[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21514.1

[Show Plain Result]


## Summary of Sequence Search
    1::440
    6::362     7e-20  25%  391 aa  YFKF_BACSU RecName: Full=Uncharacterized MFS-type transporter yfkF;
   44::357     1e-17  20%  382 aa  YCAD_ESCF3 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::382     4e-15  21%  382 aa  Y2680_YERPY RecName: Full=Uncharacterized MFS-type transporter
   36::382     4e-15  21%  382 aa  Y2592_YERP3 RecName: Full=Uncharacterized MFS-type transporter
   36::382     4e-15  21%  382 aa  Y2315_YERPP RecName: Full=Uncharacterized MFS-type transporter
   35::264     4e-15  21%  382 aa  Y2171_CITK8 RecName: Full=Uncharacterized MFS-type transporter
   36::382     4e-15  21%  382 aa  Y1506_YERPB RecName: Full=Uncharacterized MFS-type transporter
   36::382     4e-15  21%  382 aa  Y1405_YERPS RecName: Full=Uncharacterized MFS-type transporter
   36::382     4e-15  21%  382 aa  Y1380_YERPE RecName: Full=Uncharacterized MFS-type transporter
   35::264     9e-15  23%  382 aa  YCAD_SHISS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECOUT RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECOSE RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECOL6 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECOL5 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECOK1 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECO8A RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECO81 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECO45 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     9e-15  23%  382 aa  YCAD_ECO24 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  21%  382 aa  YCAD_SHIFL RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  21%  382 aa  YCAD_SHIF8 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_SHIDS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECOSM RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECOLI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECOLC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECOHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECODH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECOBW RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECO7I RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECO5E RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECO57 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECO55 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     1e-14  23%  382 aa  YCAD_ECO27 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALAR RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALTY RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALTI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALSV RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALPK RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALPC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALPA RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALNS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALCH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     2e-14  21%  382 aa  YCAD_SALA4 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     3e-14  23%  382 aa  YCAD_SALPB RecName: Full=Uncharacterized MFS-type transporter ycaD;
   35::264     3e-14  23%  382 aa  YCAD_ECOLU RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     6e-14  21%  382 aa  YCAD_SALEP RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     8e-14  24%  382 aa  YCAD_SALG2 RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::264     8e-14  24%  382 aa  YCAD_SALDC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::382     8e-14  20%  382 aa  Y1530_YERE8 RecName: Full=Uncharacterized MFS-type transporter
   44::264     2e-11  22%  382 aa  Y1421_ENT38 RecName: Full=Uncharacterized MFS-type transporter
   12::180     4e-07  33%  445 aa  MFS11_XENLA RecName: Full=UNC93-like protein MFSD11;
   28::79      5e-05  33%  386 aa  Y1560_METJA RecName: Full=Uncharacterized MFS-type transporter
  152::280     5e-05  27%  727 aa  SV2C_RAT RecName: Full=Synaptic vesicle glycoprotein 2C;       
  342::491     9e-05  26%  603 aa  KUP_METAC RecName: Full=Probable potassium transport system protein
   24::185     1e-04  30%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
  152::280     1e-04  26%  727 aa  SV2C_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2C;       
   11::175     1e-04  24%  410 aa  YQJV_BACSU RecName: Full=Uncharacterized MFS-type transporter yqjV;
  152::280     1e-04  26%  727 aa  SV2C_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2C;
   67::152     6e-04  29%  443 aa  YAAU_ECOLI RecName: Full=Putative metabolite transport protein
   43::81      0.001  44%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
    1::440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxSWALFLGIGFLMMAYGFQGSLLGVRAVQEQFSLTATGFMMSGYFVGYFIGAMTISNLISKVGH
YFKF_BACSU      -----------FFILVLLVSISGFQGMLLPVISIIFETSAAINGLHATGLYIGVLLASPFMEAPLRKLGF
YCAD_ESCF3      -------------------------------------------GMVSSSYFTGNLVGTLLTGYLIKRLGF
Y2680_YERPY     -----------------------------------QQLPTWQVGMVSSSYFTGNLVGTLIAGRFIQQLGF
Y2592_YERP3     -----------------------------------QQLPTWQVGMVSSSYFTGNLVGTLIAGRFIQQLGF
Y2315_YERPP     -----------------------------------QQLPTWQVGMVSSSYFTGNLVGTLIAGRFIQQLGF
Y2171_CITK8     ----------------------------------QESLATWQVGMVSSSYFTGNLVGTLLTGYLIKRLGF
Y1506_YERPB     -----------------------------------QQLPTWQVGMVSSSYFTGNLVGTLIAGRFIQQLGF
Y1405_YERPS     -----------------------------------QQLPTWQVGMVSSSYFTGNLVGTLIAGRFIQQLGF
Y1380_YERPE     -----------------------------------QQLPTWQVGMVSSSYFTGNLVGTLIAGRFIQQLGF
YCAD_SHISS      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOUT      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOSE      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOL6      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOL5      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOK1      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO8A      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO81      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO45      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO24      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_SHIFL      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_SHIF8      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_SHIDS      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOSM      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOLI      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOLC      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOHS      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECODH      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECOBW      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO7I      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO5E      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO57      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO55      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_ECO27      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_SALAR      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALTY      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALTI      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALSV      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALPK      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALPC      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALPA      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALNS      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALHS      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALCH      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALA4      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALPB      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGH
YCAD_ECOLU      ----------------------------------QEHMSTWQVGVVSSSYFTGNLVGTLLTGYVIKRIGF
YCAD_SALEP      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALG2      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
YCAD_SALDC      -------------------------------------------GMVSSSYFTGNLVGTLFTGYLIKRIGF
Y1530_YERE8     -----------------------------------QQLPTWQVGMVSSSYFSGNLVGTLIAGRIIQQLGF
Y1421_ENT38     -------------------------------------------GMVSSSYFXXXXXXXXXXXXXIKRFGF
MFS11_XENLA     ----------VILGVGFMFMFTAFQTS--GNVAQTVISSLNSTSFHGSGYSLAIIYSVFSASNLIAP---
Y1560_METJA     ----------------------------------------------------------------------
SV2C_RAT        --------WALFFVLGMALMADGVEVFVVGFVLPSAETDLSGSGWLGSIVYLGMMVGAFFWGGLADKVGR
KUP_METAC       -------NWLLLISVLFMIFEFRDSHRLAAAYGLAVTGTMSITGLMMTLIF--YLKG-------------
YFIU_BACSU      ----------------------------------------------------------------------
SV2C_MOUSE      --------WALFFVLGMALMADGVEVFVVGFVLPSAETDLSGSGWLGSIVYLGMMVGAFFWGGLADKVGR
YQJV_BACSU      -------SWTIIIGTIFGRMATSMSIPFLAIYLTAVQIAASSSVGILASFYGGYISDKFGRKNLVSIFGW
SV2C_HUMAN      --------WALFFVLGMALMADGVEVFVVGFVLPSAETDLSGSGWLGSIVYLGMMVGAFFWGGLADKVGR
YAAU_ECOLI      ------------------------------------------------------FVGTSLFGYISDKVGR
Y466_BUCAI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IRVFAAFASLASLVILVHSIFINPYVWFILRVLTGISMVCIYTVAESWLNDRSSNKNRGSILSIYMVILY
YFKF_BACSU      KPLIVMGGSIVILSLFGFIWLQSVWVWFLLRLFIGIGDHMLHFSTQTWVTSMSSKQNRGRNLSIYGLSFG
YCAD_ESCF3      NRSYYLASLVFAAGCLGLGLMIGFWSWMAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMIYY
Y2680_YERPY     NRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMVYY
Y2592_YERP3     NRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMVYY
Y2315_YERPP     NRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMVYY
Y2171_CITK8     NRSYYIASLIFAAGCVGLGMMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
Y1506_YERPB     NRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMVYY
Y1405_YERPS     NRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMVYY
Y1380_YERPE     NRSYHCSCILFALATCGLMLTVDFWSWLGWRFLAGIACALIWVIVESALLRSGTLTNRGQLLAAYMMVYY
YCAD_SHISS      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOUT      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOSE      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOL6      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOL5      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOK1      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO8A      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO81      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO45      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGIGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO24      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_SHIFL      NRSYYLSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_SHIF8      NRSYYLSSFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_SHIDS      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOSM      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOLI      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOLC      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOHS      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECODH      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECOBW      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO7I      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO5E      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO57      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO55      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_ECO27      NRSYASFIFAAGCAGL--GLMIGFWSWLAWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_SALAR      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALTY      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALTI      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALSV      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALPK      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALPC      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALPA      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALNS      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALHS      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALCH      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALA4      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_SALPB      SYYLASLIFAAGCVGL--GVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMVYY
YCAD_ECOLU      NRSYASFIFAAGCAGL--GLMIGFWSWLTWRFVAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
YCAD_SALEP      NRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMAYY
YCAD_SALG2      NRSYY----LASLIFAAGCVGLGGMVWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMAYY
YCAD_SALDC      NRSYY----LASLIFAAGCVGLGGMVWMSWRFIAGIGCAMIWVVVESALMCSGTSHNRGRLLAAYMMAYY
Y1530_YERE8     NRSYHYSCILFALATCGLMLSVDFWSWLGWRFFAGVACALIWVIVESALLRSGTVTNRGQLLAAYMMVYY
Y1421_ENT38     NRSYYLASLIFAAGCVGLGLMVGFWSWMTWRFIAGVGCAMIWVVVESALMCSGTSRNRGRLLAAYMMVYY
MFS11_XENLA     -SVIAVLGCQMSMFLLLYSMFIQPYTWYTLSVLIGIAAAVLWTAQGCCLTINSDERTIGRHSGIFWALLQ
Y1560_METJA     ----------------------------------------------------------------------
SV2C_RAT        KQSLLICMSVNGFFAFLSS-FVQGYGFFLLRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLS-------
KUP_METAC       -RMFRSFVSLFVTVIDVVFLLSNTYYWSIVIAAIAFSLIIIYTSGQKKLYELMNPMKIGDFLEKYKQVYA
YFIU_BACSU      ----------------------------------------------------------------------
SV2C_MOUSE      KQSLLICMSVNGFFAFLSS-FVQGYGFFLVRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLS-------
YQJV_BACSU      MLVFAGFAAASNL-----------WVFFVVNALNGLCKSLFEPASKALLSDMTEEKTRLLVFNLYAAINI
SV2C_HUMAN      KQSLLICMSVNGFFAFLSS-FVQGYGFFLFRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLS-------
YAAU_ECOLI      RKMFL-IDIIAIGVISVATMFVSPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWY
Y466_BUCAI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSMGIGMFLLNFSRPENYQPFILVSIITSLAXXXXXXXXXXXXXXXXXQGMPLKELYETSPFGMVSALFY
YFKF_BACSU      LGFAAGPFMVPLVKLSPSLPFIVISLFAWLFVFFLQNAYPETSPHETKSDNSFRRFYQAMLFGWVATFGY
YCAD_ESCF3      VGTFLGQLLVSKVSTENVLPWVTALILAGILPLLFTRILSQQTESRKTTSITSMLKLRQARLGVNGCIIS
Y2680_YERPY     LGTVIGQLLLGIVSTQSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRRSARLGINGCIIS
Y2592_YERP3     LGTVIGQLLLGIVSTQSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRRSARLGINGCIIS
Y2315_YERPP     LGTVIGQLLLGIVSTQSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRRSARLGINGCIIS
Y2171_CITK8     VGTFLGQLLVSKVPTESVLPWVTGMILAGILPLLFTRILNQQSEEHDTTPITSMLRLRQARLGVNGCIIS
Y1506_YERPB     LGTVIGQLLLGIVSTQSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRRSARLGINGCIIS
Y1405_YERPS     LGTVIGQLLLGIVSTQSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRRSARLGINGCIIS
Y1380_YERPE     LGTVIGQLLLGIVSTQSVIPWVGALVITAMLPLLFAQFSHQSRHESPPIAVWPMLKRRSARLGINGCIIS
YCAD_SHISS      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKLRQARLGVNGCIIS
YCAD_ECOUT      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOSE      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKLRQARLGVNGCIIS
YCAD_ECOL6      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOL5      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQTENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOK1      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO8A      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKLRQARLGVNGCIIS
YCAD_ECO81      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO45      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTHVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO24      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKLRQARLGVNGCIIS
YCAD_SHIFL      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKLRQARLGVNGCIIS
YCAD_SHIF8      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITAMLKLRQARLGVNGCIIS
YCAD_SHIDS      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOSM      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOLI      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOLC      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOHS      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECODH      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECOBW      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO7I      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDATSITSMLKLRQARLGVNGCIIS
YCAD_ECO5E      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO57      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO55      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_ECO27      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_SALAR      VGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTEARYSTSISAMLKLRQARLGVNGCIIS
YCAD_SALTY      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALTI      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALSV      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALPK      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQTRHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALPC      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQTRHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALPA      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQTRHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALNS      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALHS      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQTRHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALCH      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQTRHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALA4      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQTRHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALPB      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_ECOLU      VGTFLGQLLVSKVSTESVLPWVTGLTLAGILPLLFTRVLNQQAENHDSTSITSMLKLRQARLGVNGCIIS
YCAD_SALEP      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALG2      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
YCAD_SALDC      MGTFLGQLLVSKVSGEHVLPWVTGMILAGILPLLFTRIVNQQTQARHSSSISAMLKLRQARLGVNGCIIS
Y1530_YERE8     XXXXXXXXXXXXXXXQSVIPWVSALVITAMLPLLFAHFSHQDSGDVPHIAVWPMLKRRSARLGINGCIIS
Y1421_ENT38     VGTVLGQLMI------SKLPTDLMSVLPWVTGMVLAAILPLLFTRIVNQGSEHHEATQVWPLGVNGCIIS
MFS11_XENLA     FSMLFGNLYINISDTDRRTVFIALTVIS------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
SV2C_RAT        ----------------------------------------------------------------------
KUP_METAC       SENKISGTALFFARDINYVPRYISNVM-------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------MAALDN
SV2C_MOUSE      ----------------------------------------------------------------------
YQJV_BACSU      GVVFGPVLGLYFGSSQSTTPFLVPAVIYGL----------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GTIQSALFTLLAVYAASMNFTIFQISLVTFLLAISGAISQYPIGKLSDKYDRRKVIIISTFGXXXXXXXX
YFKF_BACSU      GFLETALNGSFPVYALRLGISVDAVAIILPAFAIGSIIFQFPLGILSDKYGRRNVLLVLCFFIAGVFPSP
YCAD_ESCF3      GIVLGSLYGLMPLYLNHQGISNSNIGFWMAVLVSAGIVGQWPIGRLADKFGRLLVLRVQIF---------
Y2680_YERPY     GVXXXXXXXXXXXXXXHKGMSDASVGGRMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVF---------
Y2592_YERP3     GVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVF---------
Y2315_YERPP     GVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVF---------
Y2171_CITK8     GIVLGSLYGLMPLYLNHQGISNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
Y1506_YERPB     GVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVF---------
Y1405_YERPS     GVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVF---------
Y1380_YERPE     GVXXXXXXXXXXXXXXHKGMSDASVGGWMALLVSSGIIGQWPMGRMADRYGRLLVLRIQVF---------
YCAD_SHISS      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOUT      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOSE      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOL6      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOL5      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOK1      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO8A      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO81      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO45      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO24      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_SHIFL      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_SHIF8      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_SHIDS      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOSM      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOLI      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOLC      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOHS      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECODH      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECOBW      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO7I      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO5E      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO57      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO55      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_ECO27      GIVLGSLYGLMPLYLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_SALAR      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPVGRLADKFGR------------------
YCAD_SALTY      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALTI      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALSV      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALPK      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALPC      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALPA      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALNS      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALHS      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALCH      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALA4      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALPB      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_ECOLU      GIVLGSLYGLMPLFLNHKGVSNASIGFWMAVLVSAGILGQWPIGRLADKFGR------------------
YCAD_SALEP      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALG2      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
YCAD_SALDC      GIVLGSLYGLMPLYLKHQGMANASIGFWMAVLVSAGILGQWPMGRLADKFGR------------------
Y1530_YERE8     GVXXXXXXXXXXXXXXHQGMSDASVGWWMALLVSSGIIGQWPIGKMADRYGRLLVLRIQVF---------
Y1421_ENT38     GIVLGSLYGLMPLYLNHQGVSDSGIGFWMAVMVSAGIVGQWPIGKLADRYGR------------------
MFS11_XENLA     ----------------------------------------------------------------------
Y1560_METJA     ---------IMAIYAQTLGATNLEIGLIFGSFALARTVAQIPVGVLSDIYGKKFFIVCGTF---------
SV2C_RAT        ----------------------------------------------------------------------
KUP_METAC       ----------------------------------------------------------------------
YFIU_BACSU      GIISAALTTINESFSVSPSWGSWGITLYTLGLSVSVPI----VGKLSDRYGRKKLFLIEV----------
SV2C_MOUSE      ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------FLIGLSMGIYGISQVIFQIPFGILSDKFNRKKIILLGLF---------


                         .         *         .         .         .         .         +:350
query           XXXXGQMYLPGELATSKVWXXXXXXXXXXXXXPMFSLICAHTNDYIPKEKFVAAGAGIQFTFGLGAMSGP
YFKF_BACSU      YVIGGCFFIAGMAVGS-----------------TFTLGISYMTDLLPPHLLPAGNLLCGITFSLGSILGP
YCAD_ESCF3      ------VVILGSIALTHTAMAPALFILGAAGFTLYPVAMAWSCEKVSQDQLVAMNQALLLSYTIGSLLGP
Y2680_YERPY     VVILGSVAILGNYAMAPA-----LFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTLGSLAGP
Y2592_YERP3     VVILGSVAILGNYAMAPA-----LFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTLGSLAGP
Y2315_YERPP     VVILGSVAILGNYAMAPA-----LFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTLGSLAGP
Y2171_CITK8     ----------------------------------------------------------------------
Y1506_YERPB     VVILGSVAILGNYAMAPA-----LFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTLGSLAGP
Y1405_YERPS     VVILGSVAILGNYAMAPA-----LFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTLGSLAGP
Y1380_YERPE     VVILGSVAILGNYAMAPA-----LFILGCAGFTLYPVAMAWACEKASADELVAMNQALLMSYTLGSLAGP
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
Y1530_YERE8     VVILGSIAILGNYALAPA-----LFILGCAGFTLYPVAMAWACEKVSADKLVAMNQALLMSYTIGSLTGP
Y1421_ENT38     ----------------------------------------------------------------------
MFS11_XENLA     ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
SV2C_RAT        ----------------------------------------------------------------------
KUP_METAC       ----------------------------------------------------------------------
YFIU_BACSU      -CLFGLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHILATLPKEKQGKALGLLGAMNGMAAVLGP
SV2C_MOUSE      ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLCSIFMNIVGSNGFFVFLLFFHALIGVFGIYRMRVRETVENPDSQFVAMxxxxxxxxxxxxxxxxxxxx
YFKF_BACSU      VAGGWYMQTFESANLFYFI---------------------------------------------------
YCAD_ESCF3      SFTAMLMQHYSDNLLFIMI---------------------------------------------------
Y2680_YERPY     TMTSLLMQRYSDN------LLFIMIAGVAFVYLMMLLRKPDHQQTPYAAV--------------------
Y2592_YERP3     TMTSLLMQRYSDN------LLFIMIAGVAFVYLMMLLRKPDHQQTPYAAV--------------------
Y2315_YERPP     TMTSLLMQRYSDN------LLFIMIAGVAFVYLMMLLRKPDHQQTPYAAV--------------------
Y2171_CITK8     ----------------------------------------------------------------------
Y1506_YERPB     TMTSLLMQRYSDN------LLFIMIAGVAFVYLMMLLRKPDHQQTPYAAV--------------------
Y1405_YERPS     TMTSLLMQRYSDN------LLFIMIAGVAFVYLMMLLRKPDHQQTPYAAV--------------------
Y1380_YERPE     TMTSLLMQRYSDN------LLFIMIAGVAFVYLMMLLRKPDHQQTPYAAV--------------------
YCAD_SHISS      ----------------------------------------------------------------------
YCAD_ECOUT      ----------------------------------------------------------------------
YCAD_ECOSE      ----------------------------------------------------------------------
YCAD_ECOL6      ----------------------------------------------------------------------
YCAD_ECOL5      ----------------------------------------------------------------------
YCAD_ECOK1      ----------------------------------------------------------------------
YCAD_ECO8A      ----------------------------------------------------------------------
YCAD_ECO81      ----------------------------------------------------------------------
YCAD_ECO45      ----------------------------------------------------------------------
YCAD_ECO24      ----------------------------------------------------------------------
YCAD_SHIFL      ----------------------------------------------------------------------
YCAD_SHIF8      ----------------------------------------------------------------------
YCAD_SHIDS      ----------------------------------------------------------------------
YCAD_ECOSM      ----------------------------------------------------------------------
YCAD_ECOLI      ----------------------------------------------------------------------
YCAD_ECOLC      ----------------------------------------------------------------------
YCAD_ECOHS      ----------------------------------------------------------------------
YCAD_ECODH      ----------------------------------------------------------------------
YCAD_ECOBW      ----------------------------------------------------------------------
YCAD_ECO7I      ----------------------------------------------------------------------
YCAD_ECO5E      ----------------------------------------------------------------------
YCAD_ECO57      ----------------------------------------------------------------------
YCAD_ECO55      ----------------------------------------------------------------------
YCAD_ECO27      ----------------------------------------------------------------------
YCAD_SALAR      ----------------------------------------------------------------------
YCAD_SALTY      ----------------------------------------------------------------------
YCAD_SALTI      ----------------------------------------------------------------------
YCAD_SALSV      ----------------------------------------------------------------------
YCAD_SALPK      ----------------------------------------------------------------------
YCAD_SALPC      ----------------------------------------------------------------------
YCAD_SALPA      ----------------------------------------------------------------------
YCAD_SALNS      ----------------------------------------------------------------------
YCAD_SALHS      ----------------------------------------------------------------------
YCAD_SALCH      ----------------------------------------------------------------------
YCAD_SALA4      ----------------------------------------------------------------------
YCAD_SALPB      ----------------------------------------------------------------------
YCAD_ECOLU      ----------------------------------------------------------------------
YCAD_SALEP      ----------------------------------------------------------------------
YCAD_SALG2      ----------------------------------------------------------------------
YCAD_SALDC      ----------------------------------------------------------------------
Y1530_YERE8     TMTSLLMQRYSDN------LLFIMIAGVALVYLMMLLRKPDQQKTPFAAV--------------------
Y1421_ENT38     ----------------------------------------------------------------------
MFS11_XENLA     ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
SV2C_RAT        ----------------------------------------------------------------------
KUP_METAC       ----------------------------------------------------------------------
YFIU_BACSU      NIGSFLLDWTGSHWLFLINLPIAVLLVVFG----------------------------------------
SV2C_MOUSE      ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
YAAU_ECOLI      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxx
YFKF_BACSU      --------------------
YCAD_ESCF3      --------------------
Y2680_YERPY     --------------------
Y2592_YERP3     --------------------
Y2315_YERPP     --------------------
Y2171_CITK8     --------------------
Y1506_YERPB     --------------------
Y1405_YERPS     --------------------
Y1380_YERPE     --------------------
YCAD_SHISS      --------------------
YCAD_ECOUT      --------------------
YCAD_ECOSE      --------------------
YCAD_ECOL6      --------------------
YCAD_ECOL5      --------------------
YCAD_ECOK1      --------------------
YCAD_ECO8A      --------------------
YCAD_ECO81      --------------------
YCAD_ECO45      --------------------
YCAD_ECO24      --------------------
YCAD_SHIFL      --------------------
YCAD_SHIF8      --------------------
YCAD_SHIDS      --------------------
YCAD_ECOSM      --------------------
YCAD_ECOLI      --------------------
YCAD_ECOLC      --------------------
YCAD_ECOHS      --------------------
YCAD_ECODH      --------------------
YCAD_ECOBW      --------------------
YCAD_ECO7I      --------------------
YCAD_ECO5E      --------------------
YCAD_ECO57      --------------------
YCAD_ECO55      --------------------
YCAD_ECO27      --------------------
YCAD_SALAR      --------------------
YCAD_SALTY      --------------------
YCAD_SALTI      --------------------
YCAD_SALSV      --------------------
YCAD_SALPK      --------------------
YCAD_SALPC      --------------------
YCAD_SALPA      --------------------
YCAD_SALNS      --------------------
YCAD_SALHS      --------------------
YCAD_SALCH      --------------------
YCAD_SALA4      --------------------
YCAD_SALPB      --------------------
YCAD_ECOLU      --------------------
YCAD_SALEP      --------------------
YCAD_SALG2      --------------------
YCAD_SALDC      --------------------
Y1530_YERE8     --------------------
Y1421_ENT38     --------------------
MFS11_XENLA     --------------------
Y1560_METJA     --------------------
SV2C_RAT        --------------------
KUP_METAC       --------------------
YFIU_BACSU      --------------------
SV2C_MOUSE      --------------------
YQJV_BACSU      --------------------
SV2C_HUMAN      --------------------
YAAU_ECOLI      --------------------
Y466_BUCAI      --------------------