[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21520.1

[Show Plain Result]


## Summary of Sequence Search
    1::794
  983::1110    3e-04  29% 1521 aa  DISP1_MOUSE RecName: Full=Protein dispatched homolog 1;AltName:
  242::320     3e-04  35%  885 aa  YDGH_BACSU RecName: Full=Putative membrane protein ydgH;
  133::260     5e-04  31%  301 aa  COXX_LISIN RecName: Full=Protoheme IX farnesyltransferase;       
  166::259     6e-04  36%  530 aa  Y1893_SULSO RecName: Full=Putative ABC transporter ATP-binding
  262::403     6e-04  28%  544 aa  NFL_XENLA RecName: Full=Neurofilament light polypeptide;       
  133::260     8e-04  29%  301 aa  COXX_LISMH RecName: Full=Protoheme IX farnesyltransferase;       
  133::260     8e-04  29%  301 aa  COXX_LISMF RecName: Full=Protoheme IX farnesyltransferase;       
  133::260     8e-04  29%  301 aa  COXX_LISMC RecName: Full=Protoheme IX farnesyltransferase;       
    1::794

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxLSLKYKIQSLDWVHSVITLLDIPLLNNSEAPLQERLESFKTLKDEGVDTERGF
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     -----------------------------------ILDEPTSNIDPQGTREILELVKTFRSEGISVEHKI
NFL_XENLA       -----------------LAAKNMQSAEEWFKSRFTVLTQSAARNTDAAKDEMSESRRMLSAKGLEIERGV
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NEILNSPVFRNFVISEDGKTSGIIVYIKKDELKDIENKSAQEIEEYKDTLKKKNHENITQIREVIKTYGD
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ERVL--PFIDRIIVVESGK---IAVDIKKDEIADLLHSLGLEIPDYMLFLKKSGFRRI------------
NFL_XENLA       NEALQRQI-QELEDKQSGEIAGMQDAINKEELRNTKSEMARYLKEYQDLLNVKMDIEIAAYRKLLE--GE
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VGKIYLGGIPMITxxxxxxxxxxIIVFGLGVLLFIIATLWFIFRKLIWIIVPISSCFFSVLIMTGLLGLL
DISP1_MOUSE     -----------------------LIAMGLSVAVVMLLTTWNIIISL-YAIVSIAGTIF---VTVGSLVLL
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------IGVFLYVVVYSLYAKRKLVSNTVIGS---FSGAVPP----LI
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ETRLSFSGVGAIT---------------------------------------------------------
COXX_LISMH      ----------------------------IGVFLYVVVYSLYAKRKLVSNTVIGS---FSGAVPP----LI
COXX_LISMF      ----------------------------IGVFLYVVVYSLYAKRKLVSNTVIGS---FSGAVPP----LI
COXX_LISMC      ----------------------------IGVFLYVVVYSLYAKRKLVSNTVIGS---FSGAVPP----LI


                         .         *         .         .         .         .         +:350
query           GWKVTVISSNFIALMLILTMAMNIHMSTRFLQLREDFPNLDNLKIIIMTTSKMFWPIIYTVLTTICAFLS
DISP1_MOUSE     GWELNVLESVTISVAVGLSVDFAVHYGVAYRLA----PDPDREGKVIFSLSRMGSAIAMAALTTFVAGAM
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      GWFAVEPSFSIVPIMLFLVMFQPPHFYAIAIKRKEEYPMLPVVKGIERTKKSMFWVILLTVLPFFMFDLG
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      GWFAVEPSFSIVPIMLFLVMFQPPHFYAIAIKRKEEYPMLPVVKGIERTKKSMFWVILLTILPFFMFELG
COXX_LISMF      GWFAVEPSFSIVPIMLFLVMFQPPHFYAIAIKRKEEYPMLPVVKGIERTKKSMFWVILLTILPFFMFELG
COXX_LISMC      GWFAVEPSFSIVPIMLFLVMFQPPHFYAIAIKRKEEYPMLPVVKGIERTKKSMFWVILLTILPFFMFELG


                         .         .         .         .         *         .         .:420
query           LVFSGIKPIIDFGWMMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DISP1_MOUSE     MMPSTVLAYTQLGTFM------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      LVYVILATLLNIGWL-------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      IVYVVLATLLNIGWL-------------------------------------------------------
COXX_LISMF      IVYVVLATLLNIGWL-------------------------------------------------------
COXX_LISMC      IVYVVLATLLNIGWL-------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ----------------------------------------------------------------------
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxDNSIHYIYRFKEEFLKIKDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIYFGVFTGLA
DISP1_MOUSE     ----------------------------------------------------------------------
YDGH_BACSU      ---DYCILLLTRFREELANGHDKKEAALIAYRTGGKTLFISGFAVLIGFSALGFAKFIFQSAVGVAVGVG
COXX_LISIN      ----------------------------------------------------------------------
Y1893_SULSO     ----------------------------------------------------------------------
NFL_XENLA       ----------------------------------------------------------------------
COXX_LISMH      ----------------------------------------------------------------------
COXX_LISMF      ----------------------------------------------------------------------
COXX_LISMC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           MLLAMISVLTLLPxxxxxxxxxxx
DISP1_MOUSE     ------------------------
YDGH_BACSU      IL--MIILYTLLP-----------
COXX_LISIN      ------------------------
Y1893_SULSO     ------------------------
NFL_XENLA       ------------------------
COXX_LISMH      ------------------------
COXX_LISMF      ------------------------
COXX_LISMC      ------------------------