGMLQPAIEDIEGYLAIDQAQLKG--GKFFLRVKGDSMVNAAILDGDLALIRPQPTA
LEXA_XYLFT      --------LGRVAAGQPIGA-DIGEDHVVLLDRVFFSPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTQDA
LEXA_XYLF2      --------LGRVAAGQPIGA-DIGEDHVVLLDRVFFSPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTQDA
LEXA_SORC5      ----------RIAAGLPILAEEHVLDTVRIERTLVRGGREVFGLRVTGDSMIEAGIFSGDYIFVRRQLTA
LEXA_MYXXD      --------LGKVAAGAPLLAQENMEDSVKIDSFLLGGVNGVFALRVKGQSMIDDGIHDGDYLFVKKTPSA
LEXA_XYLFM      --------LGRVAAGQPIGA-DIGEDRVVLLDRVFFSPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTHDA
LEXA_SYMTH      -------------AGQPILAQESIEDHFPLPADFVRDESELFFLTVQGDSMIEAGILDGDYVLVHRQQHA
LEXA_LEPBL      ----------RVAAGLPIFADENIESYIPVPDEMAKGNVPMYALRVQGDSMIEVGIDSGDIAIIEKRDIA
LEXA_LEPBJ      ----------RVAAGLPIFADENIESYIPVPDEMAKGNVPMYALRVQGDSMIEVGIDSGDIAIIEKRDIA
LEXA_LACCB      -------------AGVPITAIENIDDYFPVPDDLPYAADELFMLRVQGNSMIKIGILDGDQIIVKKQNDA
LEXA_LACC3      -------------AGVPITAIENIDDYFPVPDDLPYAADELFMLRVQGNSMIKIGILDGDQIIVKKQNDA
LEXA_XYLFA      --------LGRVAAGQPIGA-DIGEGRVVLLDRVFFSPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTQDA
LEXA_CHRSD      ---------------------------------------ADYLLRVRGLSMKDAGILDGDLLAVHRTQQI
LEXA_LEIXX      ----------RIAAGVPITAEQQVEEVFPLPRQLVGN-GELFMLKVVGESMIDAAICDGDWVVVRAQNTA
LEXA_EXIS2      ----------KVTAGFPITAIENIEEHFPLPAHYVGN-ENVFMLTIDGESMINAGILDGDRVIVRQQNTA
LEXA_CARHZ      --LSIPL-LGNVAAGYPTLAIENAEEEMQIPKSLFPE-KELFALRIKGDSMIEEGILPGDVIIVKKQEVA
LEXA1_XANCP     --------LGRVAAGVPIGADIGLDRQLWLDRSLFALRP-DYLLQVQGDSMIDDGILEGDLVGVQRSSDA
LEXA_STRM5      --------LGRVAAGLPIGADIGSDDFVVLDRVFFSPAP-DYLLKVQGDSMIDEGIFDGDLIGVHRTRDA
LEXA_CLAMS      ----------RIAAGIPITAEQMVEEVFPLPRQLVGKGDL-FMLRVVGDSMIDAAICDGDWVVVRQQKTA
LEXA_ACIF5      ----------RVAAGQPMLAEEFREGQLPVDPKLF-SPGADYLLRVQGMSMRDAGILDGDILAVDASLTL
LEXA_ACIF2      ----------RVAAGQPMLAEEFREGQLPVDPKLF-SPGADYLLRVQGMSMRDAGILDGDILAVDASLTL
LEXA_LYSSC      ----------KVTAGSPITAIENIEEYFPLPDTYGTSEDQLFMLEIMGESMIEAGILDGDLVIVKQKSTA
LEXA_GEOKA      --ISVPI-IGKVTAGQPITAVENIEGYFPLPKRLAAGEEQLFMLEVMGDSMIEAGILDGDYVIVRQQSSA
LEXA_GEOTN      --ISVPM-IGKVTAGQPITAVENIEDYFPLPKRLAAGEKQLFMLEVMGDSMIEAGILDGDYVIVRQQSSA
LEXA_CLAM3      ----------RIAAGIPITAEQMVEEVFPLPRQLVGKGDL-FMLRVVGDSMIDAAICDGDWVVVRQQKTA
LEXA_ARTCA      ----------RIAAGGPILADQVVEDVMPLPRQLVGQ-GELFMLKVAGDSMVDAAICDGDWVVVRRQADA
LEXA_STAEQ      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGESMIEAGILDGDKVIVRSQTIA
LEXA_MOOTA      --------LGKITAGQPILAFENIEDVFPLPADLA-GAENAFMLHVSGDSMIEAGILDGDYLIVRPQDTA
LEXA_DESAA      ----------RIAAGAPILAVENVMDTLDVDRAFFGSSDA-FSVRVEGDSMIEAHIEDGDYVVIKPTATP
LEXA_HAEPS      ----------KVAAGTPIEAIEHIEKHYPVNGAMFSPA-ADYLLKVNGNSMEKIGILDGDLLAVHKTKSV
LEXA_ARTS2      ----------RIAAGGPILADQVVEDVMPLPRQLVGH-GELFMLKVTGDSMIDAAICDGDWVVVRRQSDA
LEXA_STAHJ      ----------KVTAGIPITAVENIEEYFPLPEHLTSTHNSDFILNVVGESMIEAGILDGDKVIVRSQTIA
LEXA_SHEDO      VELGLPL-IGQVAAGEPILAQEHVEQYFQVDPHMFKPA-ANFLLRVRGDSMKNIGILEGDLLAVHKMQEA
LEXA_ARTAT      ----------RIAAGGPILADQTVEDVLALPRQLVGH-GELFMLKVAGDSMIDAAICDGDWVVVRRQNDA
LEXA_THEP1      -------------AGEKREAVEYLEDYIEIPESFLSSGYDHFLLKVKGESMIEEHICDGDLVLVRRQDWA
LEXA_THENN      -------------AGEKKEAIEYLEDYIEVPGSFLSSGYEHFLLRVKGESMIEEHICDGDLVLIRRQDWA
LEXA_THENE      -------------AGEKKEAIEYLEDYIEVPGSFLSSGYEHFLLRVKGESMIEEHICDGDLVLIRRQDWA
LEXA_THEM4      ----------KISAGMGIEMFEIVDEEIEIPVRMISGFGNYFALKVEGNSMIDAHIINGDYVILKKQYRI
LEXA_THEFY      --------LGRIAAGGPILAEEHVEDVLSLPRQLVGE-GTLFMLTVVGDSMIDAAIADGDLVVVRQQPDA
LEXA_STAAW      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAS      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAR      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAN      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAM      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAE      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAC      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAAB      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAA8      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAA3      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_STAA1      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_FINM2      ----------KVQAGMPILAIENVEDTFPLPIEYTSQ-GIVFILKVQGESMIEDGILNGDKIIVRKQNTA
LEXA_BREBN      ----------KVTAGQPITAIEDVEEYFPLPDNIVTS-DKVYMLRVSGNSMIDAGILDGDYVIVRQQHVA
LEXA_ANASK      ----------RVAAGMPILAQERVEDTVQVDAFLLGTNKKVYGLRVQGDSMIGDGILPGDYVFVKKQLNA
LEXA_ANADE      ----------RVAAGMPILAQERVEDTVQVDAFLLGTNKKVYGLRVQGDSMIGDGILPGDYVFVKKQLNA
LEXA_ANAD2      ----------RVAAGMPILAQERVEDTVQVDAFLLGTNKKVYGLRVQGDSMIGDGILPGDYVFVKKQLNA
LEXA_ACIC1      ----------RIAAGGPALAEQLIEDVVPLPRQLVGE-GTLFLLQVKGDSMVDAAICDGDWVVVRQQPVA
LEXA_XANCI      --------LGRVAAGLPIGADIGSDDFVVLDRVFFSPSP-DYLLKVQGDSMRDEGIFNGDLIGVHRTRDA
LEXA_XANCA      --------LGRVAAGLPIGADIGSDDFVVLDRVFFSPSP-DYLLKVQGDSMRDEGIFNGDLIGVHRTRDA
LEXA_SYNWW      --LSVPV-IGNVAAGSPILAEQNIDNYLSIPVDFLGS-GNHFILKVKGDSMIEAGILDGDYLIVREQADA
LEXA_SYNFM      -----------------------------------------FALRVKGDSMIEEGIREGDILIVARQSRA
LEXA_STACT      ----------KVTAGVPITAVENIEEYFPLPEHLTSTHNSDFILNVVGDSMIEAGILDGDKVIVRSQTIA
LEXA_LACJO      -------------AGQPILAVQDIDEYFPLPPDLENDAGELFMLRVHGESMINAGILNGDHVIVRKQSSA
LEXA_LACGA      -------------AGQPILAVQDIDEYFPLPPDLENDAGELFMLRVHGESMINAGILNGDHVIVRKQSSA
LEXA2_XANOR     --------LGRVAAGLPIGADIGSDDFVVLDRVFFSPSP-DYLLKVQGDSMRDEGIFNGDLIGVHRTRDA
LEXA2_XANCP     --------LGRVAAGLPIGADIGSDDFVVLDRVFFSPSP-DYLLKVQGDSMRDEGIFNGDLIGVHRTRDA
LEXA2_XANAC     --------LGRVAAGLPIGADIGSDDFVVLDRVFFSPSP-DYLLKVQGDSMRDEGIFNGDLIGVHRTRDA
LEXA_GEOSM      -------------AGLLHPAIQDIEGHFAIDRSQLASGGA-FFLRVKGDSMIHAHIVEGDLALVRPQPDA
LEXA_GEOBB      -------------AGLLHPAIQDIEGHFAIDRSQLASGGA-FFLRVKGDSMVHAHIVEGDLALVRPQPHA
LEXA2_PSEPK     --LEIPV-LGQVAAGAPIGPDLGIHEQLLLDPSLFRRTP-DYLLKVRGDSMIDDGIFDGDLVGILQQADA
LEXA_BACA2      ----------KVTAGIPITAVENIDEYFPLPDRMVPPGEHVFMLEIMGESMIDAGIFDKDYVIVKQQNTA
LEXA_THESQ      -------------AGEKREAIEYLEDYIEIPESFLSSGYDHFLLKVKGESMIEEHICDGDLVLVRRQDWA
LEXA_THEMA      -------------AGEKREAIEYLEDYIEIPESFLSSGYDHFLLKVKGESMIEEHICDGDLVLVRRQDWA
LEXA_MYCGI      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGESMVDAAICDGDWVVVRQQSVA
LEXA_DESRM      --ISIPL-LGEVAAGVPLLAVENYDEKVTLP-RSFTGYGEFFMLSVRGDSMIEAGILPGDLVLVRRQESV
LEXA_SHEWM      ----------QVAAGEPILAQEHVEQHYQVDPNMF-HPSADFLLRVRGDSMKDIGILEGDLLAVHKAEQA
LEXA_PELUB      --------LGSIAAGTPVEAIQNEVSRIPLPSNLEKN-GQYFGLKVQGDSMIEAGINEGDTVIIKRSDTA
LEXA_MYCVP      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGESMIDAAICDGDWVVVRQQSVA
LEXA_MYCSS      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGDSMVDAAICDGDWVVVRQQAVA
LEXA_MYCSK      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGDSMVDAAICDGDWVVVRQQAVA
LEXA_MYCSJ      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGDSMVDAAICDGDWVVVRQQAVA
LEXA_CORJK      -------------AGAPILAEQNVEAHFPLPQELVGN-GELFLLQVVGESMHDAGIFNGDWVVV-RSQSV
LEXA_ANADF      --------LGRVAAGQPILAQERVEDTVQVDSFLLGTNKKVYGLRVQGDSMIGDGILPGDYIFVKKQLHA
LEXA_THEAB      ----------KISAGQGIEMFELVDEEIEIPVRMINGYGNYFALRVEGTSMIEAHIIDGDYVILKKQYRI
LEXA_SHEPW      ----------QVAAGEPILAQEHVEQHYKVDPAMFRP-SADFLLRVRGDSMKDIGILEGDLLAVHKSQQA
LEXA_ROSDO      ----------RIAAGLPIEAINQNSASVAVPGQMLSGKGDHYALEVKGDSMIDAGINDGDVVVIRETSVA
LEXA_PELTS      --------LGRVAAGVPLLAVENREDIFPLPVHFTGS-GEFFMLTVRGDSMIEAGILNGDMVVVRRQQDA
LEXA_BACLD      ----------KVTAGTPITAVENIEEYFPLPERLAPPDEHVFMLEIMGESMIDAGILDQDYVIVKQQNTA
LEXA2_NOCFA     --------LGRIAAGGPILAEQAVEDVFPLPRELVGD-GSLFLLRVVGQSMVDAAICDGDWVVVRQQNVA
LEXA_PHOPR      ----------RVAAGEPILAQEHVETHYEVDPALFKP-RADFLLRVNGMSMKDIGIMDGDLLAVHKT---
LEXA_LACDB      -------------AGQPILAVQDVEDYFPLPPNLASDAGELFMLRVHGTSMINAGILNGDYVIVRKQTTA
LEXA_LACDA      -------------AGQPILAVQDVEDYFPLPPNLASDAGELFMLRVHGTSMINAGILNGDYVIVRKQTTA
LEXA_JANSC      -------------AGVPIEAISQVASHVAVPEQMLGAGGNHYALEVKGDSMIDAGINDGDIVVIEEGNTA
LEXA1_NOCFA     -------------AGAPILAEEHTDDLLTLPRELVGR-GTVFALRVRGDSMIDAAICDGDTVVVRSQREA
LEXA_VIBVY      ----------RVAAGEPILAQEHVEMHYQVDPSMFRP-QADFLLRVHGESMKDIGIMDGDLLAVHKTQDV
LEXA_VIBVU      ----------RVAAGEPILAQEHVEMHYQVDPSMFRP-QADFLLRVHGESMKDIGIMDGDLLAVHKTQDV
LEXA_VIBHB      ----------QVAAGEPILAQEHVESHYQVDPAMFKP-KADFLLRVNGESMKDIGIMDGDLLAVHKT---
LEXA_VIBFM      -ELGVPL-IGQVAAGEPILAQEHVESHYKVDPGMFKP-QADFLLRVNGESMKDIGIMDGDLLAVHKT---
LEXA_VIBF1      -ELGVPL-IGQVAAGEPILAQEHVESHYKVDPGMFKP-QADFLLRVNGESMKDIGIMDGDLLAVHKT---
LEXA_STAS1      ----------KVTAGIPITAVENVEEYFPLPEHFTSTHNSDFILNVVGNSMIEAGILDGDKVIVRSQTIA
LEXA_RHOCS      --VSLPLY-GRIAAGLPIEALRDTTASIDVPTGLIAS-GEHYALEVAGDSMVDAGILDGDTVIIQRCETA
LEXA_PSEA6      ----------RVAAGEPILAQEHVEMHYKVDPSLFKP-SADFLLRVSGMSMKDIGILDGDLLAVHKTTDV
LEXA_OCEIH      ----------KVTAGIPITAVENIEEFVPIPSSSAGPDDNVFVLVIDGESMIEAGILDGDMVIVKQQNTA
LEXA_BACSU      ----------KVTAGSPITAVENIEEYFPLPDRMVPPDEHVFMLEIMGDSMIDAGILDKDYVIVKQQNTA
LEXA_ALTMD      ----------RVAAGEPILAQEHVESHYKVDPALFQP-QADFLLRVNGMSMKDIGILDGDLLAVHRTTDV
LEXA_VIBPA      ----------QVAAGEPILAQEHVEAHYQVDPAMFKP-QADFLLRVNGESMKDIGIMDGDLLAVHKT---
LEXA_LACH4      -------------AGHPILAVQDIDEYFPLPPDLENDAGELFMLKIHGESMINAGILNGDNVIVKKQNTA
LEXA2_PSESM     --LEIPV-LGRVAAGAPIGPDLDIHTTLHLDRSTFTRVP-DYLLRVQGDSMIEDGILDGDLVGVHRNPQA
LEXA_VIBSL      ----------QVAAGEPILAQEHVEMHYQVDPGMFKP-QADFLLRVNGESMKDIGIMDGDLLAVHKT---
LEXA_SHEFN      ----------QVAAGEPILAQEHVEQYYQVDPNMFKPA-ADFLLRVRGDSMKNIGILEGDLLAVHKMQQA
LEXA_SHEAM      ----------QVAAGEPILAQEHVEQYYQVDPAMFRP-HADFLLRVRGDSMKDIGILDGDLLAVHKMNQA
LEXA_MYCS2      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGDSMVDAAICDGDWVVVRQQNVA
LEXA_MYCA9      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GSLFLLKVVGESMVDAAICDGDWVVVRQQNVA
LEXA_HAEDU      --LSLPL-IGKVAAGTPIMAIEHVESHYPVNGAMF-NPNADYLLKVNGNSMEKIGILDGDLLAVHKTNFA
LEXA_CAUSK      --------LGRIAAGTPIDAIQHERERLPVPESML-GAGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTA
LEXA_NOCSJ      ----------RIAAGGPILAEERVEDVFPLPRQLVGD-GQLFLLEVRGDSMIEAAICDGDYVAIRQQPTA
LEXA_LEUCK      -----------------------------------------FMLNVRGNSMINIGILDGDKVIVRKQDNA
LEXA_COREF      ----------KIAAGSPILAEQNIEEYYPLPADIVGD-GELYMLQVVGESMRDAGILDGDWVVVRSQPVA
LEXA_BIFAA      ----------RIAAGVPITAEQHVDDVMRLPERLT-GTGNLFMLEVHGDSMIDAAICDGDFVVVREQNSA
LEXA_BACP2      ----------KVTAGLPITAVENVEEYFPLPETFAAPDEQVFMLEIMGESMIDAGILDKDYVIVRQQSTA
LEXA_VIBCM      ----------RVAAGEPILAQEHVEAHYQVDPSMFRP-QADFLLRVHGESMKNIGILDGDLLAVHKTQDV
LEXA_VIBCH      ----------RVAAGEPILAQEHVEAHYQVDPSMFRP-QADFLLRVHGESMKNIGILDGDLLAVHKTQDV
LEXA_VIBC3      ----------RVAAGEPILAQEHVEAHYQVDPSMFRP-QADFLLRVHGESMKNIGILDGDLLAVHKTQDV
LEXA_GLUOX      --VSIPLY-GRIAAGLPIEAMQDDSDRIDVPVSLL-GTGEHYALTVAGDSMIEAGILDGDIAIIRRRETA
LEXA_CAUCR      --------LGRIAAGTPIDAIQHERERLPVPEAML-GAGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTA
LEXA_BIFLO      ----------RIAAGVPITAEQHVDDVMRLPERLTGS-GTLFMLEVHGDSMVDAAICDGDYVVVREQNSA
LEXA_BIFLI      ----------RIAAGVPITAEQHVDDVMRLPERLTGS-GTLFMLEVHGDSMVDAAICDGDYVVVREQNSA
LEXA_BIFLD      ----------RIAAGVPITAEQHVDDVMRLPERLTGS-GTLFMLEVHGDSMVDAAICDGDYVVVREQNSA
LEXA_ALISL      ----------QVAAGEPILAQEHVESHYQVDPSMFKP-QADFLLRVNGESMKNIGIMDGDLLAVHKT---
LEXA_ACTPJ      ----------KVAAGTPIMAIEHVESHYPVNGAMF-NPNADYLLKVNGNSMEKIGILDGDLLAVHKTNFA
LEXA_ACTP7      ----------KVAAGTPIMAIEHVESHYPVNGAMF-NPNADYLLKVNGNSMEKIGILDGDLLAVHKTNFA
LEXA_ACTP2      ----------KVAAGTPIMAIEHVESHYPVNGAMF-NPNADYLLKVNGNSMEKIGILDGDLLAVHKTNFA
LEXA_SHESH      ----------QVAAGEPILAQEHVEQHYQIDPAMFRP-SADFLLRVRGDSMKNIGILEGDLLAVHKAEQA
LEXA_LISIN      ----------KVTAGMPITAIENIEEYFPLPEYMAAGETNVFMLEIDGESMINAGILDGDKVIVRQQSSA
LEXA_GRABC      ----LPLY-GRIAAGMPIEALRDTSAYLSVPIDMLGN-GEHYALEVAGDSMIDAGIFDGDTVIIQQSDLA
LEXA_CORGL      ----------KIAAGSPITAEQNIEEYYPLPAEIVGDGDL-FMLQVVGESMRDAGILTGDWVVVRSQPVA
LEXA_CORGB      ----------KIAAGSPITAEQNIEEYYPLPAEIVGDGDL-FMLQVVGESMRDAGILTGDWVVVRSQPVA
LEXA_RHORT      --------LGKIAAGTPIAALIDPTSSIDVPASMVRG-GEHFALRIEGDSMIEAGILSGDLAVVRRCDEA
LEXA_LISW6      ----------KVTAGMPITAIENIEEYFPLPEYMAAGETNVFMLEIDGESMINAGILDGDKVIVRQQNSA
LEXA_LEUMM      -----------------------------------------FMLNVHGDSMVNIGILDGDKVIVRKQENA
LEXA_MYCUA      --------LGRIAAGGPILAEEAVEDVFPLPRELVGQ-GTLFLLKVVGESMVEAAICDGDWVVVRQQNVA
LEXA_MYCPA      --------LGRIAAGGPILAEEAVEDVFPLPRELVGD-GTLFLLKVVGDSMVEAAICDGDWVVVRQQHVA
LEXA_ENTFA      ---TIPM-LGVVTAGEPILAVEEASDFFPLPPDLRTEENALFMLTIRGESMINAGILDGDQVIVRKQSNA
LEXA_SHEON      ----------QVAAGEPILAQEHVEQYYQIDPSMF-HPTANFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_RHOCA      --LDIPM-MGRIAAGVPIEAIAEVAHHVTVPGAMLSGRGEHYALEVKGDSMIQAGINDGDIVVIRSQPTA
LEXA_MYCMM      --------LGRIAAGGPILAEEAVEDVFPLPRELVGQ-GTLFLLKVVGESMIEAAICDGDWVVVRQQNVA
LEXA_MYCA1      --------LGRIAAGGPILAEEAVEDVFPLPRELVGD-GTLFLLKVVGDSMVEAAICDGDWVVVRQQHVA
LEXA_LISMO      ----------KVTAGMPITAIENIDEYFPLPEYMAAGETNVFMLEIDGESMINAGILDGDKVIVRQESSA
LEXA_LISMH      ----------KVTAGMPITAIENIDEYFPLPEYMAAGETNVFMLEIDGESMINAGILDGDKVIVRQQSSA
LEXA_LISMF      ----------KVTAGMPITAIENIDEYFPLPEYMAAGETNVFMLEIDGESMINAGILDGDKVIVRQQSSA
LEXA_LISMC      ----------KVTAGMPITAIENIDEYFPLPEYMAAGETNVFMLEIDGESMINAGILDGDKVIVRQQSSA
LEXA_SILPO      ----------RIAAGVPIEAISQVSHQVAVPGSMVGK-GEHYALEVKGDSMIEAGINDGDVVVIRETSTA
LEXA_SHESA      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPAANFLLRVRGDSMKNIGILEGDLLAVHKVQQA
LEXA_MAGSA      --VTLPLY-GKIAAGTPIEALRDHSNSVDIPASMLGS-GNHYALTVDGDSMIEAGINDGDTVVIRSCDSA
LEXA_GLUDA      ----LPFY-GRIAAGQPIEALRETGAQIEVPMNLLGH-GEHYALEVAGDSMIEAGILDGDTVIIRRGDVA
LEXA_FRASN      ----------RIAAGGPILAEQAIEDVYPLPKEIVGE-GTLFLLKVVGQSMINAAICDGDFVVVRQQPVA
LEXA_DESDG      -------------AGHPIFAHENITGEVLVEASVVGSGKC-FALYTQGDSMIDAGINDGDLIIVRRQPIA
LEXA_AGRRK      ----------RIAAGVPISAIQNNTHDITVPADMLGS-GEHYALEVKGDSMIDAGIFDGDTVIIRNSTTA
LEXA_ACICJ      --ITLPLY-GRIAAGQPIEALREHQAEIEIPASLV-GPGEHYALEVAGDSMVDAGILDGDTAIIRRGETA
LEXA_SHESW      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPTADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHESR      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPSADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHESM      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPAADFLLRVRGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHEPC      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPTADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHEB9      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPAADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHEB8      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPAADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHEB5      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPAADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_SHEB2      ----------QVAAGEPILAQEHVEQYYQVDPSMF-HPAADFLLRVKGDSMKNIGILEGDLLAVHKVQQA
LEXA_MYCTU      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GTLFLLKVIGDSMVEAAICDGDWVVVRQQNVA
LEXA_MYCTA      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GTLFLLKVIGDSMVEAAICDGDWVVVRQQNVA
LEXA_MYCLE      --------LGRIAAGSPIFAEGTVEDIFPLPRELVGE-GTLFLLKVTGDSMVEAAICDGDWVVVRQQKVA
LEXA_MYCLB      --------LGRIAAGSPIFAEGTVEDIFPLPRELVGE-GTLFLLKVTGDSMVEAAICDGDWVVVRQQKVA
LEXA_MYCBT      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GTLFLLKVIGDSMVEAAICDGDWVVVRQQNVA
LEXA_MYCBP      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GTLFLLKVIGDSMVEAAICDGDWVVVRQQNVA
LEXA_MYCBO      --------LGRIAAGGPILAEEAVEDVFPLPRELVGE-GTLFLLKVIGDSMVEAAICDGDWVVVRQQNVA
LEXA_EXISA      ----------KVTAGTPITAIENVEEHFPLPAHIVGS-DNVYMLSVSGDSMINAGILDGDRVLVRQQSTA
LEXA_LACAC      -------------AGQPILAVEDISEYFPLPPDLESDAGELFMLKVHGNSMIKAGILNGDNVIVRKQSTA
LEXA_STRCO      ----------RIAAGGPILAEESVEDVFPLPRQLVGD-GELFVLKVVGDSMIEAAICDGDWVTVRRQPVA
LEXA_STRAW      ----------RIAAGGPILAEESVEDVFPLPRQLVGD-GELFVLKVVGDSMIEAAICDGDWVTVRRQPVA
LEXA_ROSS1      -----------AGQPLPNPAVEMIEVPVDLAPEKLQNV---YALKVRGHSMIDALIDDGDIVLMRYQETA
LEXA_OCHA4      ----------RIAAGVPISAIQNQTHSLSLPPEMI-GAGEHYALEVRGDSMIDAGIFDGDTVIIKRGDSA
LEXA_LACSS      ---------------FPLPPSLQTEQDL-------------FMLTIRGESMINAGILDGDEVIIRKQSTA
LEXA_STRCL      ----------RIAAGGPILAEESVEDVFPLPRQLVGD-GELFVLKVVGDSMIEAAICDGDWVTVRRQPVA
LEXA_PHEZH      -----------------------------------------FVLEIQGDSMINAGILDGDFVVIRRTDSA
LEXA_PARDP      ----------RIAAGVPIEAISEISHHIAVPTTMLSGQDRHYALEVRGDSMIEAGINDGDVVVIREQNAA
LEXA_MARMM      -----------------------------------------FGLEVKGDSMIEAGIMDGDTVLIRRCQSA
LEXA_FRAAA      --------LGRIAAGGPILAEQAIEDVFPLPKEIVGE-GTLFLLRVVGESMINAAICDGDWVVVRQQPVA
LEXA_BEII9      ----------RIAAGTPISALQHRSHTIGLPMDMLP-AGEHYALEVRGDSMIDAGILDADTVIIRRQDNA
LEXA_SILST      ----------RIAAGVPIEAINQAAAHVAVPNAMLSSSGQHYALEVRGDSMIDAGINDGDVVVIRETDAA
LEXA_RHOS5      ----------RIAAGLPIEAITDGAQSVTVPSMMLSGRGQHYALEVRGDSMIEAGINDGDIVVIREQQTA
LEXA_RHILW      ----------RIAAGVPISAIQNNTHDIVVPADMLGS-GEHYALEVKGDSMIDAGIFDGDTVIIRNGSTA
LEXA_RHIL3      ----------RIAAGVPISAIQNNTHDIVVPADMLGS-GEHYALEVKGDSMIDAGIFDGDTVIIRNGSTA
LEXA_RHIEC      ----------RIAAGVPISAIQNNTHDIVVPADMLGS-GEHYALEVKGDSMIDAGIFDGDTVIIRNGSTA
LEXA_RHIE6      ----------RIAAGVPISAIQNNTHDIVVPADMLGS-GEHYALEVKGDSMIDAGIFDGDTVIIRNGSTA
LEXA_LACS1      -----------------------------------------FMLSIRGESMINAGILDGDQVIVRKQSSA
LEXA_DEIRA      ----LPIY-GQIAAGIPALA-EQSPEDFTPSIEALLGLKADFLLRVRGESMTGIGVMDGDYVVV------
LEXA_BRUME      -----------------------------------------YALEVKGDSMIDAGIFDGDTIIIKRGDTA
LEXA_AGRT5      ---TIPV-MGRIAAGVPISAIQNNTHDLAVPVDMLGS-GEHYALEVKGDSMIEAGIFDGDTVIIRNGNTA
LEXA_FRASC      --------LGRIAAGGPILAEQAVEDVFPLPREIVGE-GTLFLLRVVGDSMINAAICDGDWVVVRQQPVA
LEXA_BRUSU      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUSI      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUO2      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUMB      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUC2      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUAB      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUA2      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_BRUA1      -----------------------------------------YALEVKGDSMIDAGIFDGDTVIIKRGDTA
LEXA_RHIRD      ----------RIAAGVPISAIQNNMHDISVPVEMIGS-GEHYALEIKGDSMIEAGILDGDTVIIRNGSTA
LEXA_RHIME      ----------RIAAGVPISAIQNNMHDISVPVEMIGS-GEHYALEIKGDSMIEAGILDGDTVIIRNGSTA
LEXA_NITWN      ----------RIAAGTPIEALQTCSHTISLPPDML-GAGEHYALEVRGDSMVDAGILDGDMALIQRNPTA
LEXA_METS4      -----------------------------------------YALEVRGDSMIEAGILDGDLVVIRRQDTA
LEXA_METNO      -----------------------------------------YALEVRGDSMIEAGILDGDLVVIRRQDTA
LEXA_MAGSM      -----------------------------------------FALKVKGDSMIDAEIFEGDYVVVRHQALA
LEXA_BRASO      ----------RIAAGTPIEALQTRSHTISVPADMLGNGDH-YALEVRGDSMVDAGILDGDMALIQRNETA
LEXA_BRASB      ----------RIAAGTPIEALQTRSHTISVPADMLGNGDH-YALEVRGDSMVDAGILDGDMALIQRNETA
LEXA_SINMW      ----------RIAAGVPISAIQNNMHDISVPIEMIGS-GEHYALEIKGDSMIEAGILDGDTVIIRNASTA
LEXA_RHILO      ----------RIAAGVPIDAIQHQTHSISVPPDMIMG-GEHYALEVKGDSMIDAGIFDGDTVIIRNADTA
LEXA_OENOB      -----------------------------------------FVLRVSGTSMINIGILDGDMVFVRKQDYA
LEXA_ERYLH      -----------------------------------------YALEVSGDSMIEAGIFDGDFALIRRTDSA
LEXA_AGRVS      ----------RIAAGVPISAIQNNTHDISVPMEMLGS-GEHYALEVKGDSMIEAGILDGDTVIIRNATTA
LEXA_LACRJ      -----------------------------------------FMLTIRGTSMIKAGIFNGDQVIVRKQSTA
LEXA_LACRD      -----------------------------------------FMLTIRGTSMIKAGIFNGDQVIVRKQSTA
LEXA_NITHX      -----------------------------------------YALEVRGDSMVEAGILDGDMALIQRNETA
LEXA_METRJ      -----------------------------------------YALEVRGDSMVEAGILDGDLVVIRKQDTA
LEXA_MESSB      ----------RIAAGVPIDAIQHRTHSIGVPPDMITG-GEHYALEVKGDSMIEAGIFDGDTVIIRQTQAA
LEXA_RHOS4      ----------RIAAGLPIEAINGGPQSVTVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTA
LEXA_RHOS1      ----------RIAAGLPIEAINGGPQSVTVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTA
LEXA_RHOP2      -----------------------------------------YALEVRGDSMMDAGILDGDMALIQRNESA
LEXA_OLICO      -----------------------------------------YALEVRGDSMVEAGILDGDMALIQRSENA
LEXA_LACF3      -----------------------------------------FMLTIQGTSMINIGILNGDKVIVRRQETA
LEXA_BRAJA      -----------------------------------------YALEVRGDSMVEAGILDGDMALIQRNESA
LEXA_RHOPS      -----------------------------------------YALEVRGDSMVEAGILDGDMALIQRNESA
LEXA_HYPNA      -----------------------------------------FALEVQGDSMIQAGILNGDTVILKRTNTA
LEXA_ACIBL      -------FLGRIAAGQPIEA---IENPETISLGDFTGSKEVFVLQVSGESMQDEHIVDGDYVLVERINTA


                         .         .         *         .         .         .         .:140
query           KNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIHSTY
MUCA_SALTY      SHGSIVVACIHNEFTVK-XXXXXXXXXXXXXNKDFPVYYIDPDNESVEIWGVVTH------
MUCA_ECOLX      SHGSIVVACIHNEFTVK-XXXXXXXXXXXXXNKDFPVYYIDPDNESVEIWGVVTH------
IMPA_SHIFL      QHGDIVIAEIDGEFTVKXXXXSDSPEFRTLYPENI------------CIFGVVTHVIHRT-
IMPA_SALTY      QHGDIVIAEIDGEFTVKXXXXSDSPEFRTLYPENI------------CIFGVVTHVIHRT-
IMPA_SALCH      QHGDIVIAEIDGEFTVKXXXXSDSPEFRTLYPENI------------CIFGVVTHVIHRT-
IMPA_ECOLX      QHGDIVIAEIDGEFTVKXXXXSDSPEFRTLYPENI------------CIFGVVTHVIHRT-
SAMA_SALTY      MQGDIVIAETDGEFTVKRLQLKPRIALLPI---NPAYPTLYPEELQIF--GVVTAFIHKT-
UMUD_SALTY      DHGDIVIAAIEGEFTVKRLQLRPTVQLIP--MNGAYRPIPVGSEDTLDIFGVVTFII----
LEXA_LEPCP      KNGQIVVARLGDEVTVKRWRRSKSGIDLIPENPDFDIIHVPADSPDFALEGLAVGLIRNT-
LEXA_CLONN      KNGEIVVALIDNEVTLKRFFKEDKHIRLQPENKNM-DPIILEDDS----------------
LEXA_RHOFD      KNGQIVVARLGDEVTVKRFRRTKD--LIELCPENPDYQIIVVEPGEPFIEGLAVGLIRNT-
LEXA_METPP      KNGQIVVARLGDEVTVKRFRRVRGTIELLPENPDFEPIVVTPESGEFEIEGLAVGLIRNT-
LEXA_AZOVD      HNGQIVVARLNDEVTVKRFRRDGDKVWLIAENPEFSPLEIDLTEQDLTIEGLSVGVI----
LEXA_RALSO      ANGKIVVARLGDDVTVKRFQRKGRQVELIAENPDFEPIHVDLDRDEFQLEGLAVGLI----
LEXA_BURP8      KDGQIIVARLGDDVTVKRLKRRPDGLELIAENPDYENIFVQAGSAEFALEGIAVGLI----
LEXA1_PSESM     RNGQIVVARIGDEVTVKRFKREGSKVWLLAENPDFAPIEVDLKDQELVIEGLSVGVI----
LEXA_RALPJ      TNGKIVVARLGDDVTVKRFQRKGRHVELIAENPDFEPIHVDLDRDEFHLEGLAVGLI----
LEXA_PSYIN      KNGQVVIARVEDDVTVKRFYR----------------------------------------
LEXA_PSEPU      RNGQIVVARIGDEVTVKRFKREGSKVWLLAENPEFAPIEVDLKEQELVIEGLSVGVI----
LEXA_PSEMY      RNGQIVVARLDDEVTVKRFKREGNKVWLIAENPEFAPIEVDLEQQDLVIEGLSVGVI----
LEXA_POLNA      KNGQIVVARLGDEVTVKRFHRNQ--HLIELLSENPDFKPIVVQPGEPF-------------
LEXA_COLP3      QNGQVVVARVENDVTVKRFKREGNVVYLHAENEDFSPIKVDLANQEFNIEGIAVGIIRS--
LEXA_CLOAB      QNGDIVVALIENDATIKRFFKEKD-------------------------------------
LEXA1_PSEPK     RNGQIVVARIGDEVTVKRFKREGSKVWLLAENPEFAPIEVDLKEQELVIEGLSVGVI----
LEXA_PSECL      RNGQVVVARIGDEVTVKRFKR----------------------------------------
LEXA_PRORE      HNGQVVVARIEDEVTVKRFKQQGNRVELIAENPEFEPIVVDLRQQNFTIEGLAVGVIRNS-
LEXA_HAHCH      HNGQIVVARIGDEVTVKRFQRQKNKVLLLPENEEFE-------------------------
LEXA_CLOK5      ENGDIVVALIENEATLKRFFKEENHIRLQPENKNMPPIIV---------------------
LEXA_CLOK1      ENGDIVVALIENEATLKRFFKEENHIRLQPENKNMPPIIV---------------------
LEXA_ALCBS      RSGEIVVARIDEEVTVKTLKLNKSSATLLPANEAYEPIKVPADQ-----------------
LEXA_HAES2      RNGQIVVARIEDEVTVKRFERKGSVVYLHAENEEFEPIVVDLTQQPYFIEGIAVGIIRN--
LEXA_HAES1      RNGQIVVARIEDEVTVKRFERKGSVVYLHAENEEFEPIVVDLTQQPYFIEGIAVGIIRN--
LEXA_CALS8      ENGDIVVALIDDEATVKRFFKESDHIRLQPENKAMEPIIV---------------------
LEXA_RALME      ANGKVVVARLGDDVTVKRLKKRGDTIELIAENPDFQNIVLHAGRDEFSLEGIAVGLIRSS-
LEXA_RALEU      ANGKVVVARLGDDVTVKRLKKRGDTIELIAENPDFQNIVLHAGRDEFSLEGIAVGLIRSS-
LEXA_POLSJ      RNGQIVVARIGDEVTVKRFRRTK--HLIELLPENPDFKTIVVEPGEPFLEGLAVGLIRNT-
LEXA_BURS3      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSAEFALEGIAVGLIRS--
LEXA_BURCM      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSAEFALEGIAVGLIRS--
LEXA_BURA4      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSAEFALEGIAVGLIRS--
LEXA_BURXL      KDGQIVIARLGDDVTVKRLKRRPNGLELIAENPDYENIFVETGSAEFALEGIAVGLI----
LEXA_BURVG      KDGQIIVARLGDDVTVKRLMRRPGGIELIAENPDYENIFVKAGSAEFALEGIAVGLIRS--
LEXA_BACCN      NNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_PSEAE      RNGQVVVARIGEEVTVKRFKREGSKVWLLAENPEFAPIEVDLKEQELIIEGLSVGVI----
LEXA_PSEAB      RNGQVVVARIGEEVTVKRFKREGSKVWLLAENPEFAPIEVDLKEQELIIEGLSVGVI----
LEXA_PSEA8      RNGQVVVARIGEEVTVKRFKREGSKVWLLAENPEFAPIEVDLKEQELIIEGLSVGVI----
LEXA_PROMH      HNGQVIVARIEDEVTVKRF--KKVGSKIELHAENPEFSPIIVDEQSFTVEGLAVGVIRN--
LEXA_PHOLL      RNGQIIVARIEDEVTVKRF------------------------------------------
LEXA_CLOPE      TNGDIVVALIENEATIKRFFKENGFIRLQPENKNYEPIIV---------------------
LEXA_CLOP1      TNGDIVVALIENEATIKRFFKENGFIRLQPENKNYEPIIV---------------------
LEXA_THIDA      RAGQVVVARIGDEVTVKRFQKRGHTVQLLPENADFEPIVVDLKRQELVIEGIAVGVIRS--
LEXA_CLOTH      NNGDIVVALIDDEATVKTFYKEK-GFIRLQPANKFYDPIIVRDNLSI--------------
LEXA_CLOPS      TNGDIVVALIENEATIKRFFKENGFIRLQPENKNYEPIIV---------------------
LEXA_CITK8      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVDEQSFTIEGLAVGVIRN--
LEXA_BURPP      KDGQIIIARLGDDVTVKRLKRRPNGLELIAENPDYENIFVETGSAEFALEGIAVGLI----
LEXA_BURM1      KDGQIIVARLGDDVTVKRLMRRPGGIELIAENPDYENIFVKAGSADFALEGIAVGLIRS--
LEXA_BURCJ      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSADFALEGIAVGLIRS--
LEXA_BURCH      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSADFALEGIAVGLIRS--
LEXA_BURCC      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSADFALEGIAVGLIRS--
LEXA_BURCA      KDGQIIVARLGDDVTVKRLMRRPGGLELIAENPDYENIFVKAGSADFALEGIAVGLIRS--
LEXA_BACHK      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACCZ      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACCR      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACCQ      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACC1      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACC0      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACAN      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_BACAH      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_ALHEH      RNGQIVVMRLHDEVTVK--------------------------------------------
LEXA_AERS4      RNGQVVVARLDEDVTVKRFQRKGSQVWLLPENEELEPIAVDLSCQQLTIEGLAVGVIRN--
LEXA1_GEOSL     ENRDIVVAMVDGEATLKRFYRQRDQIRLQPENPNMDPIIIRPGEGDVAIIGKV--------
LEXA_SODGM      CNGQVVVARIDDDVTVKRLKRQGNIVELLPENSEFDPIVVDLRQQELTIEGLAVGVIRN--
LEXA_RALEJ      PNGKIVVARLGDDVTVKRLQRRDGAIELIAENPDFPNIMVTPGREEFSLEGIAVGLIRSS-
LEXA_PSEA7      RNGQVVVARLGEEVTVKRFKREGSKVWLLAENPEFAPIEVDLKEQELIIEGLSVGVI----
LEXA_ENTS8      RNGQVVVARIDDEVTVKRL--KKQGNTVELLPENSEFKPIVVDEHNFSIEGLAVGVIRN--
LEXA_CLOTE      LNGEIVVALLGDRATVKRFFKEKDYIRLQPENETMEPIIV---------------------
LEXA_BORPE      RNGQIVVARLGDEVTVKRLQR-QNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRT--
LEXA_BORBR      RNGQIVVARLGDEVTVKRLQR-QNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRT--
LEXA_MANSM      RNGQVIVARIEDEVTVKRLERKGDVVYLHAENEEFKPIVVLKEQPNFEIEGIAVGIIRN--
LEXA_BORPA      RNGQIVVARLGDEVTVKRLQR----------------------------------------
LEXA_YERPY      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPS      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPP      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPN      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPG      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPE      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPB      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERPA      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERP3      RNGQVVVARIDDEVTVKRL--KKQGNIVHLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_YERE8      RNGQVVVARIDDEVTVKRL--KKQGNIVQLLPENSEFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_TERTT      RNGDIVVARIDNEVTVKRFKRERN-------------------------------------
LEXA_SHISS      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_SHIFL      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_SHIF8      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_SHIDS      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_SHIBS      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_SHIB3      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_RALEH      ANGKIVVARLGDDVTVKRLQR-RGGHIELIAENPDFTNIIVEPGEEFSLEGIAVGLIRSS-
LEXA_MARAV      HNGQIVVARVGEEVTVKRFRREGNKVWLIAENEEFAPIEVDLAEQELFIEGLGVGVI----
LEXA_JANMA      KNGQIVVARLGEEVTVKRYKKS---------------------------------------
LEXA_HALHL      RDGQIVVVRLHDEVTVKFLER----------------------------------------
LEXA_ESCF3      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOUT      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOSM      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOSE      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOLU      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOLI      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOLC      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOL6      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOL5      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOK1      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOHS      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECODH      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECOBW      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO8A      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO81      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO7I      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO5E      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO57      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO55      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO45      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO27      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_ECO24      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFKPIVVD------------------
LEXA_BURTA      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURPS      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURP6      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURP1      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURP0      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURMS      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURMA      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURM9      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BURM7      KDGQIIVARLGDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLI----
LEXA_BACWK      YNGEIVVALTEDEATVKRFYKEKDHFRLQPENSSLEPIIL---------------------
LEXA_EDWI9      RNGQVVVARIEDEVTVKRL--KKQGNMVQLLPENCDFQPIVVDEQSFTIEGLAVGVIRN--
LEXA_CLOCE      NNGDIVVALIGDEATCKTFYREKDHIRLQPQNSSME-PIVVKDELSI--------------
LEXA_BORA1      RNGQIIVARLGDDVTVKRLQR--HGSRIELLPENPESPILVAPDDEFALEGVAVGLIRT--
LEXA_SERP5      RNGQVVVARIEDEVTVKRL--KKHGNVVELLPENSEFQPIVVD------------------
LEXA_SALTY      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALTI      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALSV      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALPK      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALPC      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALPB      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALPA      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALNS      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALHS      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALG2      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALEP      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALDC      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALCH      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALAR      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SALA4      RNGQVVVARIDDEVTVKRL--KKQGNKVELLPENSEFTPIVVDEQSFTIEGLAVGVIRN--
LEXA_SACD2      KNGDIVVARIEDEVTVKRFKRERNNATIQLLPENPDFNII---------------------
LEXA_GEOUR      DNGDIVVARINDEATLKRFFREKDRIRLQPENSAMEPIIVKAKAGEVNIIGKVTGIFRS--
LEXA_DESHY      RNGEIVVAMIDEEATVKRFYKEK--------------------------------------
LEXA_DESHD      RNGEIVVAMIDEEATVKRFYKEK--------------------------------------
LEXA_VARPS      RNGQIVVARLGDEVTVKRLKRNK--QVIELHAENPDYPTIVVQPGEPFIEGLAVGLIRNT-
LEXA_SHELP      RNGQIVVARVEDDVTVKRFEKRGSTVYLHAENEEYSPIVVDLTTQSLSIEGLAVGVIRN--
LEXA_MARMS      RNGQIVVARIGDEVTVKRFEQKGSIVRLIPENEEFND-IIVDLESEEF-------------
LEXA_CUPTR      ANGKIVVARLGDDVTVKRLQR-RGGHIELIAENPDFTNIIVEPGEEFSLEGIAVGLIRSS-
LEXA_AERHH      RNGQVVVARLDEDVTVKRFQR----------------------------------------
LEXA_IDILO      RNGQIVVARVEDEVTVKRF------------------------------------------
LEXA_ENT38      RNGQVVVARIDDEVTVKRL--KKQGNTVQLLPENSEFSPIVVDEQTFSIEGLAVGVIRN--
LEXA_CLOBM      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_CLOBL      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_CLOBK      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_CLOBJ      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_CLOB6      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_BORPD      RNGQIVVARLGDEVTVKRLQR----------------------------------------
LEXA_AZOSB      RNGQVVVARIDDDVTVKTLRRN---------------------------------------
UMUD_SHIFL      SHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNS--AYSPITISSEDTLDVFGVVIHVV----
UMUD_ECOLI      SHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNS--AYSPITISSEDTLDVFGVVIHVV----
UMUD_ECO57      SHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNS--AYSPITISSEDTLDVFGVVIHVV----
LEXA_SHEHH      RNGQIVVARVEDDVTVKRFEKKGNKVFL---------------------------------
LEXA_DELAS      RNGQIVVARLGDEVTVKRLRRTTQG------------------------------------
LEXA_BACHD      DNGDIIVATEEDEATVKRFFREKD-------------------------------------
LEXA_ACTSZ      RNGQVIVARIEDEVTVKRLERKGDVIYLHAENEEFAPIVVNLREQERFIEGIAVGIIRN--
LEXA_PECCP      RNGQIVVARIDDEVTVKRL--KKQGNMVHLLAENEEFAPIVVDQQSFSIEGLAVGVIRNS-
LEXA_KLEP3      RNGQVVVARIDDEVTVKRL--KKQGNVVELLPENSEFTPIVVD------------------
LEXA_HERAR      KNGQIVVARLGDDVTVKRYKKT---------------------------------------
LEXA_ALKMQ      RNGDIVVALIDDSATVKRFYREKDHIRLQPSNTSVDDVTILGKVTGVF-------------
LEXA_AZOSE      RAGQVVVARLEDEVTVKTFTR----------------------------------------
LEXA_SHEPA      RNGQIVVARVEDDVTVKRFEKKGNKVFL---------------------------------
LEXA_PASMU      RNGQIVVARIEDEVTVKRLERK--GSVIYLHAENEEFAPIVVD------------------
LEXA_KLEP7      RNGQVVVARIDEEVTVKRL--KKQGNVVELLPENSEFSPIVVD------------------
LEXA_CLOBH      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_CLOB1      NNGDIVVALIDNEATLKRFF--KESSYIRLQPENKSMKPIILENCKV--------------
LEXA_CELJU      RNGQIVVARIGEEVTVKRFKRQGNQAQVELWPENPDFKVIHVDDQEFSIEGLSVGVI----
LEXA_ALKOO      SNGDIVVALIDDEATVKRFFKESD-HIRLQPENSLMDPILLKD------------------
LEXA2_GEOSL     ENRDIVVAMIDGEATLKRFYQGADHIRLQPENPNMAPIIVRSGVQEAWIIGKV--------
LEXA_HAEIG      RNGQIVVARIEDEVTVKRL--EKKGSIIYLHAENEEDPIVVNLEEQ---------------
LEXA_HAEIE      RNGQIVVARIEDEVTVKRL--EKKGSIIYLHAENEEDPIVVNLEEQ---------------
LEXA_HAEI8      RNGQIVVARIEDEVTVKRL--EKKGSIIYLHAENEEDPIVVNLEEQ---------------
LEXA_GEOSW      DNGDIVVAMTEDEATVKRFFKEKDHIRLQPENSNLEPIIV---------------------
LEXA_ERWT9      RNGQVVVARIDDEVTVKRL--KKNGNMVELLPENPDFQPIVVDQQTLTIEGLAVGVIRN--
LEXA_METCA      RSGQIVVVRLHDEVTVK--------------------------------------------
LEXA_DIAST      RNGQIIVARLGDDVTVKRLRRT--GSAIELLPENPDYPVIRVEPGEPFIEGLAVGLIRNT-
LEXA_CLOD6      LNSQIVVALINGEATVKRFF--KEGNLIRLQPENDFMEPIMLNDSEVEIVGIVTGV-----
LEXA_ACISJ      RNGQIIVARLGDDVTVKRLRRT--GSAIELLPENPDYPVIRVEPGEPFIEGLAVGLIRNT-
LEXA_TOLAT      NNGQVVVARVDDEVTVKRFERKGHIVQLLPENEELQPIVVDLTQENLSIEGLAVGVIRN--
LEXA_HAEIN      RNGQIVVARIEDEVTVKRL--EKKGSIIYLHAENEEDPIVVNLEEQ---------------
LEXA_ACIAC      RNGQIIVARLGDEVTVKRLRRT---------------------------------------
LEXA_VEREI      RNGQIIVARLGDDVTVKRLRRTASTIELL--PENPDYPVIVVQPGEPFIEGLAVGLIRNT-
LEXA_PECCC      RNGQIVVARIDDEVTVKRLKKQGNTVHLLAENEEFAPIVVDLRQQSFSIEGLAVGVIRNS-
LEXA_LEPIN      RNGEIVVALIEDEATLKVYYKEQD-------------------------------------
LEXA_LEPIC      RNGEIVVALIEDEATLKVYYKEQD-------------------------------------
LEXA_LEPBP      RNGEIVVALIENEATLKVFFKEPD-------------------------------------
LEXA_LEPBA      RNGEIVVALIENEATLKVFFKEPD-------------------------------------
LEXA_ERWCT      RNGQIVVARIDDEVTVKRLKKQGNTVHLLAENEEFAPIVVDLRQQSFSIEGLAVGVIRNS-
LEXA_DECAR      RDGQIVVARLDEEVTVKRLERSGGQIRLIAENPDFEPIIVDPEAVDFAIEGIAVGLI----
LEXA_BACSK      DNGDIIVAMTEDEATVKRFFREKDYIRLQPENSSMEPIIL---------------------
LEXA_GEOMG      ENNDIVVAMVDGEATLKAFYRERGQIRLQPRNPNMEPIIIREGEGEVAIVGKVVGIFRT--
LEXA_XYLFT      HSGQIVVARIDDEITVKLLKISKD-------------------------------------
LEXA_XYLF2      HSGQIVVARIDDEITVKLLKISKD-------------------------------------
LEXA_SORC5      QRGDIVVALIGDEATVKYFFPEKD-------------------------------------
LEXA_MYXXD      QPGEIVVALIEDEATVKRYYPEGD-------------------------------------
LEXA_XYLFM      HSGQIVVARIDDEITVKLLKISKD-------------------------------------
LEXA_SYMTH      NNGDIVVALIEDEATVKRFFKEQD-HIRLQPENRFMDPIIVPD------------------
LEXA_LEPBL      RNGEIVVALIEDEATLKVYYKEQD-------------------------------------
LEXA_LEPBJ      RNGEIVVALIEDEATLKVYYKEQD-------------------------------------
LEXA_LACCB      ENGQIVVATEEDEATVKRFYKEKNGIRLHPENDSMDDMFF----PDVTILGIV--------
LEXA_LACC3      ENGQIVVATEEDEATVKRFYKEKNGIRLHPENDSMDDMFF----PDVTILGIV--------
LEXA_XYLFA      HSGQIVVARIDDEITVKLLKISKD-------------------------------------
LEXA_CHRSD      RDGQIVVARLDDEVTVKRFKR----------------------------------------
LEXA_LEIXX      ENGDIVAAMLDEEATVKVF-RQRDGHWLLPRNSNFEP--ILGDFSQI--------------
LEXA_EXIS2      ENGEIVVAMTEDEATVKRF------------------------------------------
LEXA_CARHZ      ENGDIVVAYLEGEVTVKKFWKSVNGVIKLIPANSKYEPIIINRETKI--------------
LEXA1_XANCP     RNGQIVVARVDGEITIKRLERSAD-------------------------------------
LEXA_STRM5      HSGQIVVARIDDEITVKLLKIAKD-------------------------------------
LEXA_CLAMS      ENGDIVAAMLDDEATVKVF-RQRDGHTWLL-ARNSAFEPILGDFAEVV--GKVVAVMRS--
LEXA_ACIF5      QDGQMVVARVNGEVTVKRWKR----------------------------------------
LEXA_ACIF2      QDGQMVVARVNGEVTVKRWKR----------------------------------------
LEXA_LYSSC      NNGDIVVATAEDEATVKRFFKEKNHFRLQPENSSMEDQVSIGGQ-----------------
LEXA_GEOKA      NNGDIVVAMTEDEATVKRFFKEKDHIRLQPENAHLEPIIV---------------------
LEXA_GEOTN      NNGDIVVAMTEEEATVKRFFKEKDHIRLQPENVHLEPIIV---------------------
LEXA_CLAM3      ENGDIVAAMLDDEATVKVF-RQRDGHTWLL-PRNSAFEPILGDFAEVV--GKVVAVMRS--
LEXA_ARTCA      ANGDIVAALLDDEATVKTF-RQRDGHTWLL-PQNTQYEPILGDHAT--IMGKVVSVLRS--
LEXA_STAEQ      ENGDIIVAMTEDEATVKRFYKEKNRYRLQPENSTMEDNVIV--------------------
LEXA_MOOTA      ENGDIVVALLEDEATVKYFYRYPDHIELVPANSSMQPLIV---------------------
LEXA_DESAA      RNGDIVAALVNDEVTLKYFHR--DGSRIELRPANVRYK-----------------------
LEXA_HAEPS      RNGQXXXXXXXXXXXXKRLEKKGDLIYLHPENDELEPIVVDPRQSYIEIEGIAVGVIRS--
LEXA_ARTS2      VNGDIVAALLDDEATVKTF-RQRDGHTWLL-PQNTQYEPILGDHAN--IMGKVVSVFRS--
LEXA_STAHJ      ENGDIIVAMTEDEATVKRFYKEK--------------------------------------
LEXA_SHEDO      KN-----------------------------------------------------------
LEXA_ARTAT      INGDIVAALLDDEATVKTF-RQRDGHTWLL-PQNTQYEPILGDQAT--IMGKVVSVLRS--
LEXA_THEP1      QNGDIVVAMVDGEVTLKKFYQRGD-------------------------------------
LEXA_THENN      QNGDIVAAMVEGEVTLKKFFQRGEMVELRPANKEMSPMFFRADRVKI--------------
LEXA_THENE      QNGDIVAAMVEGEVTLKKFFQRGEMVELRPANKEMSPMFFRADRVKI--------------
LEXA_THEM4      PNGQIAAVVFDNKVTLKRFYHKKDKVELVPENKDMNP--IVCDAKDIKVIGKLVGII----
LEXA_THEFY      NNGDIVAALLGDEATVKVFKRDREHVWL---------------------------------
LEXA_STAAW      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAS      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAR      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAN      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAM      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAE      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAC      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAAB      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAA8      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAA3      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_STAA1      ENGDIIVATEEDEATVKRFYKEKNRYRLQPENSTME-------------------------
LEXA_FINM2      NNGDIVVALMDESATVKRFYRHSD-------------------------------------
LEXA_BREBN      NNGDIVVATEEDEATVKRFFKEKN-------------------------------------
LEXA_ANASK      DDGEIVVAMIDDEATVK--------------------------------------------
LEXA_ANADE      DDGEIVVAMIDDEATVK--------------------------------------------
LEXA_ANAD2      DDGEIVVAMIDDEATVK--------------------------------------------
LEXA_ACIC1      ENGDIVAAMIDGEATVKTFKRR--GAHIWLMPHNPQYEPIPGDEATI--------------
LEXA_XANCI      RSGQIVVARIDEEITVKLLKIGKD-------------------------------------
LEXA_XANCA      RSGQIVVARIDEEITVKLLKIGKD-------------------------------------
LEXA_SYNWW      SNGEIVVALLDNEATVKRFYRRDD-------------------------------------
LEXA_SYNFM      ENGQTVVALVQGEATVKKF------------------------------------------
LEXA_STACT      ENGDIIVAMTEDEATVKRFYKEK--------------------------------------
LEXA_LACJO      NNGEIVVAMTEDEATVKRFFK-EDGYYRLQPENDTMDPIIL--------------------
LEXA_LACGA      NNGEIVVAMTEDEATVKRFFK-EDGYYRLQPENDTMDPIIL--------------------
LEXA2_XANOR     RSGQIVVARIDEEITVKLLKIGKD-------------------------------------
LEXA2_XANCP     RSGQIVVARIDEEITVKLLKIGKD-------------------------------------
LEXA2_XANAC     RSGQIVVARIDEEITVKLLKIGKD-------------------------------------
LEXA_GEOSM      SNRDIVVAMVEGEATLKRFYREADRIRLQPENPNYEPIIIQKGEQEVSIVGKV--------
LEXA_GEOBB      SNRDIVVAMVDGEATLKRFYREADRIRLQPENPNYEPIIIEKGEQEVSIVGKV--------
LEXA2_PSEPK     RDGQIVVARLDGEVTIKRLQR-QGGTYRLLPRNPAYAPIDVQPEQDFFIEGV---------
LEXA_BACA2      NNGEIVVAMTEDEATVKRFYK----------------------------------------
LEXA_THESQ      QNGDIVAAMVDGEVTLKKFYQRGD-------------------------------------
LEXA_THEMA      QNGDIVAAMVDGEVTLKKFYQRGD-------------------------------------
LEXA_MYCGI      DNGDIVAAMIDGEATVKTFKRTK--------------------------------------
LEXA_DESRM      SNGDIAVALLEDEATVKRFYKEKN-------------------------------------
LEXA_SHEWM      RNGQXXXXXXXXXXXXKRFEKKGSTVYLHAENEDYSPIVVDLTNQSLSIEGLAVGVIRN--
LEXA_PELUB      DNGKIVVALIDEEAMLKRIRRKGKTVALESANRNYETKIFGPDRVKV--------------
LEXA_MYCVP      DNGDIVAAMIDGEATVKTFKRTK--------------------------------------
LEXA_MYCSS      DNGDIVAAMIDGEATVKTFKRSR--------------------------------------
LEXA_MYCSK      DNGDIVAAMIDGEATVKTFKRSR--------------------------------------
LEXA_MYCSJ      DNGDIVAAMIDGEATVKTFKRSR--------------------------------------
LEXA_CORJK      AEFGDFVAAMIDEATVKEFQKDADGLWL---------------------------------
LEXA_ANADF      EDGDIVVAMIDEEATVK--------------------------------------------
LEXA_THEAB      PNGQIAAVVFDNKVTLKRFYHKNDKVELVPENSSMSP--IICDAKDVKVIGKLVGVI----
LEXA_SHEPW      RN-----------------------------------------------------------
LEXA_ROSDO      DNGDIVVALIEDEATLKRYMRKGSSIALEAANPAYETRVFTEDKVKV--------------
LEXA_PELTS      GNGDIVVALLEEEATVKRLFK-ENGRIRLQPENRLMEPIY---AAEVQILGKVIGLVRKIY
LEXA_BACLD      NNGDIVVAMTEDEATVKRFFKEE--------------------------------------
LEXA2_NOCFA     ENGDIVAAMIDGEATVKTFKRT---------------------------------------
LEXA_PHOPR      -------------------------------------------------------------
LEXA_LACDB      QNGEIVVAMTDDEATVKRFFK-EDLHYRLQPENDAMDPIIL--------------------
LEXA_LACDA      QNGEIVVAMTDDEATVKRFFK-EDLHYRLQPENDAMDPIIL--------------------
LEXA_JANSC      DNGDIVVALVEDHEATLKRLRRKGGMILEAANPAYETRVFRDDQVKV--------------
LEXA1_NOCFA     NSGDIVAAMIGEEATVKVF-RRRNGHVLLE-PRNPAYDVIDGDEAVI--------------
LEXA_VIBVY      RN-----------------------------------------------------------
LEXA_VIBVU      RN-----------------------------------------------------------
LEXA_VIBHB      -------------------------------------------------------------
LEXA_VIBFM      -------------------------------------------------------------
LEXA_VIBF1      -------------------------------------------------------------
LEXA_STAS1      ENGDIIVAMTEEEATVKRFFKEK--------------------------------------
LEXA_RHOCS      ENGTVIVALVDDNEVTLKRLRRK--------------------------------------
LEXA_PSEA6      HN-----------------------------------------------------------
LEXA_OCEIH      VNGEIVVAMTEEEATVKRFFKEEN-------------------------------------
LEXA_BACSU      NNGEIVVAMTEDEATVKRFYK----------------------------------------
LEXA_ALTMD      HN-----------------------------------------------------------
LEXA_VIBPA      -------------------------------------------------------------
LEXA_LACH4      NNGEIVVAMTENEATVKRFYKEKD-------------------------------------
LEXA2_PSESM     SDGQIVVARLEGEVTIKRLQHRGDQLHLLPRNPAYQPIIVTPDQ-----------------
LEXA_VIBSL      -------------------------------------------------------------
LEXA_SHEFN      RN-----------------------------------------------------------
LEXA_SHEAM      RN-----------------------------------------------------------
LEXA_MYCS2      DNGDIVAAMIDGEATVKTFKRAR--------------------------------------
LEXA_MYCA9      DNGDIVAAMIDGEATVKTFKRT---------------------------------------
LEXA_HAEDU      RN-----------------------------------------------------------
LEXA_CAUSK      NSGEIVVALVGEEATLKR-LRKKGGSILEAANPKYETRIFGPDQVEV--------------
LEXA_NOCSJ      ENGEIVAAMIDGEATVKTFQR-KDGNVWLLPHNPAYDPI---DGTHATILGKVTAVL----
LEXA_LEUCK      DNGDVVVANDDDEATVKRFFREAD-------------------------------------
LEXA_COREF      EQGEFVAAMIEGEATVKEFHKDASGIWL---------------------------------
LEXA_BIFAA      ENGDIVAALLDDEATVKTF------------------------------------------
LEXA_BACP2      NNGDIVVATEEDEATVKRFYK----------------------------------------
LEXA_VIBCM      RN-----------------------------------------------------------
LEXA_VIBCH      RN-----------------------------------------------------------
LEXA_VIBC3      RN-----------------------------------------------------------
LEXA_GLUOX      ENGQIIVALIDEQEVTLKKLRRRGSMILEAANRDYETRI----------------------
LEXA_CAUCR      TSGEIVVALVGEEATLKR-LRKKGGSILEAANPKYETRIFGPDQVEV--------------
LEXA_BIFLO      VNGDIVAALLDDEATVKTF-RKENG------------------------------------
LEXA_BIFLI      VNGDIVAALLDDEATVKTF-RKENG------------------------------------
LEXA_BIFLD      VNGDIVAALLDDEATVKTF-RKENG------------------------------------
LEXA_ALISL      -------------------------------------------------------------
LEXA_ACTPJ      RN-----------------------------------------------------------
LEXA_ACTP7      RN-----------------------------------------------------------
LEXA_ACTP2      RN-----------------------------------------------------------
LEXA_SHESH      RN-----------------------------------------------------------
LEXA_LISIN      INGEIVVAMTENEATCKRFYK----------------------------------------
LEXA_GRABC      ENGQIVVALIDDEVTLKRLRRRGKSVALEPANERHETRIFPADRVRV--------------
LEXA_CORGL      EQGEFVAAMIDGEATVKEFHKDSSGIWL---------------------------------
LEXA_CORGB      EQGEFVAAMIDGEATVKEFHKDSSGIWL---------------------------------
LEXA_RHORT      ENGTVIVALVDNEEATLKRLRRK--------------------------------------
LEXA_LISW6      INGEIVVAMTENEATCKRFYK----------------------------------------
LEXA_LEUMM      DNGDVVVANDNNEATVKRFFREAD-------------------------------------
LEXA_MYCUA      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCPA      DNADIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_ENTFA      NNGDIVIAMTEDEATCKRFFREVD-------------------------------------
LEXA_SHEON      RN-----------------------------------------------------------
LEXA_RHOCA      ENGDIVVALVEDEATLKRYYRRGGMIALEAANPAYETRLLREDQVKV--------------
LEXA_MYCMM      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCA1      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_LISMO      INGEIVVAMTENEATCKRFYK----------------------------------------
LEXA_LISMH      INGEIVVAMTENEATCKRFYK----------------------------------------
LEXA_LISMF      INGEIVVAMTENEATCKRFYK----------------------------------------
LEXA_LISMC      INGEIVVAMTENEATCKRFYK----------------------------------------
LEXA_SILPO      DNGDIVVALVDDEATLKRFFRRGASIALEAANPAYETRVLPSDRVRV--------------
LEXA_SHESA      RN-----------------------------------------------------------
LEXA_MAGSA      ETGTIVVALVDDEVTLKRLRRKGTSVALEPANKAYETRVLPPDRVKV--------------
LEXA_GLUDA      QNGQIVVALIDDEVTLKRLRRRGSTIALEPANARYEPRIVPSDRVRI--------------
LEXA_FRASN      DNGEIVAAMIDGEATVKRF-RQRDGR-----------------------------------
LEXA_DESDG      EDGDIVIALLDDEATVK--------------------------------------------
LEXA_AGRRK      NPGDIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_ACICJ      ETGQIVVALIDDEVTLKRLRRRGNSTALEPANPRYEIRIFPAERVKV--------------
LEXA_SHESW      RN-----------------------------------------------------------
LEXA_SHESR      RN-----------------------------------------------------------
LEXA_SHESM      RN-----------------------------------------------------------
LEXA_SHEPC      RN-----------------------------------------------------------
LEXA_SHEB9      RN-----------------------------------------------------------
LEXA_SHEB8      RN-----------------------------------------------------------
LEXA_SHEB5      RN-----------------------------------------------------------
LEXA_SHEB2      RN-----------------------------------------------------------
LEXA_MYCTU      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCTA      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCLE      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCLB      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCBT      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCBP      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_MYCBO      DNGDIVAAMIDGEATVKTFKRA---------------------------------------
LEXA_EXISA      DNGEIVVAMTEEEATVK--------------------------------------------
LEXA_LACAC      NNGEIVVAMTENEATVKRFFKEDD-------------------------------------
LEXA_STRCO      ENGDIVAAMLDGEATVKRFKREDGHVWLLPHNSAYEP--IPGDDATI--------------
LEXA_STRAW      ENGDIVAAMLDGEATVKRFKREDGHVWLL--PHNSAYQPIPGDEATI--------------
LEXA_ROSS1      DNGQMVAVRIEDDVTLKRFYREGDKVRLQPANVTMEP--IYVDAARVHIQGRVVGVLRSMW
LEXA_OCHA4      NPGEIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVRV--------------
LEXA_LACSS      DNGDIVIATAEDEATCKRFFKEADHYRLQPENDTFEPIIL----NEVSILGKV--------
LEXA_STRCL      ENGDIVAAMLDGEATVKRFKRENGHVWLL--PHNAAYQPIPGDDATI--------------
LEXA_PHEZH      NSGDIVVALVDGEEATLKRLRKKGASIALEAANPAYETRIFGPD-----------------
LEXA_PARDP      ESGDIVVALVDGEATLKRYRRKGNMIALEAANPAYETRVL--PEDKVRIQGRLVGLIRS--
LEXA_MARMM      ETGDIVVALIDDEEATLKRLRKKGGSVLEAANPEYETRIFPPDRVKV--------------
LEXA_FRAAA      DNGEIVAAMIDGEATVKR-LRVRDGK-----------------------------------
LEXA_BEII9      ENGDIVVALIDDEEATLKRLRRRGASIALEPANSAYETRIFGPD-----------------
LEXA_SILST      DNGDIVVALVEHEATLKRFER----------------------------------------
LEXA_RHOS5      DNGDIVVALVADEATLKRFRR----------------------------------------
LEXA_RHILW      SPGDIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_RHIL3      SPGDIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_RHIEC      SPGDIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_RHIE6      SPGDIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_LACS1      NNGEIVIAMTEEEATCKRFFK-EDGYYRLQPENDTMDPIIL--------------------
LEXA_DEIRA      -------------------------------------------------------------
LEXA_BRUME      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_AGRT5      NPGDIVVALVDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKI--------------
LEXA_FRASC      DNGEIVAAMIDGEATVKR-LRVRDGK-----------------------------------
LEXA_BRUSU      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUSI      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUO2      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUMB      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUC2      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUAB      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUA2      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_BRUA1      NPGEIVVALVEEEATLKRFRREGASIALEAANPAYETRIFGPDRVHV--------------
LEXA_RHIRD      SPGDIVVALIDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKI--------------
LEXA_RHIME      SPGDIVVALIDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKI--------------
LEXA_NITWN      DTGDIVVALIDDE------------------------------------------------
LEXA_METS4      NTGDIVVALIDDEEATLKRLRRRGSSIALEAANPAYETRVLGPD-----------------
LEXA_METNO      NTGDIVVALIDDEEATLKRLRRRGSSIALEAANPAYETRVLGPD-----------------
LEXA_MAGSM      ENGDIVVAILDGEATVKRLYISEETIELRPENRSYQ-PIVVPPGGDIRILGKVLAV-----
LEXA_BRASO      DTGDIVVALIDDE------------------------------------------------
LEXA_BRASB      DTGDIVVALIDDE------------------------------------------------
LEXA_SINMW      SIGDIVVALIDDEATLKRFRRKGASIALEAANPAYETRIFGPDRVKI--------------
LEXA_RHILO      SPGEIVVALVEEEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_OENOB      DNGDIVVANGEGEATVKRFFKESN-------------------------------------
LEXA_ERYLH      RDGEIVVALVNNEEATLKYLHRDSGR-----------------------------------
LEXA_AGRVS      NPGDIVVALVDDEATLKRFRRRGASIALEAANPAYETRIFGPDRVKI--------------
LEXA_LACRJ      KNGDIVIANDDNEATCKRFYKEK--------------------------------------
LEXA_LACRD      KNGDIVIANDDNEATCKRFYKEK--------------------------------------
LEXA_NITHX      ETGDIVVALIDDE------------------------------------------------
LEXA_METRJ      NTGDIIVALIDDEEATLKRLRRRGSSIALEAANPAYETRVLGPD-----------------
LEXA_MESSB      NPGDIVVALVEEEATLKRFRRKGASIALEAANPAYETRIFGPDRVKV--------------
LEXA_RHOS4      DNGDIVVALVADEATLKRYRR----------------------------------------
LEXA_RHOS1      DNGDIVVALVADEATLKRYRR----------------------------------------
LEXA_RHOP2      DTGDIVVALIEEEATLKRFRR----------------------------------------
LEXA_OLICO      DTGDIVVALIEEEATLKRFRR----------------------------------------
LEXA_LACF3      NNGDIVIAMTSDEATCKRFFKEQ--------------------------------------
LEXA_BRAJA      DTGDIVVALIDDE------------------------------------------------
LEXA_RHOPS      ETGDIVVALIEEEATLKRFRR----------------------------------------
LEXA_HYPNA      QTGDIVVALIDEEATLKRLRRKGASVALEAANPAFETRIFGPDRVEV--------------
LEXA_ACIBL      RDGEIVVALVEN-------------------------------------------------