[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21535.1

[Show Plain Result]


## Summary of Sequence Search
    1::485
   95::498     e-113  57%  500 aa  AMPA_EHRRG RecName: Full=Probable cytosol aminopeptidase;       
   95::498     e-113  57%  500 aa  AMPA_EHRRW RecName: Full=Probable cytosol aminopeptidase;       
  128::494     e-112  59%  495 aa  AMPA_MESSB RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-112  59%  498 aa  AMPA_XANP2 RecName: Full=Probable cytosol aminopeptidase;       
  131::496     e-110  58%  499 aa  AMPA_BRASB RecName: Full=Probable cytosol aminopeptidase;       
   98::491     e-110  53%  493 aa  AMPA_PHYAS RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-110  58%  499 aa  AMPA_BRAJA RecName: Full=Probable cytosol aminopeptidase;       
  125::496     e-109  56%  497 aa  AMPA_RHISN RecName: Full=Probable cytosol aminopeptidase;       
  129::497     e-109  57%  498 aa  AMPA_OCHA4 RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-109  56%  500 aa  AMPA_RHOPT RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-109  56%  500 aa  AMPA_RHOPA RecName: Full=Probable cytosol aminopeptidase;       
  125::496     e-109  56%  497 aa  AMPA_RHIME RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-109  56%  500 aa  AMPA_NITWN RecName: Full=Probable cytosol aminopeptidase;       
  125::495     e-108  56%  496 aa  AMPA_RHILW RecName: Full=Probable cytosol aminopeptidase;       
   93::495     e-108  53%  497 aa  AMPA_RHIEC RecName: Full=Probable cytosol aminopeptidase;       
   93::495     e-107  53%  496 aa  AMPA_RHIL3 RecName: Full=Probable cytosol aminopeptidase;       
  125::496     e-107  57%  497 aa  AMPA_SINMW RecName: Full=Probable cytosol aminopeptidase;       
  172::497     e-107  61%  500 aa  AMPA_OLICO RecName: Full=Probable cytosol aminopeptidase;       
  126::496     e-107  56%  497 aa  AMPA_AGRT5 RecName: Full=Probable cytosol aminopeptidase;       
   93::495     e-106  52%  496 aa  AMPA_RHIE6 RecName: Full=Probable cytosol aminopeptidase;       
  137::497     e-106  58%  499 aa  AMPA_RHOPB RecName: Full=Probable cytosol aminopeptidase;       
  153::497     e-106  58%  500 aa  AMPA_WOLPM RecName: Full=Probable cytosol aminopeptidase;       
  137::496     e-105  57%  498 aa  AMPA_RHOP5 RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-105  55%  500 aa  AMPA_RHOP2 RecName: Full=Probable cytosol aminopeptidase;       
  180::497     e-105  60%  500 aa  AMPA_RHOPS RecName: Full=Probable cytosol aminopeptidase;       
  180::497     e-104  60%  498 aa  AMPA_AGRRK RecName: Full=Probable cytosol aminopeptidase;       
  185::502     e-104  59%  503 aa  AMPA_RHILO RecName: Full=Probable cytosol aminopeptidase;       
  131::497     e-102  54%  500 aa  AMPA_NITHX RecName: Full=Probable cytosol aminopeptidase;       
   91::501     e-102  51%  502 aa  AMPA_RICBR RecName: Full=Probable cytosol aminopeptidase;       
   91::501     e-101  50%  502 aa  AMPA_RICB8 RecName: Full=Probable cytosol aminopeptidase;       
  170::492     e-101  60%  493 aa  AMPA_CAUCR RecName: Full=Probable cytosol aminopeptidase;       
  100::496     e-100  52%  498 aa  AMPA_PHYMT RecName: Full=Probable cytosol aminopeptidase;       
  125::484     4e-99  54%  490 aa  AMPA_GLUOX RecName: Full=Probable cytosol aminopeptidase;       
   91::497     2e-97  52%  500 aa  AMPA_RICCK RecName: Full=Probable cytosol aminopeptidase;       
  117::484     1e-96  52%  485 aa  AMPA_BRUME RecName: Full=Probable cytosol aminopeptidase;       
  175::496     1e-96  56%  497 aa  AMPA_AGRVS RecName: Full=Probable cytosol aminopeptidase;       
  129::496     2e-96  52%  497 aa  AMPA_BRUO2 RecName: Full=Probable cytosol aminopeptidase;       
  129::496     4e-96  51%  497 aa  AMPA_BRUSU RecName: Full=Probable cytosol aminopeptidase;       
  123::498     1e-95  51%  500 aa  AMPA_RICFE RecName: Full=Probable cytosol aminopeptidase;       
  123::498     4e-94  50%  500 aa  AMPA_RICM5 RecName: Full=Probable cytosol aminopeptidase;       
  125::498     2e-93  51%  500 aa  AMPA_RICPR RecName: Full=Cytosol aminopeptidase;       
  123::498     3e-93  50%  500 aa  AMPA_RICPU RecName: Full=Probable cytosol aminopeptidase;       
  123::498     9e-93  50%  500 aa  AMPA_RICCN RecName: Full=Probable cytosol aminopeptidase;       
  123::498     9e-93  50%  500 aa  AMPA_RICAE RecName: Full=Probable cytosol aminopeptidase;       
  123::498     2e-92  49%  500 aa  AMPA_RICRS RecName: Full=Probable cytosol aminopeptidase;       
  123::498     2e-92  49%  500 aa  AMPA_RICRO RecName: Full=Probable cytosol aminopeptidase;       
  125::496     3e-91  49%  497 aa  AMPA_METPB RecName: Full=Probable cytosol aminopeptidase;       
  126::487     2e-90  50%  488 aa  AMPA_DINSH RecName: Full=Probable cytosol aminopeptidase;       
  125::496     1e-89  48%  497 aa  AMPA_METEP RecName: Full=Probable cytosol aminopeptidase;       
  126::488     2e-89  48%  489 aa  AMPA_RHOS5 RecName: Full=Probable cytosol aminopeptidase;       
  123::498     2e-89  48%  500 aa  AMPA_RICTY RecName: Full=Probable cytosol aminopeptidase;       
  125::496     1e-88  49%  497 aa  AMPA_METC4 RecName: Full=Probable cytosol aminopeptidase;       
  130::501     5e-84  45%  503 aa  AMPA_METRJ RecName: Full=Probable cytosol aminopeptidase;       
  139::493     8e-79  48%  497 aa  AMPA_PSEPW RecName: Full=Probable cytosol aminopeptidase;       
  138::492     4e-78  48%  496 aa  AMPA_PSEU5 RecName: Full=Probable cytosol aminopeptidase;       
  138::492     8e-78  48%  496 aa  AMPA_PSEFS RecName: Full=Probable cytosol aminopeptidase;       
  126::490     1e-77  42%  500 aa  AMPA1_SHEON RecName: Full=Probable cytosol aminopeptidase 1;       
  138::492     1e-76  47%  496 aa  AMPA_PSEPF RecName: Full=Probable cytosol aminopeptidase;       
  192::500     2e-76  46%  503 aa  AMPA_CHLL2 RecName: Full=Probable cytosol aminopeptidase;       
  125::495     2e-75  45%  497 aa  AMPA_PELCD RecName: Full=Probable cytosol aminopeptidase;       
  129::492     2e-75  44%  496 aa  AMPA_PSESM RecName: Full=Probable cytosol aminopeptidase;       
  138::491     4e-75  47%  496 aa  AMPA_THISH RecName: Full=Probable cytosol aminopeptidase;       
  144::500     1e-74  46%  500 aa  AMPA_SACD2 RecName: Full=Probable cytosol aminopeptidase;       
  139::493     1e-74  47%  497 aa  AMPA_PSEPG RecName: Full=Probable cytosol aminopeptidase;       
   98::487     1e-74  43%  493 aa  AMPA_CLOPE RecName: Full=Probable cytosol aminopeptidase;       
  139::493     3e-74  47%  497 aa  AMPA_PSEPK RecName: Full=Probable cytosol aminopeptidase;       
  176::490     3e-74  49%  495 aa  AMPA_PSEA7 RecName: Full=Probable cytosol aminopeptidase;       
  138::492     4e-74  44%  496 aa  AMPA_PSEU2 RecName: Full=Probable cytosol aminopeptidase;       
  176::490     4e-74  49%  495 aa  AMPA_PSEAE RecName: Full=Cytosol aminopeptidase;       
  176::490     4e-74  49%  495 aa  AMPA_PSEA8 RecName: Full=Probable cytosol aminopeptidase;       
  139::493     7e-74  47%  497 aa  AMPA_PSEP1 RecName: Full=Probable cytosol aminopeptidase;       
  101::474     7e-74  41%  481 aa  AMPA_CLOTE RecName: Full=Probable cytosol aminopeptidase;       
   98::487     1e-73  43%  493 aa  AMPA_CLOPS RecName: Full=Probable cytosol aminopeptidase;       
  139::493     1e-73  46%  497 aa  AMPA_PSEPU RecName: Full=Cytosol aminopeptidase;       
  137::491     2e-73  45%  496 aa  AMPA_METFK RecName: Full=Probable cytosol aminopeptidase;       
  176::490     3e-73  49%  495 aa  AMPA_PSEAB RecName: Full=Probable cytosol aminopeptidase;       
  123::476     5e-73  44%  478 aa  AMPA_FUSNN RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-72  50%  497 aa  AMPA_ALHEH RecName: Full=Probable cytosol aminopeptidase;       
  139::493     2e-72  45%  497 aa  AMPA_PSEE4 RecName: Full=Probable cytosol aminopeptidase;       
  121::479     3e-72  42%  488 aa  AMPA_CENSY RecName: Full=Probable cytosol aminopeptidase;       
  126::449     7e-72  47%  496 aa  AMPA_ACISJ RecName: Full=Probable cytosol aminopeptidase;       
  129::476     2e-71  44%  483 aa  AMPA_LEGPC RecName: Full=Probable cytosol aminopeptidase;       
  115::449     2e-71  45%  496 aa  AMPA_DIAST RecName: Full=Probable cytosol aminopeptidase;       
  137::486     2e-71  46%  498 aa  AMPA_DECAR RecName: Full=Probable cytosol aminopeptidase;       
  129::476     3e-71  43%  483 aa  AMPA_LEGPL RecName: Full=Probable cytosol aminopeptidase;       
  131::488     3e-71  45%  489 aa  AMPA_ALCBS RecName: Full=Probable cytosol aminopeptidase;       
  104::476     3e-71  42%  479 aa  AMPA_VESOH RecName: Full=Probable cytosol aminopeptidase;       
  117::474     4e-71  44%  482 aa  AMPA_ACIAD RecName: Full=Probable cytosol aminopeptidase;       
  167::507     8e-71  46%  510 aa  AMPA_RALEJ RecName: Full=Probable cytosol aminopeptidase;       
  141::499     8e-71  44%  503 aa  AMPA_BURP8 RecName: Full=Probable cytosol aminopeptidase;       
  179::492     1e-70  47%  502 aa  AMPA_SHEDO RecName: Full=Probable cytosol aminopeptidase;       
  129::476     1e-70  43%  483 aa  AMPA_LEGPA RecName: Full=Probable cytosol aminopeptidase;       
  137::492     1e-70  45%  496 aa  AMPA_AZOVD RecName: Full=Probable cytosol aminopeptidase;       
  127::484     2e-70  42%  491 aa  AMPA_GEOSM RecName: Full=Probable cytosol aminopeptidase;       
  117::474     3e-70  43%  482 aa  AMPA_ACIBY RecName: Full=Probable cytosol aminopeptidase;       
  117::474     3e-70  43%  482 aa  AMPA_ACIBT RecName: Full=Probable cytosol aminopeptidase;       
  117::474     3e-70  43%  482 aa  AMPA_ACIBC RecName: Full=Probable cytosol aminopeptidase;       
  117::474     3e-70  43%  482 aa  AMPA_ACIB5 RecName: Full=Probable cytosol aminopeptidase;       
  117::474     3e-70  43%  482 aa  AMPA_ACIB3 RecName: Full=Probable cytosol aminopeptidase;       
  189::502     5e-70  49%  509 aa  AMPA_TERTT RecName: Full=Probable cytosol aminopeptidase;       
  190::499     5e-70  49%  503 aa  AMPA_BURP1 RecName: Full=Probable cytosol aminopeptidase;       
  179::492     5e-70  46%  502 aa  AMPA2_SHEON RecName: Full=Probable cytosol aminopeptidase 2;       
  190::499     6e-70  48%  503 aa  AMPA_BURPS RecName: Full=Probable cytosol aminopeptidase;       
  190::499     6e-70  48%  503 aa  AMPA_BURP6 RecName: Full=Probable cytosol aminopeptidase;       
  190::499     6e-70  48%  503 aa  AMPA_BURP0 RecName: Full=Probable cytosol aminopeptidase;       
  190::499     6e-70  48%  503 aa  AMPA_BURMS RecName: Full=Probable cytosol aminopeptidase;       
  190::499     6e-70  48%  503 aa  AMPA_BURMA RecName: Full=Probable cytosol aminopeptidase;       
  190::499     6e-70  48%  503 aa  AMPA_BURM9 RecName: Full=Probable cytosol aminopeptidase;       
  190::499     6e-70  48%  503 aa  AMPA_BURM7 RecName: Full=Probable cytosol aminopeptidase;       
  110::490     8e-70  41%  495 aa  AMPA_HAES2 RecName: Full=Probable cytosol aminopeptidase;       
  115::482     8e-70  42%  509 aa  AMPA_CHLT3 RecName: Full=Probable cytosol aminopeptidase;       
  177::491     8e-70  46%  500 aa  AMPA_AZOSE RecName: Full=Probable cytosol aminopeptidase;       
  179::492     1e-69  46%  502 aa  AMPA_SHEFN RecName: Full=Probable cytosol aminopeptidase;       
  179::490     1e-69  46%  497 aa  AMPA_NITEU RecName: Full=Probable cytosol aminopeptidase;       
  138::493     1e-69  44%  521 aa  AMPA_CHRVO RecName: Full=Probable cytosol aminopeptidase;       
  130::495     1e-69  42%  499 aa  AMPA_ALKOO RecName: Full=Probable cytosol aminopeptidase;       
  117::474     1e-69  43%  482 aa  AMPA_ACIBS RecName: Full=Probable cytosol aminopeptidase;       
  138::492     2e-69  43%  497 aa  AMPA_NITEC RecName: Full=Probable cytosol aminopeptidase;       
  190::499     3e-69  49%  503 aa  AMPA_BURTA RecName: Full=Probable cytosol aminopeptidase;       
  179::492     4e-69  47%  502 aa  AMPA_SHEPW RecName: Full=Probable cytosol aminopeptidase;       
  190::499     4e-69  48%  503 aa  AMPA_BURM1 RecName: Full=Probable cytosol aminopeptidase;       
  190::499     5e-69  49%  508 aa  AMPA_BURXL RecName: Full=Probable cytosol aminopeptidase;       
  167::507     7e-69  45%  510 aa  AMPA_RALME RecName: Full=Probable cytosol aminopeptidase;       
  110::490     7e-69  40%  495 aa  AMPA_HAES1 RecName: Full=Probable cytosol aminopeptidase;       
  173::513     9e-69  45%  516 aa  AMPA_CUPTR RecName: Full=Probable cytosol aminopeptidase;       
  141::499     2e-68  44%  503 aa  AMPA_BURVG RecName: Full=Probable cytosol aminopeptidase;       
  190::499     2e-68  48%  508 aa  AMPA_BURPP RecName: Full=Probable cytosol aminopeptidase;       
  125::493     3e-68  42%  501 aa  AMPA_WIGBR RecName: Full=Probable cytosol aminopeptidase;       
  180::485     4e-68  49%  504 aa  AMPA_JANMA RecName: Full=Probable cytosol aminopeptidase;       
  125::486     5e-68  41%  491 aa  AMPA_HAEIN RecName: Full=Cytosol aminopeptidase;       
  125::486     5e-68  41%  491 aa  AMPA_HAEIE RecName: Full=Probable cytosol aminopeptidase;       
  125::486     5e-68  41%  491 aa  AMPA_HAEI8 RecName: Full=Probable cytosol aminopeptidase;       
  179::492     6e-68  47%  502 aa  AMPA_SHELP RecName: Full=Probable cytosol aminopeptidase;       
  169::509     6e-68  45%  512 aa  AMPA_RALEH RecName: Full=Probable cytosol aminopeptidase;       
  121::492     8e-68  39%  499 aa  AMPA_PARUW RecName: Full=Probable cytosol aminopeptidase;       
  121::485     8e-68  42%  490 aa  AMPA_MANSM RecName: Full=Probable cytosol aminopeptidase;       
  191::500     8e-68  45%  503 aa  AMPA_CHLP8 RecName: Full=Probable cytosol aminopeptidase;       
  126::470     2e-67  43%  479 aa  AMPA_RHOFD RecName: Full=Probable cytosol aminopeptidase;       
  179::492     2e-67  46%  502 aa  AMPA_SHESH RecName: Full=Probable cytosol aminopeptidase;       
  125::486     2e-67  41%  491 aa  AMPA_HAEIG RecName: Full=Probable cytosol aminopeptidase;       
  118::479     3e-67  42%  484 aa  AMPA_ACTSZ RecName: Full=Probable cytosol aminopeptidase;       
  179::491     5e-67  46%  501 aa  AMPA_COLP3 RecName: Full=Probable cytosol aminopeptidase;       
  130::492     7e-67  41%  496 aa  AMPA_GEOSL RecName: Full=Probable cytosol aminopeptidase;       
  138::491     9e-67  44%  501 aa  AMPA_IDILO RecName: Full=Probable cytosol aminopeptidase;       
  131::496     1e-66  38%  497 aa  AMPA_PERMH RecName: Full=Probable cytosol aminopeptidase;       
  126::492     1e-66  42%  499 aa  AMPA_HAEDU RecName: Full=Probable cytosol aminopeptidase;       
  138::496     2e-66  44%  504 aa  AMPA_PSYIN RecName: Full=Probable cytosol aminopeptidase;       
  184::500     3e-66  46%  502 aa  AMPA_RALPJ RecName: Full=Probable cytosol aminopeptidase;       
  132::469     3e-66  45%  494 aa  AMPA_HAHCH RecName: Full=Probable cytosol aminopeptidase;       
  179::491     4e-66  45%  501 aa  AMPA_PSEA6 RecName: Full=Probable cytosol aminopeptidase;       
  181::469     7e-66  43%  493 aa  AMPA_THICR RecName: Full=Probable cytosol aminopeptidase;       
  138::492     7e-66  43%  502 aa  AMPA_PHOPR RecName: Full=Probable cytosol aminopeptidase;       
  196::504     7e-66  43%  508 aa  AMPA_PELLD RecName: Full=Probable cytosol aminopeptidase;       
  130::496     7e-66  40%  499 aa  AMPA_CHLPN RecName: Full=Probable cytosol aminopeptidase;       
  179::492     1e-65  45%  502 aa  AMPA_PROMH RecName: Full=Probable cytosol aminopeptidase;       
  192::501     1e-65  43%  504 aa  AMPA_CHLTE RecName: Full=Probable cytosol aminopeptidase;       
  174::490     1e-65  47%  493 aa  AMPA_XANCP RecName: Full=Probable cytosol aminopeptidase;       
  174::490     1e-65  47%  493 aa  AMPA_XANCB RecName: Full=Probable cytosol aminopeptidase;       
  174::490     1e-65  47%  493 aa  AMPA_XANC8 RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-65  44%  503 aa  AMPA_SERP5 RecName: Full=Probable cytosol aminopeptidase;       
  184::485     1e-65  47%  503 aa  AMPA_HERAR RecName: Full=Probable cytosol aminopeptidase;       
  190::472     1e-65  49%  503 aa  AMPA_BURCM RecName: Full=Probable cytosol aminopeptidase;       
  190::472     1e-65  49%  503 aa  AMPA_BURA4 RecName: Full=Probable cytosol aminopeptidase;       
  174::487     2e-65  47%  490 aa  AMPA_XANOR RecName: Full=Probable cytosol aminopeptidase;       
  174::487     2e-65  47%  490 aa  AMPA_XANOP RecName: Full=Probable cytosol aminopeptidase;       
  174::487     2e-65  47%  490 aa  AMPA_XANOM RecName: Full=Probable cytosol aminopeptidase;       
  179::490     3e-65  47%  500 aa  AMPA_TOLAT RecName: Full=Probable cytosol aminopeptidase;       
  197::505     3e-65  44%  507 aa  AMPA_RHOBA RecName: Full=Probable cytosol aminopeptidase;       
  141::472     3e-65  44%  503 aa  AMPA_BURS3 RecName: Full=Probable cytosol aminopeptidase;       
  174::487     4e-65  47%  490 aa  AMPA_XANC5 RecName: Full=Probable cytosol aminopeptidase;       
  194::503     4e-65  46%  506 aa  AMPA_RALSO RecName: Full=Probable cytosol aminopeptidase;       
   95::479     5e-65  39%  486 aa  AMPL_ENCCU RecName: Full=Cytosol aminopeptidase;       
  125::487     5e-65  41%  494 aa  AMPA_PASMU RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-65  48%  503 aa  AMPA_EDWI9 RecName: Full=Probable cytosol aminopeptidase;       
  129::499     5e-65  40%  502 aa  AMPA_BUCAP RecName: Full=Probable cytosol aminopeptidase;       
  174::487     6e-65  47%  490 aa  AMPA_XANAC RecName: Full=Probable cytosol aminopeptidase;       
  179::490     6e-65  46%  502 aa  AMPA_AERHH RecName: Full=Probable cytosol aminopeptidase;       
  178::489     8e-65  43%  495 aa  AMPA_LEPIN RecName: Full=Probable cytosol aminopeptidase;       
  178::489     8e-65  43%  495 aa  AMPA_LEPIC RecName: Full=Probable cytosol aminopeptidase;       
  153::496     1e-64  42%  499 aa  AMPA_BUCAT RecName: Full=Probable cytosol aminopeptidase;       
  179::490     1e-64  45%  502 aa  AMPA_AERS4 RecName: Full=Probable cytosol aminopeptidase;       
  190::472     1e-64  48%  503 aa  AMPA_BURCH RecName: Full=Probable cytosol aminopeptidase;       
  190::472     1e-64  48%  503 aa  AMPA_BURCA RecName: Full=Probable cytosol aminopeptidase;       
  153::496     1e-64  42%  499 aa  AMPA_BUCAI RecName: Full=Cytosol aminopeptidase;       
  153::496     1e-64  42%  499 aa  AMPA_BUCA5 RecName: Full=Probable cytosol aminopeptidase;       
  126::492     1e-64  42%  499 aa  AMPA_ACTP7 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     2e-64  47%  503 aa  AMPA_ERWT9 RecName: Full=Probable cytosol aminopeptidase;       
  126::492     2e-64  42%  499 aa  AMPA_ACTPJ RecName: Full=Probable cytosol aminopeptidase;       
  181::502     2e-64  42%  507 aa  AMPA_DESVH RecName: Full=Probable cytosol aminopeptidase;       
  179::494     3e-64  45%  497 aa  AMPA_METCA RecName: Full=Probable cytosol aminopeptidase;       
  177::491     3e-64  45%  500 aa  AMPA_AZOSB RecName: Full=Probable cytosol aminopeptidase;       
  190::472     4e-64  48%  503 aa  AMPA_BURCJ RecName: Full=Probable cytosol aminopeptidase;       
  190::472     4e-64  48%  503 aa  AMPA_BURCC RecName: Full=Probable cytosol aminopeptidase;       
  175::489     5e-64  45%  491 aa  AMPA_XYLFM RecName: Full=Probable cytosol aminopeptidase;       
  175::489     5e-64  45%  491 aa  AMPA_XYLFA RecName: Full=Probable cytosol aminopeptidase;       
  173::483     7e-64  46%  493 aa  AMPA_SYNPW RecName: Full=Probable cytosol aminopeptidase;       
  194::493     7e-64  45%  503 aa  AMPA_SODGM RecName: Full=Probable cytosol aminopeptidase;       
  222::493     7e-64  48%  503 aa  AMPA_ERWCT RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-63  47%  503 aa  AMPA_PECCP RecName: Full=Probable cytosol aminopeptidase;       
  137::499     2e-63  43%  504 aa  AMPA_BORA1 RecName: Full=Probable cytosol aminopeptidase;       
  179::482     2e-63  45%  502 aa  AMPA_VIBHB RecName: Full=Probable cytosol aminopeptidase;       
  137::494     2e-63  41%  497 aa  AMPA_GEOTN RecName: Full=Probable cytosol aminopeptidase;       
  175::489     3e-63  45%  491 aa  AMPA_XYLFT RecName: Full=Probable cytosol aminopeptidase;       
  175::489     3e-63  45%  491 aa  AMPA_XYLF2 RecName: Full=Probable cytosol aminopeptidase;       
  182::491     4e-63  43%  501 aa  AMPA_NITOC RecName: Full=Probable cytosol aminopeptidase;       
  100::488     6e-63  37%  504 aa  AMPA_SULSY RecName: Full=Probable cytosol aminopeptidase;       
  132::473     6e-63  42%  500 aa  AMPA_CORDI RecName: Full=Probable cytosol aminopeptidase;       
  181::495     6e-63  42%  501 aa  AMPA_BUCBP RecName: Full=Probable cytosol aminopeptidase;       
  126::470     8e-63  41%  519 aa  AMPA_VEREI RecName: Full=Probable cytosol aminopeptidase;       
  166::468     8e-63  44%  511 aa  AMPA_VARPS RecName: Full=Probable cytosol aminopeptidase;       
  188::491     8e-63  43%  500 aa  AMPA_BAUCH RecName: Full=Probable cytosol aminopeptidase;       
  138::482     1e-62  42%  502 aa  AMPA_VIBPA RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALAR RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALTY RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALSV RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALPK RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALPC RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALPB RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALPA RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALNS RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALHS RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALG2 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALEP RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALDC RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALCH RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-62  46%  503 aa  AMPA_SALA4 RecName: Full=Probable cytosol aminopeptidase;       
  179::482     2e-62  44%  502 aa  AMPA_VIBVY RecName: Full=Probable cytosol aminopeptidase;       
  179::482     2e-62  44%  502 aa  AMPA_VIBVU RecName: Full=Probable cytosol aminopeptidase;       
  135::494     2e-62  40%  497 aa  AMPA_GEOSW RecName: Full=Probable cytosol aminopeptidase;       
  121::489     2e-62  38%  499 aa  AMPA_CHLMU RecName: Full=Probable cytosol aminopeptidase;       
  126::492     2e-62  41%  499 aa  AMPA_ACTP2 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     3e-62  46%  503 aa  AMPA_SALTI RecName: Full=Probable cytosol aminopeptidase;       
  122::474     3e-62  40%  477 aa  AMPA_EXIS2 RecName: Full=Probable cytosol aminopeptidase;       
  121::494     3e-62  37%  499 aa  AMPA_CHLCV RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_SHISS RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_SHIFL RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_SHIF8 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_SHIBS RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_SHIB3 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ESCF3 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  46%  503 aa  AMPA_ENT38 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOUT RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOSM RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOSE RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOLU RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOLI RecName: Full=Cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOLC RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOL6 RecName: Full=Cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOL5 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOK1 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOHS RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECODH RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECOBW RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO8A RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO81 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO7I RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO5E RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO57 RecName: Full=Cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO55 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO45 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO27 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_ECO24 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     5e-62  45%  503 aa  AMPA_CITK8 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     6e-62  45%  503 aa  AMPA_SHIDS RecName: Full=Probable cytosol aminopeptidase;       
  212::493     6e-62  46%  503 aa  AMPA_KLEP7 RecName: Full=Probable cytosol aminopeptidase;       
  138::505     8e-62  39%  515 aa  AMPA_DESAH RecName: Full=Probable cytosol aminopeptidase;       
  129::480     8e-62  39%  493 aa  AMPA_AQUAE RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPY RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPS RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPP RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPN RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPG RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPE RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPB RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERPA RecName: Full=Probable cytosol aminopeptidase;       
  179::493     1e-61  43%  503 aa  AMPA_YERP3 RecName: Full=Probable cytosol aminopeptidase;       
  212::493     1e-61  45%  503 aa  AMPA_KLEP3 RecName: Full=Probable cytosol aminopeptidase;       
  165::479     1e-61  43%  484 aa  AMPA_METPP RecName: Full=Probable cytosol aminopeptidase;       
  179::492     2e-61  43%  503 aa  AMPA_VIBCM RecName: Full=Probable cytosol aminopeptidase;       
  179::492     2e-61  43%  503 aa  AMPA_VIBCH RecName: Full=Cytosol aminopeptidase;       
  179::492     2e-61  43%  503 aa  AMPA_VIBC3 RecName: Full=Cytosol aminopeptidase;       
  176::490     2e-61  43%  501 aa  AMPA_HAMD5 RecName: Full=Probable cytosol aminopeptidase;       
  127::487     2e-61  39%  495 aa  AMPA_GEOUR RecName: Full=Probable cytosol aminopeptidase;       
  132::471     2e-61  42%  500 aa  AMPA_BDEBA RecName: Full=Probable cytosol aminopeptidase;       
  179::493     3e-61  43%  503 aa  AMPA_YERE8 RecName: Full=Probable cytosol aminopeptidase;       
  121::495     3e-61  36%  500 aa  AMPA_CHLAB RecName: Full=Probable cytosol aminopeptidase;       
  131::489     4e-61  39%  494 aa  AMPA_BACCR RecName: Full=Probable cytosol aminopeptidase;       
  131::489     4e-61  39%  494 aa  AMPA_BACC2 RecName: Full=Probable cytosol aminopeptidase;       
  136::490     5e-61  41%  496 aa  AMPA_TRIEI RecName: Full=Probable cytosol aminopeptidase;       
  131::489     7e-61  39%  494 aa  AMPA_BACC4 RecName: Full=Probable cytosol aminopeptidase;       
  138::492     7e-61  40%  502 aa  AMPA_ALISL RecName: Full=Probable cytosol aminopeptidase;       
  173::483     9e-61  44%  496 aa  AMPA_PROMA RecName: Full=Probable cytosol aminopeptidase;       
  126::492     9e-61  40%  498 aa  AMPA_HAEPS RecName: Full=Probable cytosol aminopeptidase;       
   96::490     9e-61  37%  500 aa  AMPA_BACSU RecName: Full=Probable cytosol aminopeptidase;       
  191::476     1e-60  43%  503 aa  AMPA_CHLPD RecName: Full=Probable cytosol aminopeptidase;       
   96::490     1e-60  37%  496 aa  AMPA_BACP2 RecName: Full=Probable cytosol aminopeptidase;       
  173::483     2e-60  43%  493 aa  AMPA_PROM4 RecName: Full=Probable cytosol aminopeptidase;       
  104::484     2e-60  38%  491 aa  AMPA_CYAP8 RecName: Full=Probable cytosol aminopeptidase;       
  182::501     2e-60  42%  504 aa  AMPA_GLOVI RecName: Full=Probable cytosol aminopeptidase;       
  140::498     2e-60  39%  504 aa  AMPA_BLOFL RecName: Full=Probable cytosol aminopeptidase;       
  138::502     4e-60  40%  502 aa  AMPA_VIBFM RecName: Full=Probable cytosol aminopeptidase;       
  122::495     4e-60  37%  500 aa  AMPA_CHLFF RecName: Full=Probable cytosol aminopeptidase;       
  181::496     5e-60  40%  500 aa  AMPA_CORGL RecName: Full=Probable cytosol aminopeptidase;       
  138::502     6e-60  40%  502 aa  AMPA_VIBF1 RecName: Full=Probable cytosol aminopeptidase;       
  173::483     6e-60  42%  496 aa  AMPA_SYNS3 RecName: Full=Probable cytosol aminopeptidase;       
  147::509     6e-60  39%  512 aa  AMPA_ACIBL RecName: Full=Probable cytosol aminopeptidase;       
  182::493     8e-60  41%  518 aa  AMPA_NITMU RecName: Full=Probable cytosol aminopeptidase;       
  154::517     2e-59  38%  520 aa  AMPL1_ARATH RecName: Full=Leucine aminopeptidase 1;       
  222::493     3e-59  46%  506 aa  AMPA_PHOLL RecName: Full=Probable cytosol aminopeptidase;       
  198::479     4e-59  46%  487 aa  AMPA_SYNPX RecName: Full=Probable cytosol aminopeptidase;       
  172::489     5e-59  42%  490 aa  AMPA_PROM9 RecName: Full=Probable cytosol aminopeptidase;       
  130::484     5e-59  41%  491 aa  AMPA_ANAVT RecName: Full=Probable cytosol aminopeptidase;       
  121::494     9e-59  36%  499 aa  AMPA_CHLTR RecName: Full=Probable cytosol aminopeptidase;       
   95::452     1e-58  36%  507 aa  AMPA_POLSJ RecName: Full=Probable cytosol aminopeptidase;       
  186::495     1e-58  42%  501 aa  AMPA_DESDA RecName: Full=Probable cytosol aminopeptidase;       
  121::494     1e-58  36%  499 aa  AMPA_CHLTB RecName: Full=Probable cytosol aminopeptidase;       
  121::494     1e-58  36%  499 aa  AMPA_CHLT2 RecName: Full=Probable cytosol aminopeptidase;       
  154::489     1e-58  40%  519 aa  AMPL_BOVIN RecName: Full=Cytosol aminopeptidase;       
   94::454     1e-58  37%  476 aa  AMPA_TREDE RecName: Full=Probable cytosol aminopeptidase;       
  121::494     1e-58  36%  499 aa  AMPA_CHLTA RecName: Full=Probable cytosol aminopeptidase;       
  217::580     2e-58  39%  583 aa  AMPL3_ARATH RecName: Full=Leucine aminopeptidase 3, chloroplastic; 
  178::486     2e-58  42%  492 aa  AMPA_ACAM1 RecName: Full=Probable cytosol aminopeptidase;       
  154::489     3e-58  40%  519 aa  AMPL_HUMAN RecName: Full=Cytosol aminopeptidase;       
  189::499     3e-58  42%  503 aa  AMPA_COREF RecName: Full=Probable cytosol aminopeptidase;       
  191::488     3e-58  43%  500 aa  AMPA_ACIF5 RecName: Full=Probable cytosol aminopeptidase;       
  191::488     3e-58  43%  500 aa  AMPA_ACIF2 RecName: Full=Probable cytosol aminopeptidase;       
  124::489     4e-58  38%  491 aa  AMPA_PROMP RecName: Full=Probable cytosol aminopeptidase;       
  172::489     4e-58  42%  490 aa  AMPA_PROM0 RecName: Full=Probable cytosol aminopeptidase;       
  130::484     4e-58  41%  491 aa  AMPA_ANASP RecName: Full=Probable cytosol aminopeptidase;       
  173::488     6e-58  42%  497 aa  AMPA_THEEB RecName: Full=Probable cytosol aminopeptidase;       
  168::483     7e-58  44%  501 aa  AMPA_SYNR3 RecName: Full=Probable cytosol aminopeptidase;       
  176::484     7e-58  40%  488 aa  AMPA_ROSCS RecName: Full=Probable cytosol aminopeptidase;       
  181::487     1e-57  45%  492 aa  AMPA_STRM5 RecName: Full=Probable cytosol aminopeptidase;       
  179::496     1e-57  45%  499 aa  AMPA_BORPE RecName: Full=Probable cytosol aminopeptidase;       
  179::496     1e-57  45%  499 aa  AMPA_BORPA RecName: Full=Probable cytosol aminopeptidase;       
  179::496     1e-57  45%  499 aa  AMPA_BORBR RecName: Full=Probable cytosol aminopeptidase;       
  172::489     1e-57  41%  490 aa  AMPA_PROMS RecName: Full=Probable cytosol aminopeptidase;       
  154::489     2e-57  40%  519 aa  AMPL_RAT RecName: Full=Cytosol aminopeptidase;       
  180::486     2e-57  45%  491 aa  AMPA_STRMK RecName: Full=Probable cytosol aminopeptidase;       
  187::496     2e-57  42%  510 aa  AMPA_SYNJB RecName: Full=Probable cytosol aminopeptidase;       
   90::490     2e-57  36%  496 aa  AMPA_BACA2 RecName: Full=Probable cytosol aminopeptidase;       
  158::496     3e-57  43%  498 aa  AMPA_BORPD RecName: Full=Probable cytosol aminopeptidase;       
  154::489     4e-57  40%  519 aa  AMPL_MOUSE RecName: Full=Cytosol aminopeptidase;       
  187::507     4e-57  44%  515 aa  AMPA_STRGG RecName: Full=Probable cytosol aminopeptidase;       
  216::579     8e-57  39%  581 aa  AMPL2_ARATH RecName: Full=Leucine aminopeptidase 2, chloroplastic; 
  109::477     1e-56  39%  483 aa  AMPA_WOLSU RecName: Full=Probable cytosol aminopeptidase;       
  207::463     2e-56  46%  493 aa  AMPA_CYAP4 RecName: Full=Probable cytosol aminopeptidase;       
  233::596     2e-56  41%  598 aa  AMPL2_ORYSJ RecName: Full=Leucine aminopeptidase 2, chloroplastic; 
  123::490     2e-56  39%  490 aa  AMPA_MICAN RecName: Full=Probable cytosol aminopeptidase;       
  203::473     3e-56  44%  510 aa  AMPA_POLNA RecName: Full=Probable cytosol aminopeptidase;       
  140::478     3e-56  42%  507 aa  AMPA_ACIC5 RecName: Full=Probable cytosol aminopeptidase;       
  200::481     7e-56  44%  489 aa  AMPA_SYNSC RecName: Full=Probable cytosol aminopeptidase;       
  172::482     7e-56  42%  490 aa  AMPA_SYNS9 RecName: Full=Probable cytosol aminopeptidase;       
  132::485     7e-56  39%  491 aa  AMPA_SYNP2 RecName: Full=Probable cytosol aminopeptidase;       
  105::484     7e-56  38%  490 aa  AMPA_CYAP7 RecName: Full=Probable cytosol aminopeptidase;       
  104::484     9e-56  37%  490 aa  AMPA_CYAA5 RecName: Full=Probable cytosol aminopeptidase;       
  131::489     1e-55  37%  494 aa  AMPA_BACC7 RecName: Full=Probable cytosol aminopeptidase;       
  174::503     2e-55  40%  514 aa  AMPA_DESDG RecName: Full=Probable cytosol aminopeptidase;       
  131::489     2e-55  37%  494 aa  AMPA_BACCZ RecName: Full=Probable cytosol aminopeptidase;       
  131::489     2e-55  37%  494 aa  AMPA_BACCQ RecName: Full=Probable cytosol aminopeptidase;       
  131::489     2e-55  37%  494 aa  AMPA_BACC1 RecName: Full=Probable cytosol aminopeptidase;       
  172::482     3e-55  42%  490 aa  AMPA_PROMM RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  37%  494 aa  AMPA_BACHK RecName: Full=Probable cytosol aminopeptidase;       
   96::490     3e-55  34%  496 aa  AMPA_BACLD RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  36%  494 aa  AMPA_BACC3 RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  36%  494 aa  AMPA_BACC0 RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  36%  494 aa  AMPA_BACAN RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  36%  494 aa  AMPA_BACAH RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  36%  494 aa  AMPA_BACAC RecName: Full=Probable cytosol aminopeptidase;       
  131::489     3e-55  36%  494 aa  AMPA_BACAA RecName: Full=Probable cytosol aminopeptidase;       
  103::491     4e-55  38%  496 aa  AMPA_HELAH RecName: Full=Probable cytosol aminopeptidase;       
  190::474     6e-55  40%  505 aa  AMPA_RHOSR RecName: Full=Probable cytosol aminopeptidase;       
  112::486     1e-54  39%  502 aa  AMPA_TROWT RecName: Full=Probable cytosol aminopeptidase;       
  112::486     1e-54  39%  502 aa  AMPA_TROW8 RecName: Full=Probable cytosol aminopeptidase;       
  118::461     1e-54  40%  468 aa  AMPA_NEIMA RecName: Full=Probable cytosol aminopeptidase;       
  176::487     2e-54  41%  492 aa  AMPA_SYNY3 RecName: Full=Probable cytosol aminopeptidase;       
  190::474     2e-54  40%  505 aa  AMPA_RHOOB RecName: Full=Probable cytosol aminopeptidase;       
  218::496     2e-54  43%  510 aa  AMPA_SYNJA RecName: Full=Probable cytosol aminopeptidase;       
  192::520     3e-54  39%  520 aa  AMPL_DICDI RecName: Full=Cytosol aminopeptidase;       
  131::489     3e-54  36%  494 aa  AMPA_BACWK RecName: Full=Probable cytosol aminopeptidase;       
   90::440     5e-54  36%  520 aa  AMPA_MYCSA RecName: Full=Probable cytosol aminopeptidase;       
  110::477     1e-53  37%  480 aa  AMPA_SOLUE RecName: Full=Probable cytosol aminopeptidase;       
  196::505     1e-53  41%  513 aa  AMPA_STRAW RecName: Full=Probable cytosol aminopeptidase;       
  190::474     2e-53  40%  505 aa  AMPA_RHOE4 RecName: Full=Probable cytosol aminopeptidase;       
  172::489     2e-53  40%  490 aa  AMPA_PROM2 RecName: Full=Probable cytosol aminopeptidase;       
  207::571     3e-53  40%  571 aa  AMPL1_SOLLC RecName: Full=Leucine aminopeptidase 1, chloroplastic; 
  112::462     6e-53  37%  474 aa  AMPA_HELHP RecName: Full=Probable cytosol aminopeptidase;       
  130::461     7e-53  40%  493 aa  AMPA_NOSP7 RecName: Full=Probable cytosol aminopeptidase;       
  149::519     1e-52  39%  524 aa  AMPA_MYCLE RecName: Full=Probable cytosol aminopeptidase;       
  137::421     2e-52  40%  445 aa  AMPA_MYCPN RecName: Full=Probable cytosol aminopeptidase;       
  192::488     2e-52  41%  520 aa  AMPL_XENTR RecName: Full=Cytosol aminopeptidase;       
  189::509     5e-52  39%  517 aa  AMPA_STRCO RecName: Full=Probable cytosol aminopeptidase;       
  126::491     6e-52  39%  496 aa  AMPA_HELPG RecName: Full=Probable cytosol aminopeptidase;       
  132::494     8e-52  38%  500 aa  AMPA_ALKMQ RecName: Full=Probable cytosol aminopeptidase;       
  140::510     2e-51  37%  515 aa  AMPA_MYCPA RecName: Full=Probable cytosol aminopeptidase;       
  154::491     2e-51  38%  496 aa  AMPA_HELPJ RecName: Full=Cytosol aminopeptidase;       
  154::491     2e-51  38%  496 aa  AMPA_HELPH RecName: Full=Probable cytosol aminopeptidase;       
  126::491     3e-51  39%  496 aa  AMPA_HELPS RecName: Full=Probable cytosol aminopeptidase;       
  126::491     4e-51  38%  496 aa  AMPA_HELPY RecName: Full=Cytosol aminopeptidase;       
  133::498     5e-51  36%  502 aa  AMPA_DESPS RecName: Full=Probable cytosol aminopeptidase;       
  110::484     7e-51  34%  492 aa  AMPA_AERPE RecName: Full=Probable cytosol aminopeptidase;       
  188::495     9e-51  37%  505 aa  AMPA_SYNFM RecName: Full=Probable cytosol aminopeptidase;       
  170::491     9e-51  38%  496 aa  AMPA_HELP2 RecName: Full=Probable cytosol aminopeptidase;       
  144::514     1e-50  35%  519 aa  AMPA_MYCUA RecName: Full=Probable cytosol aminopeptidase;       
  140::510     1e-50  37%  515 aa  AMPA_MYCTU RecName: Full=Probable cytosol aminopeptidase;       
  140::510     1e-50  37%  515 aa  AMPA_MYCTA RecName: Full=Probable cytosol aminopeptidase;       
  132::489     1e-50  38%  513 aa  AMPA_MYCSS RecName: Full=Probable cytosol aminopeptidase;       
  132::489     1e-50  38%  513 aa  AMPA_MYCSK RecName: Full=Probable cytosol aminopeptidase;       
  105::477     1e-50  37%  483 aa  AMPA_CAMJE RecName: Full=Probable cytosol aminopeptidase;       
  162::492     2e-50  41%  496 aa  AMPA_LEIXX RecName: Full=Probable cytosol aminopeptidase;       
  144::514     3e-50  35%  519 aa  AMPA_MYCMM RecName: Full=Probable cytosol aminopeptidase;       
  140::510     3e-50  37%  515 aa  AMPA_MYCBT RecName: Full=Probable cytosol aminopeptidase;       
  140::510     3e-50  37%  515 aa  AMPA_MYCBP RecName: Full=Probable cytosol aminopeptidase;       
  140::510     3e-50  37%  515 aa  AMPA_MYCBO RecName: Full=Probable cytosol aminopeptidase;       
  207::571     6e-50  38%  573 aa  AMPL_SOLTU RecName: Full=Leucine aminopeptidase, chloroplastic;    
  136::499     6e-50  36%  503 aa  AMPA_NOCFA RecName: Full=Probable cytosol aminopeptidase;       
  178::491     6e-50  39%  499 aa  AMPA_HALHL RecName: Full=Probable cytosol aminopeptidase;       
  205::566     7e-50  37%  569 aa  AMPL2_SOLLC RecName: Full=Leucine aminopeptidase 2, chloroplastic; 
  132::489     1e-49  37%  513 aa  AMPA_MYCSJ RecName: Full=Probable cytosol aminopeptidase;       
  216::480     4e-49  44%  486 aa  AMPA_SYNE7 RecName: Full=Probable cytosol aminopeptidase;       
  197::508     5e-49  38%  513 aa  YA55_SCHPO RecName: Full=Putative aminopeptidase C13A11.05;        
  216::480     5e-49  44%  486 aa  AMPA_SYNP6 RecName: Full=Probable cytosol aminopeptidase;       
   92::431     2e-48  37%  432 aa  PEPB_VIBPA RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::428     3e-48  36%  431 aa  PEPB_VIBSL RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  130::488     4e-48  33%  493 aa  AMPA_BACCN RecName: Full=Probable cytosol aminopeptidase;       
   92::428     3e-47  36%  432 aa  PEPB_VIBHB RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  187::494     3e-46  39%  507 aa  AMPA_CHRSD RecName: Full=Probable cytosol aminopeptidase;       
  103::428     6e-45  37%  432 aa  PEPB_VIBVY RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  103::428     6e-45  37%  432 aa  PEPB_VIBVU RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   70::425     9e-45  35%  428 aa  PEPB_ENTS8 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  210::533     9e-45  41%  542 aa  AMPL1_ORYSJ RecName: Full=Putative leucine aminopeptidase 1;       
  180::468     9e-45  39%  502 aa  AMPA_CLAM3 RecName: Full=Probable cytosol aminopeptidase;       
  107::428     2e-44  36%  434 aa  PEPB_HAEIN RecName: Full=Putative peptidase B;       
  106::423     2e-44  34%  447 aa  AMPA_MYCGE RecName: Full=Probable cytosol aminopeptidase;       
  109::425     3e-44  35%  429 aa  PEPB_VIBCH RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  107::428     5e-44  36%  434 aa  PEPB_HAEI8 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  181::481     1e-43  35%  495 aa  AMPA_STACT RecName: Full=Probable cytosol aminopeptidase;       
  107::428     1e-43  36%  434 aa  PEPB_PASMU RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  170::477     2e-43  34%  491 aa  AMPA_SYMTH RecName: Full=Probable cytosol aminopeptidase;       
  190::506     9e-43  38%  510 aa  AMPA_MICLC RecName: Full=Probable cytosol aminopeptidase;       
  169::502     1e-42  33%  508 aa  AMPA_PROAC RecName: Full=Probable cytosol aminopeptidase;       
   78::425     1e-41  32%  427 aa  PEPB_SALTI RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     2e-41  36%  431 aa  PEPB_PHOLL RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     2e-41  35%  428 aa  PEPB_ENT38 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   84::434     8e-41  34%  436 aa  PEPB_PECCP RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   84::434     8e-41  34%  436 aa  PEPB_ERWCT RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     4e-40  35%  428 aa  PEPB_KLEP7 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-40  34%  427 aa  PEPB_ESCF3 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     2e-39  33%  427 aa  PEPB_SHIFL RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     2e-39  33%  427 aa  PEPB_ECO5E RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     2e-39  33%  427 aa  PEPB_ECO57 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_SHISS RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_SHIF8 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_SHIDS RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_ECOSE RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_ECO8A RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_ECO55 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-39  33%  427 aa  PEPB_ECO24 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOUT RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOLI RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOLC RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOL6 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOL5 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOK1 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOHS RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECODH RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECOBW RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECO81 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECO45 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-39  33%  427 aa  PEPB_ECO27 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     8e-39  33%  427 aa  PEPB_ECOSM RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     8e-39  33%  427 aa  PEPB_ECOLU RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     1e-38  33%  427 aa  PEPB_SHIBS RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     1e-38  33%  427 aa  PEPB_SHIB3 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     1e-38  34%  428 aa  PEPB_KLEP3 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     3e-38  33%  427 aa  PEPB_CITK8 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     4e-38  31%  427 aa  PEPB_SALAR RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALTY RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALPC RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALPB RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALNS RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALG2 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALEP RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALDC RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     5e-38  31%  427 aa  PEPB_SALA4 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     9e-38  34%  431 aa  PEPB_SERP5 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
   78::425     1e-37  31%  427 aa  PEPB_SALCH RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPY RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPS RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPP RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPN RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPG RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPE RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPB RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     5e-36  32%  432 aa  PEPB_YERPA RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  110::426     6e-36  32%  432 aa  PEPB_YERP3 RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  109::425     5e-33  31%  427 aa  PEPB_ECO7I RecName: Full=Peptidase B;         EC=3.4.11.23;AltName:
  153::480     2e-32  33%  491 aa  AMPL_CAEEL RecName: Full=Leucine aminopeptidase 1;       
  176::466     2e-31  34%  523 aa  PEPL1_PONAB RecName: Full=Probable aminopeptidase NPEPL1;       
  176::466     2e-31  34%  523 aa  PEPL1_HUMAN RecName: Full=Probable aminopeptidase NPEPL1;       
  143::466     3e-31  33%  524 aa  PEPL1_MOUSE RecName: Full=Probable aminopeptidase NPEPL1;       
  153::471     1e-21  31%  522 aa  YH24_CAEEL RecName: Full=Putative aminopeptidase W07G4.4;       
    1::485

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AMPA_EHRRG      ----------------------------------------------------------------------
AMPA_EHRRW      ----------------------------------------------------------------------
AMPA_MESSB      ----------------------------------------------------------------------
AMPA_XANP2      ----------------------------------------------------------------------
AMPA_BRASB      ----------------------------------------------------------------------
AMPA_PHYAS      ----------------------------------------------------------------------
AMPA_BRAJA      ----------------------------------------------------------------------
AMPA_RHISN      ----------------------------------------------------------------------
AMPA_OCHA4      ----------------------------------------------------------------------
AMPA_RHOPT      ----------------------------------------------------------------------
AMPA_RHOPA      ----------------------------------------------------------------------
AMPA_RHIME      ----------------------------------------------------------------------
AMPA_NITWN      ----------------------------------------------------------------------
AMPA_RHILW      ----------------------------------------------------------------------
AMPA_RHIEC      ----------------------------------------------------------------------
AMPA_RHIL3      ----------------------------------------------------------------------
AMPA_SINMW      ----------------------------------------------------------------------
AMPA_OLICO      ----------------------------------------------------------------------
AMPA_AGRT5      ----------------------------------------------------------------------
AMPA_RHIE6      ----------------------------------------------------------------------
AMPA_RHOPB      ----------------------------------------------------------------------
AMPA_WOLPM      ----------------------------------------------------------------------
AMPA_RHOP5      ----------------------------------------------------------------------
AMPA_RHOP2      ----------------------------------------------------------------------
AMPA_RHOPS      ----------------------------------------------------------------------
AMPA_AGRRK      ----------------------------------------------------------------------
AMPA_RHILO      ----------------------------------------------------------------------
AMPA_NITHX      ----------------------------------------------------------------------
AMPA_RICBR      ----------------------------------------------------------------------
AMPA_RICB8      ----------------------------------------------------------------------
AMPA_CAUCR      ----------------------------------------------------------------------
AMPA_PHYMT      ----------------------------------------------------------------------
AMPA_GLUOX      ----------------------------------------------------------------------
AMPA_RICCK      ----------------------------------------------------------------------
AMPA_BRUME      ----------------------------------------------------------------------
AMPA_AGRVS      ----------------------------------------------------------------------
AMPA_BRUO2      ----------------------------------------------------------------------
AMPA_BRUSU      ----------------------------------------------------------------------
AMPA_RICFE      ----------------------------------------------------------------------
AMPA_RICM5      ----------------------------------------------------------------------
AMPA_RICPR      ----------------------------------------------------------------------
AMPA_RICPU      ----------------------------------------------------------------------
AMPA_RICCN      ----------------------------------------------------------------------
AMPA_RICAE      ----------------------------------------------------------------------
AMPA_RICRS      ----------------------------------------------------------------------
AMPA_RICRO      ----------------------------------------------------------------------
AMPA_METPB      ----------------------------------------------------------------------
AMPA_DINSH      ----------------------------------------------------------------------
AMPA_METEP      ----------------------------------------------------------------------
AMPA_RHOS5      ----------------------------------------------------------------------
AMPA_RICTY      ----------------------------------------------------------------------
AMPA_METC4      ----------------------------------------------------------------------
AMPA_METRJ      ----------------------------------------------------------------------
AMPA_PSEPW      ----------------------------------------------------------------------
AMPA_PSEU5      ----------------------------------------------------------------------
AMPA_PSEFS      ----------------------------------------------------------------------
AMPA1_SHEON     ----------------------------------------------------------------------
AMPA_PSEPF      ----------------------------------------------------------------------
AMPA_CHLL2      ----------------------------------------------------------------------
AMPA_PELCD      ----------------------------------------------------------------------
AMPA_PSESM      ----------------------------------------------------------------------
AMPA_THISH      ----------------------------------------------------------------------
AMPA_SACD2      ----------------------------------------------------------------------
AMPA_PSEPG      ----------------------------------------------------------------------
AMPA_CLOPE      ----------------------------------------------------------------------
AMPA_PSEPK      ----------------------------------------------------------------------
AMPA_PSEA7      ----------------------------------------------------------------------
AMPA_PSEU2      ----------------------------------------------------------------------
AMPA_PSEAE      ----------------------------------------------------------------------
AMPA_PSEA8      ----------------------------------------------------------------------
AMPA_PSEP1      ----------------------------------------------------------------------
AMPA_CLOTE      ----------------------------------------------------------------------
AMPA_CLOPS      ----------------------------------------------------------------------
AMPA_PSEPU      ----------------------------------------------------------------------
AMPA_METFK      ----------------------------------------------------------------------
AMPA_PSEAB      ----------------------------------------------------------------------
AMPA_FUSNN      ----------------------------------------------------------------------
AMPA_ALHEH      ----------------------------------------------------------------------
AMPA_PSEE4      ----------------------------------------------------------------------
AMPA_CENSY      ----------------------------------------------------------------------
AMPA_ACISJ      ----------------------------------------------------------------------
AMPA_LEGPC      ----------------------------------------------------------------------
AMPA_DIAST      ----------------------------------------------------------------------
AMPA_DECAR      ----------------------------------------------------------------------
AMPA_LEGPL      ----------------------------------------------------------------------
AMPA_ALCBS      ----------------------------------------------------------------------
AMPA_VESOH      ----------------------------------------------------------------------
AMPA_ACIAD      ----------------------------------------------------------------------
AMPA_RALEJ      ----------------------------------------------------------------------
AMPA_BURP8      ----------------------------------------------------------------------
AMPA_SHEDO      ----------------------------------------------------------------------
AMPA_LEGPA      ----------------------------------------------------------------------
AMPA_AZOVD      ----------------------------------------------------------------------
AMPA_GEOSM      ----------------------------------------------------------------------
AMPA_ACIBY      ----------------------------------------------------------------------
AMPA_ACIBT      ----------------------------------------------------------------------
AMPA_ACIBC      ----------------------------------------------------------------------
AMPA_ACIB5      ----------------------------------------------------------------------
AMPA_ACIB3      ----------------------------------------------------------------------
AMPA_TERTT      ----------------------------------------------------------------------
AMPA_BURP1      ----------------------------------------------------------------------
AMPA2_SHEON     ----------------------------------------------------------------------
AMPA_BURPS      ----------------------------------------------------------------------
AMPA_BURP6      ----------------------------------------------------------------------
AMPA_BURP0      ----------------------------------------------------------------------
AMPA_BURMS      ----------------------------------------------------------------------
AMPA_BURMA      ----------------------------------------------------------------------
AMPA_BURM9      ----------------------------------------------------------------------
AMPA_BURM7      ----------------------------------------------------------------------
AMPA_HAES2      ----------------------------------------------------------------------
AMPA_CHLT3      ----------------------------------------------------------------------
AMPA_AZOSE      ----------------------------------------------------------------------
AMPA_SHEFN      ----------------------------------------------------------------------
AMPA_NITEU      ----------------------------------------------------------------------
AMPA_CHRVO      ----------------------------------------------------------------------
AMPA_ALKOO      ----------------------------------------------------------------------
AMPA_ACIBS      ----------------------------------------------------------------------
AMPA_NITEC      ----------------------------------------------------------------------
AMPA_BURTA      ----------------------------------------------------------------------
AMPA_SHEPW      ----------------------------------------------------------------------
AMPA_BURM1      ----------------------------------------------------------------------
AMPA_BURXL      ----------------------------------------------------------------------
AMPA_RALME      ----------------------------------------------------------------------
AMPA_HAES1      ----------------------------------------------------------------------
AMPA_CUPTR      ----------------------------------------------------------------------
AMPA_BURVG      ----------------------------------------------------------------------
AMPA_BURPP      ----------------------------------------------------------------------
AMPA_WIGBR      ----------------------------------------------------------------------
AMPA_JANMA      ----------------------------------------------------------------------
AMPA_HAEIN      ----------------------------------------------------------------------
AMPA_HAEIE      ----------------------------------------------------------------------
AMPA_HAEI8      ----------------------------------------------------------------------
AMPA_SHELP      ----------------------------------------------------------------------
AMPA_RALEH      ----------------------------------------------------------------------
AMPA_PARUW      ----------------------------------------------------------------------
AMPA_MANSM      ----------------------------------------------------------------------
AMPA_CHLP8      ----------------------------------------------------------------------
AMPA_RHOFD      ----------------------------------------------------------------------
AMPA_SHESH      ----------------------------------------------------------------------
AMPA_HAEIG      ----------------------------------------------------------------------
AMPA_ACTSZ      ----------------------------------------------------------------------
AMPA_COLP3      ----------------------------------------------------------------------
AMPA_GEOSL      ----------------------------------------------------------------------
AMPA_IDILO      ----------------------------------------------------------------------
AMPA_PERMH      ----------------------------------------------------------------------
AMPA_HAEDU      ----------------------------------------------------------------------
AMPA_PSYIN      ----------------------------------------------------------------------
AMPA_RALPJ      ----------------------------------------------------------------------
AMPA_HAHCH      ----------------------------------------------------------------------
AMPA_PSEA6      ----------------------------------------------------------------------
AMPA_THICR      ----------------------------------------------------------------------
AMPA_PHOPR      ----------------------------------------------------------------------
AMPA_PELLD      ----------------------------------------------------------------------
AMPA_CHLPN      ----------------------------------------------------------------------
AMPA_PROMH      ----------------------------------------------------------------------
AMPA_CHLTE      ----------------------------------------------------------------------
AMPA_XANCP      ----------------------------------------------------------------------
AMPA_XANCB      ----------------------------------------------------------------------
AMPA_XANC8      ----------------------------------------------------------------------
AMPA_SERP5      ----------------------------------------------------------------------
AMPA_HERAR      ----------------------------------------------------------------------
AMPA_BURCM      ----------------------------------------------------------------------
AMPA_BURA4      ----------------------------------------------------------------------
AMPA_XANOR      ----------------------------------------------------------------------
AMPA_XANOP      ----------------------------------------------------------------------
AMPA_XANOM      ----------------------------------------------------------------------
AMPA_TOLAT      ----------------------------------------------------------------------
AMPA_RHOBA      ----------------------------------------------------------------------
AMPA_BURS3      ----------------------------------------------------------------------
AMPA_XANC5      ----------------------------------------------------------------------
AMPA_RALSO      ----------------------------------------------------------------------
AMPL_ENCCU      ----------------------------------------------------------------------
AMPA_PASMU      ----------------------------------------------------------------------
AMPA_EDWI9      ----------------------------------------------------------------------
AMPA_BUCAP      ----------------------------------------------------------------------
AMPA_XANAC      ----------------------------------------------------------------------
AMPA_AERHH      ----------------------------------------------------------------------
AMPA_LEPIN      ----------------------------------------------------------------------
AMPA_LEPIC      ----------------------------------------------------------------------
AMPA_BUCAT      ----------------------------------------------------------------------
AMPA_AERS4      ----------------------------------------------------------------------
AMPA_BURCH      ----------------------------------------------------------------------
AMPA_BURCA      ----------------------------------------------------------------------
AMPA_BUCAI      ----------------------------------------------------------------------
AMPA_BUCA5      ----------------------------------------------------------------------
AMPA_ACTP7      ----------------------------------------------------------------------
AMPA_ERWT9      ----------------------------------------------------------------------
AMPA_ACTPJ      ----------------------------------------------------------------------
AMPA_DESVH      ----------------------------------------------------------------------
AMPA_METCA      ----------------------------------------------------------------------
AMPA_AZOSB      ----------------------------------------------------------------------
AMPA_BURCJ      ----------------------------------------------------------------------
AMPA_BURCC      ----------------------------------------------------------------------
AMPA_XYLFM      ----------------------------------------------------------------------
AMPA_XYLFA      ----------------------------------------------------------------------
AMPA_SYNPW      ----------------------------------------------------------------------
AMPA_SODGM      ----------------------------------------------------------------------
AMPA_ERWCT      ----------------------------------------------------------------------
AMPA_PECCP      ----------------------------------------------------------------------
AMPA_BORA1      ----------------------------------------------------------------------
AMPA_VIBHB      ----------------------------------------------------------------------
AMPA_GEOTN      ----------------------------------------------------------------------
AMPA_XYLFT      ----------------------------------------------------------------------
AMPA_XYLF2      ----------------------------------------------------------------------
AMPA_NITOC      ----------------------------------------------------------------------
AMPA_SULSY      ----------------------------------------------------------------------
AMPA_CORDI      ----------------------------------------------------------------------
AMPA_BUCBP      ----------------------------------------------------------------------
AMPA_VEREI      ----------------------------------------------------------------------
AMPA_VARPS      ----------------------------------------------------------------------
AMPA_BAUCH      ----------------------------------------------------------------------
AMPA_VIBPA      ----------------------------------------------------------------------
AMPA_SALAR      ----------------------------------------------------------------------
AMPA_SALTY      ----------------------------------------------------------------------
AMPA_SALSV      ----------------------------------------------------------------------
AMPA_SALPK      ----------------------------------------------------------------------
AMPA_SALPC      ----------------------------------------------------------------------
AMPA_SALPB      ----------------------------------------------------------------------
AMPA_SALPA      ----------------------------------------------------------------------
AMPA_SALNS      ----------------------------------------------------------------------
AMPA_SALHS      ----------------------------------------------------------------------
AMPA_SALG2      ----------------------------------------------------------------------
AMPA_SALEP      ----------------------------------------------------------------------
AMPA_SALDC      ----------------------------------------------------------------------
AMPA_SALCH      ----------------------------------------------------------------------
AMPA_SALA4      ----------------------------------------------------------------------
AMPA_VIBVY      ----------------------------------------------------------------------
AMPA_VIBVU      ----------------------------------------------------------------------
AMPA_GEOSW      ----------------------------------------------------------------------
AMPA_CHLMU      ----------------------------------------------------------------------
AMPA_ACTP2      ----------------------------------------------------------------------
AMPA_SALTI      ----------------------------------------------------------------------
AMPA_EXIS2      ----------------------------------------------------------------------
AMPA_CHLCV      ----------------------------------------------------------------------
AMPA_SHISS      ----------------------------------------------------------------------
AMPA_SHIFL      ----------------------------------------------------------------------
AMPA_SHIF8      ----------------------------------------------------------------------
AMPA_SHIBS      ----------------------------------------------------------------------
AMPA_SHIB3      ----------------------------------------------------------------------
AMPA_ESCF3      ----------------------------------------------------------------------
AMPA_ENT38      ----------------------------------------------------------------------
AMPA_ECOUT      ----------------------------------------------------------------------
AMPA_ECOSM      ----------------------------------------------------------------------
AMPA_ECOSE      ----------------------------------------------------------------------
AMPA_ECOLU      ----------------------------------------------------------------------
AMPA_ECOLI      ----------------------------------------------------------------------
AMPA_ECOLC      ----------------------------------------------------------------------
AMPA_ECOL6      ----------------------------------------------------------------------
AMPA_ECOL5      ----------------------------------------------------------------------
AMPA_ECOK1      ----------------------------------------------------------------------
AMPA_ECOHS      ----------------------------------------------------------------------
AMPA_ECODH      ----------------------------------------------------------------------
AMPA_ECOBW      ----------------------------------------------------------------------
AMPA_ECO8A      ----------------------------------------------------------------------
AMPA_ECO81      ----------------------------------------------------------------------
AMPA_ECO7I      ----------------------------------------------------------------------
AMPA_ECO5E      ----------------------------------------------------------------------
AMPA_ECO57      ----------------------------------------------------------------------
AMPA_ECO55      ----------------------------------------------------------------------
AMPA_ECO45      ----------------------------------------------------------------------
AMPA_ECO27      ----------------------------------------------------------------------
AMPA_ECO24      ----------------------------------------------------------------------
AMPA_CITK8      ----------------------------------------------------------------------
AMPA_SHIDS      ----------------------------------------------------------------------
AMPA_KLEP7      ----------------------------------------------------------------------
AMPA_DESAH      ----------------------------------------------------------------------
AMPA_AQUAE      ----------------------------------------------------------------------
AMPA_YERPY      ----------------------------------------------------------------------
AMPA_YERPS      ----------------------------------------------------------------------
AMPA_YERPP      ----------------------------------------------------------------------
AMPA_YERPN      ----------------------------------------------------------------------
AMPA_YERPG      ----------------------------------------------------------------------
AMPA_YERPE      ----------------------------------------------------------------------
AMPA_YERPB      ----------------------------------------------------------------------
AMPA_YERPA      ----------------------------------------------------------------------
AMPA_YERP3      ----------------------------------------------------------------------
AMPA_KLEP3      ----------------------------------------------------------------------
AMPA_METPP      ----------------------------------------------------------------------
AMPA_VIBCM      ----------------------------------------------------------------------
AMPA_VIBCH      ----------------------------------------------------------------------
AMPA_VIBC3      ----------------------------------------------------------------------
AMPA_HAMD5      ----------------------------------------------------------------------
AMPA_GEOUR      ----------------------------------------------------------------------
AMPA_BDEBA      ----------------------------------------------------------------------
AMPA_YERE8      ----------------------------------------------------------------------
AMPA_CHLAB      ----------------------------------------------------------------------
AMPA_BACCR      ----------------------------------------------------------------------
AMPA_BACC2      ----------------------------------------------------------------------
AMPA_TRIEI      ----------------------------------------------------------------------
AMPA_BACC4      ----------------------------------------------------------------------
AMPA_ALISL      ----------------------------------------------------------------------
AMPA_PROMA      ----------------------------------------------------------------------
AMPA_HAEPS      ----------------------------------------------------------------------
AMPA_BACSU      ----------------------------------------------------------------------
AMPA_CHLPD      ----------------------------------------------------------------------
AMPA_BACP2      ----------------------------------------------------------------------
AMPA_PROM4      ----------------------------------------------------------------------
AMPA_CYAP8      ----------------------------------------------------------------------
AMPA_GLOVI      ----------------------------------------------------------------------
AMPA_BLOFL      ----------------------------------------------------------------------
AMPA_VIBFM      ----------------------------------------------------------------------
AMPA_CHLFF      ----------------------------------------------------------------------
AMPA_CORGL      ----------------------------------------------------------------------
AMPA_VIBF1      ----------------------------------------------------------------------
AMPA_SYNS3      ----------------------------------------------------------------------
AMPA_ACIBL      ----------------------------------------------------------------------
AMPA_NITMU      ----------------------------------------------------------------------
AMPL1_ARATH     ----------------------------------------------------------------------
AMPA_PHOLL      ----------------------------------------------------------------------
AMPA_SYNPX      ----------------------------------------------------------------------
AMPA_PROM9      ----------------------------------------------------------------------
AMPA_ANAVT      ----------------------------------------------------------------------
AMPA_CHLTR      ----------------------------------------------------------------------
AMPA_POLSJ      ----------------------------------------------------------------------
AMPA_DESDA      ----------------------------------------------------------------------
AMPA_CHLTB      ----------------------------------------------------------------------
AMPA_CHLT2      ----------------------------------------------------------------------
AMPL_BOVIN      ----------------------------------------------------------------------
AMPA_TREDE      ----------------------------------------------------------------------
AMPA_CHLTA      ----------------------------------------------------------------------
AMPL3_ARATH     ----------------------------------------------------------------------
AMPA_ACAM1      ----------------------------------------------------------------------
AMPL_HUMAN      ----------------------------------------------------------------------
AMPA_COREF      ----------------------------------------------------------------------
AMPA_ACIF5      ----------------------------------------------------------------------
AMPA_ACIF2      ----------------------------------------------------------------------
AMPA_PROMP      ----------------------------------------------------------------------
AMPA_PROM0      ----------------------------------------------------------------------
AMPA_ANASP      ----------------------------------------------------------------------
AMPA_THEEB      ----------------------------------------------------------------------
AMPA_SYNR3      ----------------------------------------------------------------------
AMPA_ROSCS      ----------------------------------------------------------------------
AMPA_STRM5      ----------------------------------------------------------------------
AMPA_BORPE      ----------------------------------------------------------------------
AMPA_BORPA      ----------------------------------------------------------------------
AMPA_BORBR      ----------------------------------------------------------------------
AMPA_PROMS      ----------------------------------------------------------------------
AMPL_RAT        ----------------------------------------------------------------------
AMPA_STRMK      ----------------------------------------------------------------------
AMPA_SYNJB      ----------------------------------------------------------------------
AMPA_BACA2      ----------------------------------------------------------------------
AMPA_BORPD      ----------------------------------------------------------------------
AMPL_MOUSE      ----------------------------------------------------------------------
AMPA_STRGG      ----------------------------------------------------------------------
AMPL2_ARATH     ----------------------------------------------------------------------
AMPA_WOLSU      ----------------------------------------------------------------------
AMPA_CYAP4      ----------------------------------------------------------------------
AMPL2_ORYSJ     ----------------------------------------------------------------------
AMPA_MICAN      ----------------------------------------------------------------------
AMPA_POLNA      ----------------------------------------------------------------------
AMPA_ACIC5      ----------------------------------------------------------------------
AMPA_SYNSC      ----------------------------------------------------------------------
AMPA_SYNS9      ----------------------------------------------------------------------
AMPA_SYNP2      ----------------------------------------------------------------------
AMPA_CYAP7      ----------------------------------------------------------------------
AMPA_CYAA5      ----------------------------------------------------------------------
AMPA_BACC7      ----------------------------------------------------------------------
AMPA_DESDG      ----------------------------------------------------------------------
AMPA_BACCZ      ----------------------------------------------------------------------
AMPA_BACCQ      ----------------------------------------------------------------------
AMPA_BACC1      ----------------------------------------------------------------------
AMPA_PROMM      ----------------------------------------------------------------------
AMPA_BACHK      ----------------------------------------------------------------------
AMPA_BACLD      ----------------------------------------------------------------------
AMPA_BACC3      ----------------------------------------------------------------------
AMPA_BACC0      ----------------------------------------------------------------------
AMPA_BACAN      ----------------------------------------------------------------------
AMPA_BACAH      ----------------------------------------------------------------------
AMPA_BACAC      ----------------------------------------------------------------------
AMPA_BACAA      ----------------------------------------------------------------------
AMPA_HELAH      ----------------------------------------------------------------------
AMPA_RHOSR      ----------------------------------------------------------------------
AMPA_TROWT      ----------------------------------------------------------------------
AMPA_TROW8      ----------------------------------------------------------------------
AMPA_NEIMA      ----------------------------------------------------------------------
AMPA_SYNY3      ----------------------------------------------------------------------
AMPA_RHOOB      ----------------------------------------------------------------------
AMPA_SYNJA      ----------------------------------------------------------------------
AMPL_DICDI      ----------------------------------------------------------------------
AMPA_BACWK      ----------------------------------------------------------------------
AMPA_MYCSA      ----------------------------------------------------------------------
AMPA_SOLUE      ----------------------------------------------------------------------
AMPA_STRAW      ----------------------------------------------------------------------
AMPA_RHOE4      ----------------------------------------------------------------------
AMPA_PROM2      ----------------------------------------------------------------------
AMPL1_SOLLC     ----------------------------------------------------------------------
AMPA_HELHP      ----------------------------------------------------------------------
AMPA_NOSP7      ----------------------------------------------------------------------
AMPA_MYCLE      ----------------------------------------------------------------------
AMPA_MYCPN      ----------------------------------------------------------------------
AMPL_XENTR      ----------------------------------------------------------------------
AMPA_STRCO      ----------------------------------------------------------------------
AMPA_HELPG      ----------------------------------------------------------------------
AMPA_ALKMQ      ----------------------------------------------------------------------
AMPA_MYCPA      ----------------------------------------------------------------------
AMPA_HELPJ      ----------------------------------------------------------------------
AMPA_HELPH      ----------------------------------------------------------------------
AMPA_HELPS      ----------------------------------------------------------------------
AMPA_HELPY      ----------------------------------------------------------------------
AMPA_DESPS      ----------------------------------------------------------------------
AMPA_AERPE      ----------------------------------------------------------------------
AMPA_SYNFM      ----------------------------------------------------------------------
AMPA_HELP2      ----------------------------------------------------------------------
AMPA_MYCUA      ----------------------------------------------------------------------
AMPA_MYCTU      ----------------------------------------------------------------------
AMPA_MYCTA      ----------------------------------------------------------------------
AMPA_MYCSS      ----------------------------------------------------------------------
AMPA_MYCSK      ----------------------------------------------------------------------
AMPA_CAMJE      ----------------------------------------------------------------------
AMPA_LEIXX      ----------------------------------------------------------------------
AMPA_MYCMM      ----------------------------------------------------------------------
AMPA_MYCBT      ----------------------------------------------------------------------
AMPA_MYCBP      ----------------------------------------------------------------------
AMPA_MYCBO      ----------------------------------------------------------------------
AMPL_SOLTU      ----------------------------------------------------------------------
AMPA_NOCFA      ----------------------------------------------------------------------
AMPA_HALHL      ----------------------------------------------------------------------
AMPL2_SOLLC     ----------------------------------------------------------------------
AMPA_MYCSJ      ----------------------------------------------------------------------
AMPA_SYNE7      ----------------------------------------------------------------------
YA55_SCHPO      ----------------------------------------------------------------------
AMPA_SYNP6      ----------------------------------------------------------------------
PEPB_VIBPA      ----------------------------------------------------------------------
PEPB_VIBSL      ----------------------------------------------------------------------
AMPA_BACCN      ----------------------------------------------------------------------
PEPB_VIBHB      ----------------------------------------------------------------------
AMPA_CHRSD      ----------------------------------------------------------------------
PEPB_VIBVY      ----------------------------------------------------------------------
PEPB_VIBVU      ----------------------------------------------------------------------
PEPB_ENTS8      ----------------------------------------------------------------------
AMPL1_ORYSJ     ----------------------------------------------------------------------
AMPA_CLAM3      ----------------------------------------------------------------------
PEPB_HAEIN      ----------------------------------------------------------------------
AMPA_MYCGE      ----------------------------------------------------------------------
PEPB_VIBCH      ----------------------------------------------------------------------
PEPB_HAEI8      ----------------------------------------------------------------------
AMPA_STACT      ----------------------------------------------------------------------
PEPB_PASMU      ----------------------------------------------------------------------
AMPA_SYMTH      ----------------------------------------------------------------------
AMPA_MICLC      ----------------------------------------------------------------------
AMPA_PROAC      ----------------------------------------------------------------------
PEPB_SALTI      ----------------------------------------------------------------------
PEPB_PHOLL      ----------------------------------------------------------------------
PEPB_ENT38      ----------------------------------------------------------------------
PEPB_PECCP      ----------------------------------------------------------------------
PEPB_ERWCT      ----------------------------------------------------------------------
PEPB_KLEP7      ----------------------------------------------------------------------
PEPB_ESCF3      ----------------------------------------------------------------------
PEPB_SHIFL      ----------------------------------------------------------------------
PEPB_ECO5E      ----------------------------------------------------------------------
PEPB_ECO57      ----------------------------------------------------------------------
PEPB_SHISS      ----------------------------------------------------------------------
PEPB_SHIF8      ----------------------------------------------------------------------
PEPB_SHIDS      ----------------------------------------------------------------------
PEPB_ECOSE      ----------------------------------------------------------------------
PEPB_ECO8A      ----------------------------------------------------------------------
PEPB_ECO55      ----------------------------------------------------------------------
PEPB_ECO24      ----------------------------------------------------------------------
PEPB_ECOUT      ----------------------------------------------------------------------
PEPB_ECOLI      ----------------------------------------------------------------------
PEPB_ECOLC      ----------------------------------------------------------------------
PEPB_ECOL6      ----------------------------------------------------------------------
PEPB_ECOL5      ----------------------------------------------------------------------
PEPB_ECOK1      ----------------------------------------------------------------------
PEPB_ECOHS      ----------------------------------------------------------------------
PEPB_ECODH      ----------------------------------------------------------------------
PEPB_ECOBW      ----------------------------------------------------------------------
PEPB_ECO81      ----------------------------------------------------------------------
PEPB_ECO45      ----------------------------------------------------------------------
PEPB_ECO27      ----------------------------------------------------------------------
PEPB_ECOSM      ----------------------------------------------------------------------
PEPB_ECOLU      ----------------------------------------------------------------------
PEPB_SHIBS      ----------------------------------------------------------------------
PEPB_SHIB3      ----------------------------------------------------------------------
PEPB_KLEP3      ----------------------------------------------------------------------
PEPB_CITK8      ----------------------------------------------------------------------
PEPB_SALAR      ----------------------------------------------------------------------
PEPB_SALTY      ----------------------------------------------------------------------
PEPB_SALPC      ----------------------------------------------------------------------
PEPB_SALPB      ----------------------------------------------------------------------
PEPB_SALNS      ----------------------------------------------------------------------
PEPB_SALG2      ----------------------------------------------------------------------
PEPB_SALEP      ----------------------------------------------------------------------
PEPB_SALDC      ----------------------------------------------------------------------
PEPB_SALA4      ----------------------------------------------------------------------
PEPB_SERP5      ----------------------------------------------------------------------
PEPB_SALCH      ----------------------------------------------------------------------
PEPB_YERPY      ----------------------------------------------------------------------
PEPB_YERPS      ----------------------------------------------------------------------
PEPB_YERPP      ----------------------------------------------------------------------
PEPB_YERPN      ----------------------------------------------------------------------
PEPB_YERPG      ----------------------------------------------------------------------
PEPB_YERPE      ----------------------------------------------------------------------
PEPB_YERPB      ----------------------------------------------------------------------
PEPB_YERPA      ----------------------------------------------------------------------
PEPB_YERP3      ----------------------------------------------------------------------
PEPB_ECO7I      ----------------------------------------------------------------------
AMPL_CAEEL      ----------------------------------------------------------------------
PEPL1_PONAB     ----------------------------------------------------------------------
PEPL1_HUMAN     ----------------------------------------------------------------------
PEPL1_MOUSE     ----------------------------------------------------------------------
YH24_CAEEL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxENLGAKFHSYINNDKKKEYFVNSDTINNKIKNFVGYFLHGLKLKSYEFNIYKSKKNKE
AMPA_EHRRG      --------------VGGVIYSELNRMKVPDASIVINTDSNVSAN-IGY---GALLRSFKFDKYVEKKDKN
AMPA_EHRRW      --------------VGGVIYSELNRMKIPDASIVINTDSNVSAN-IGY---GALLRSFKFDKYVEKKDKN
AMPA_MESSB      ---------------------------------------------------GILLRSYVFDKYKTRRDEN
AMPA_XANP2      ---------------------------------------------------GIRLRTYSFDRYKTKKKDD
AMPA_BRASB      ---------------------------------------------------GIRLRAYRFDRYKTKKKDE
AMPA_PHYAS      ----------------------LNKANKVVVFADALGIENQTSQ-VMHFALGLLLRSYSFKHYHTQKNEK
AMPA_BRAJA      ---------------------------------------------------GLRLRAYKFDRYKTKKKDS
AMPA_RHISN      ------------------------------------------------FALGMEMNAYAFDSYKTRKSQK
AMPA_OCHA4      ---------------------------------------------------GMILRSYKFERYKTRKNNE
AMPA_RHOPT      ---------------------------------------------------GIRLRAYKFDRYKTKKKDD
AMPA_RHOPA      ---------------------------------------------------GIRLRAYKFDRYKTKKKDD
AMPA_RHIME      ------------------------------------------------FALGMEMNAYGFESYKTRKSQK
AMPA_NITWN      ---------------------------------------------------GIRLRAYKFDRYKTRKKEG
AMPA_RHILW      ------------------------------------------------FALGMLLRTYSFDTYKTKKNDD
AMPA_RHIEC      ---------------GGAAASKVKNTDKVAIFIDVPGLETDARAAADFAL-GMLLRAYSFDAYKTKKNDD
AMPA_RHIL3      ---------------GGAAASRIKNTDKAAVFIDVPGLTTSPRAAADFAL-GMLLRAYSFDTYKTKKGDE
AMPA_SINMW      ------------------------------------------------FALGMEMNAYSFESYKTRKSKT
AMPA_OLICO      ----------------------------------------------------------------------
AMPA_AGRT5      ------------------------------------------------FALGLLLRAYSFDAYXXXXXXX
AMPA_RHIE6      ---------------GGAAASKIKNTDRAAVFLDVPGLTTDARAAADFAL-GMLLRAYSFDSYKTKKNDD
AMPA_RHOPB      ---------------------------------------------------------YKFDRYKTKKKDE
AMPA_WOLPM      ----------------------------------------------------------------------
AMPA_RHOP5      ---------------------------------------------------------YKFDRYKTKKKDD
AMPA_RHOP2      ---------------------------------------------------GILLRAYKFDRYKTKKKDD
AMPA_RHOPS      ----------------------------------------------------------------------
AMPA_AGRRK      ----------------------------------------------------------------------
AMPA_RHILO      ----------------------------------------------------------------------
AMPA_NITHX      ---------------------------------------------------GIRLRAYKFDRYKTRKKDD
AMPA_RICBR      ------------EELGGKILQNVTNAKIATIGLK---IKNRISNFTSSHVXXXXXXXXXXXXYRFDKYRT
AMPA_RICB8      ------------EELGGKILQNVTNAKIATIGLK---IKNRISNFTSSHVXXXXXXXXXXXXYRFDKYRT
AMPA_CAUCR      ----------------------------------------------------------------------
AMPA_PHYMT      -----------------------NYPKKVVVFADADVSTTQIMNFV----LGALLKQYSFECYYTDXXXX
AMPA_GLUOX      ---------------------------------------------------GARLASYDFDVYRTKKSES
AMPA_RICCK      ------------EELGGKILQYATSAK-------ISTISLKIINRISRFTSGAFLASYRFDKYRTNLKEA
AMPA_BRUME      ---------------------------------------------------GMVLRSYKFDRYKTRKSEE
AMPA_AGRVS      ----------------------------------------------------------------------
AMPA_BRUO2      ---------------------------------------------------GMVLRSYKFDRYKTRKSEE
AMPA_BRUSU      ---------------------------------------------------GMVLRSYKFDRYKTRKSEE
AMPA_RICFE      ------------------------------------------QTFASLVASGAFLASYRFNKYRTTKEAE
AMPA_RICM5      ------------------------------------------QTFASLVASGAFLASYRFDKYRTTKEAE
AMPA_RICPR      --------------------------------------------FTSLIASGAFLASYRFHKYKTTLKEV
AMPA_RICPU      ------------------------------------------QTFASLVASGAFLASYRFDKYRTTKEAE
AMPA_RICCN      ------------------------------------------QTFASLVASGAFLASYRFDKYRTTKEAE
AMPA_RICAE      ------------------------------------------QTFASLVASGAFLASYRFDKYRTTKEAE
AMPA_RICRS      ------------------------------------------QTFASLVASGAFLASYRFDKYRTTKEAE
AMPA_RICRO      ------------------------------------------QTFASLVASGAFLASYRFDKYRTTKEAE
AMPA_METPB      ---------------------------------------------VADFTLGARLRSYRFDQYKTKKKDE
AMPA_DINSH      ---------------------------------------------------GAALRAYRFDARKSKSEDA
AMPA_METEP      ---------------------------------------------VADFTLGARLRSYRFDQYKTKKKDE
AMPA_RHOS5      ---------------------------------------------------GIALRAYDFTPHKTGEKTV
AMPA_RICTY      ------------------------------------------QTFTSLIASGAFLASYRFHKYKTTLKEV
AMPA_METC4      ---------------------------------------------VADFTLGARLRSYRFDQYKTKKKDE
AMPA_METRJ      ----------------------------------------------GEFALGARLRTYAFDRYKTKKDKS
AMPA_PSEPW      ---------------------------------------------------------YVFDRFKSQKAEP
AMPA_PSEU5      ---------------------------------------------------------YVFDQFKSKKAEP
AMPA_PSEFS      ---------------------------------------------------------YIFDEFKSQKAKK
AMPA1_SHEON     ---------------------------------------NNAPLFGSELAHGIELRSYRYTQFKSNRVEK
AMPA_PSEPF      ---------------------------------------------------------YTFDQFKSQKAEP
AMPA_CHLL2      ----------------------------------------------------------------------
AMPA_PELCD      ---------------------------------------------VQVLVEGLLLASYRFDRFLTQKRED
AMPA_PSESM      ------------------------------------------------FVEALADGEYVFDRFKTQKAEV
AMPA_THISH      ---------------------------------------------------------YSFQQLKSKKEDK
AMPA_SACD2      --------------------------------------------------------SYRFSLKAGTKNTP
AMPA_PSEPG      ---------------------------------------------------------YVFDRFKSQKKKV
AMPA_CLOPE      --------------------------KSKSVFLRFDSVEAGLENTLKAMVEGLALGSYSFNKYKSDKKEE
AMPA_PSEPK      ---------------------------------------------------------YVFDRFKSQKKKV
AMPA_PSEA7      ----------------------------------------------------------------------
AMPA_PSEU2      ---------------------------------------------------------YVFDRFKTQKAEV
AMPA_PSEAE      ----------------------------------------------------------------------
AMPA_PSEA8      ----------------------------------------------------------------------
AMPA_PSEP1      ---------------------------------------------------------YVFDRFKSQKKKV
AMPA_CLOTE      --------------------------------------NLKYESIVQSITEGLLQSEYSFEKYLTKKSIK
AMPA_CLOPS      --------------------------KSKSVFLRFDSVEAGLENTLKAMVEGLALGSYSFNKYKSDKKEE
AMPA_PSEPU      ---------------------------------------------------------YVFDRFKSQKKKV
AMPA_METFK      --------------------------------------------------------TYRFDRFKSKKGIA
AMPA_PSEAB      ----------------------------------------------------------------------
AMPA_FUSNN      --------------------------------------------------------NYKFDKYFSKKKEE
AMPA_ALHEH      ----------------------------------------------------------------------
AMPA_PSEE4      ---------------------------------------------------------YVFDRYKSQKAEP
AMPA_CENSY      -------------------------------------------------VEGAELALYSFDEFKAEKAGN
AMPA_ACISJ      --------------------------------------------------------SYVYTATKTKAEPR
AMPA_LEGPC      ---------------------------------------------------------YQLLDFKTKHAKS
AMPA_DIAST      ---------------------------------------------IGAAVRAVSDGSYVYTATKTKAEPR
AMPA_DECAR      --------------------------------------------------------TYKFDQFKSKKEER
AMPA_LEGPL      ---------------------------------------------------------YQLLDFKTKHAKS
AMPA_ALCBS      --------------------------------------------------------TYRFDNYRSKPAPA
AMPA_VESOH      -----------------------------------------IKGFNELWVHEITAKTYKVQKVGNYKKQN
AMPA_ACIAD      ------------------------------------------------FALNLTQANYVFDEFKSKKSEA
AMPA_RALEJ      -----------------------------------------------------------------KATLR
AMPA_BURP8      ----------------------------------------------------LRELTYKFTQMKSKPDTS
AMPA_SHEDO      ----------------------------------------------------------------------
AMPA_LEGPA      ---------------------------------------------------------YQLLDFKTKHAKS
AMPA_AZOVD      --------------------------------------------------------TYAFDRFKSEKASA
AMPA_GEOSM      ---------------------------------------------------GSLLGSYSFDLYKTKDKEQ
AMPA_ACIBY      ------------------------------------------------FALSLTQAAYGYDEFKSKKN-E
AMPA_ACIBT      ------------------------------------------------FALSLTQAAYGYDEFKSKKN-E
AMPA_ACIBC      ------------------------------------------------FALSLTQAAYGYDEFKSKKN-E
AMPA_ACIB5      ------------------------------------------------FALSLTQAAYGYDEFKSKKN-E
AMPA_ACIB3      ------------------------------------------------FALSLTQAAYGYDEFKSKKN-E
AMPA_TERTT      ----------------------------------------------------------------------
AMPA_BURP1      ----------------------------------------------------------------------
AMPA2_SHEON     ----------------------------------------------------------------------
AMPA_BURPS      ----------------------------------------------------------------------
AMPA_BURP6      ----------------------------------------------------------------------
AMPA_BURP0      ----------------------------------------------------------------------
AMPA_BURMS      ----------------------------------------------------------------------
AMPA_BURMA      ----------------------------------------------------------------------
AMPA_BURM9      ----------------------------------------------------------------------
AMPA_BURM7      ----------------------------------------------------------------------
AMPA_HAES2      -------------------------------FLNEIELKNRDIHWIRFAIETIEASHYQFDTFKSKKTDA
AMPA_CHLT3      ----------------------------------SETANDSVDYIAQTAVEGFHSGLYDFNQLKTNRVKE
AMPA_AZOSE      ----------------------------------------------------------------------
AMPA_SHEFN      ----------------------------------------------------------------------
AMPA_NITEU      ----------------------------------------------------------------------
AMPA_CHRVO      ---------------------------------------------------------YRFDRFKSKQDES
AMPA_ALKOO      -------------------------------------------------MEGADLAAYKFDKYKTTDRQE
AMPA_ACIBS      ------------------------------------------------FALSLTQAAYGYDEFKSTKN-E
AMPA_NITEC      ---------------------------------------------------------YRFDRLKSKREER
AMPA_BURTA      ----------------------------------------------------------------------
AMPA_SHEPW      ----------------------------------------------------------------------
AMPA_BURM1      ----------------------------------------------------------------------
AMPA_BURXL      ----------------------------------------------------------------------
AMPA_RALME      -----------------------------------------------------------------KASLR
AMPA_HAES1      -------------------------------FLNEIELKNRDIHWIRFAIETIEASFYQFDAFKTKKGDE
AMPA_CUPTR      -----------------------------------------------------------------KSSLR
AMPA_BURVG      ----------------------------------------------------LRNETYRFTQMKSKPEPA
AMPA_BURPP      ----------------------------------------------------------------------
AMPA_WIGBR      ----------------------------------------KIRRSIEYIYESL----YEFNNFKSKTKSY
AMPA_JANMA      ----------------------------------------------------------------------
AMPA_HAEIN      ---------------------------------------------IRFAIETIEHTNYQFDHFKSQKAET
AMPA_HAEIE      ---------------------------------------------IRFAIETIEHTNYQFDHFKSQKAET
AMPA_HAEI8      ---------------------------------------------IRFAIETIEHTNYQFDHFKSQKAET
AMPA_SHELP      ----------------------------------------------------------------------
AMPA_RALEH      -----------------------------------------------------------------KSSLR
AMPA_PARUW      --------------------------------------------FIKAITEGLLLPNYVYDRLKSKQEED
AMPA_MANSM      ---------------------------------------------VRFAVETIEEDNYIFEQFKSKKSEN
AMPA_CHLP8      ----------------------------------------------------------------------
AMPA_RHOFD      --------------------------------------------------------SYVFTTTKSKPEGR
AMPA_SHESH      ----------------------------------------------------------------------
AMPA_HAEIG      ---------------------------------------------IRFAIETIEHTNYQFDHFKSQKAET
AMPA_ACTSZ      ---------------------------------------------IRFGLETIAAESYIFDEFKSKKADP
AMPA_COLP3      ----------------------------------------------------------------------
AMPA_GEOSL      ---------------------------------------------------GLSLGDYSFDIYKTKPGTT
AMPA_IDILO      ---------------------------------------------------------YNFNELKSKKEER
AMPA_PERMH      -------------------------------------------------VEGVILGNYRFDKYLSKKDEY
AMPA_HAEDU      ---------------------------------------------IRFAIESIQASRYVYDVFKSIKAKV
AMPA_PSYIN      -----------------------------------------------------------YNFDKFKTNKE
AMPA_RALPJ      ----------------------------------------------------------------------
AMPA_HAHCH      ----------------------------------------------------LESACYTFDNMKSEKATP
AMPA_PSEA6      ----------------------------------------------------------------------
AMPA_THICR      ----------------------------------------------------------------------
AMPA_PHOPR      ---------------------------------------------------------YTFNQFKSNKPET
AMPA_PELLD      ----------------------------------------------------------------------
AMPA_CHLPN      ---------------------------------------------------GILSLNYDYPRYKVDRNLE
AMPA_PROMH      ----------------------------------------------------------------------
AMPA_CHLTE      ----------------------------------------------------------------------
AMPA_XANCP      ----------------------------------------------------------------------
AMPA_XANCB      ----------------------------------------------------------------------
AMPA_XANC8      ----------------------------------------------------------------------
AMPA_SERP5      ----------------------------------------------------------------------
AMPA_HERAR      ----------------------------------------------------------------------
AMPA_BURCM      ----------------------------------------------------------------------
AMPA_BURA4      ----------------------------------------------------------------------
AMPA_XANOR      ----------------------------------------------------------------------
AMPA_XANOP      ----------------------------------------------------------------------
AMPA_XANOM      ----------------------------------------------------------------------
AMPA_TOLAT      ----------------------------------------------------------------------
AMPA_RHOBA      ----------------------------------------------------------------------
AMPA_BURS3      ----------------------------------------------------LRNETYRFTQMKSKPEPA
AMPA_XANC5      ----------------------------------------------------------------------
AMPA_RALSO      ----------------------------------------------------------------------
AMPL_ENCCU      ---------------GASAYKCVSQFKNMEMSLTSEYMAREV-------VSGIMLASYKYRFLHKEKDEP
AMPA_PASMU      ---------------------------------------------IRFSVETLETSIYQFEQFKSKKSEQ
AMPA_EDWI9      ----------------------------------------------------------------------
AMPA_BUCAP      -----------------------------------------IVNSINKYLY----KNFKINAFLKKEYLN
AMPA_XANAC      ----------------------------------------------------------------------
AMPA_AERHH      ----------------------------------------------------------------------
AMPA_LEPIN      ----------------------------------------------------------------------
AMPA_LEPIC      ----------------------------------------------------------------------
AMPA_BUCAT      ----------------------------------------------------------------------
AMPA_AERS4      ----------------------------------------------------------------------
AMPA_BURCH      ----------------------------------------------------------------------
AMPA_BURCA      ----------------------------------------------------------------------
AMPA_BUCAI      ----------------------------------------------------------------------
AMPA_BUCA5      ----------------------------------------------------------------------
AMPA_ACTP7      ---------------------------------------------VRFAIEAIQESLYSYNDFKSIKPER
AMPA_ERWT9      ----------------------------------------------------------------------
AMPA_ACTPJ      ---------------------------------------------VRFAIEAIQESLYSYNDFKSIKPER
AMPA_DESVH      ----------------------------------------------------------------------
AMPA_METCA      ----------------------------------------------------------------------
AMPA_AZOSB      ----------------------------------------------------------------------
AMPA_BURCJ      ----------------------------------------------------------------------
AMPA_BURCC      ----------------------------------------------------------------------
AMPA_XYLFM      ----------------------------------------------------------------------
AMPA_XYLFA      ----------------------------------------------------------------------
AMPA_SYNPW      ----------------------------------------------------------------------
AMPA_SODGM      ----------------------------------------------------------------------
AMPA_ERWCT      ----------------------------------------------------------------------
AMPA_PECCP      ----------------------------------------------------------------------
AMPA_BORA1      --------------------------------------------------------TYHYDATFGKPDRE
AMPA_VIBHB      ----------------------------------------------------------------------
AMPA_GEOTN      --------------------------------------------------------TYEFPGYKQKKSEP
AMPA_XYLFT      ----------------------------------------------------------------------
AMPA_XYLF2      ----------------------------------------------------------------------
AMPA_NITOC      ----------------------------------------------------------------------
AMPA_SULSY      --------------------------KAKELKLSDIIIDTNLQQFENYITEGLILGDYSFDKYFSKKDEK
AMPA_CORDI      -------------------------------------------------VEGFALGAYNYTGVRSKQKKE
AMPA_BUCBP      ----------------------------------------------------------------------
AMPA_VEREI      --------------------------------------------------------SYVYTTTKSKAEAR
AMPA_VARPS      ----------------------------------------------------------------------
AMPA_BAUCH      ----------------------------------------------------------------------
AMPA_VIBPA      ---------------------------------------------------------YTFNQFKSVKPET
AMPA_SALAR      ----------------------------------------------------------------------
AMPA_SALTY      ----------------------------------------------------------------------
AMPA_SALSV      ----------------------------------------------------------------------
AMPA_SALPK      ----------------------------------------------------------------------
AMPA_SALPC      ----------------------------------------------------------------------
AMPA_SALPB      ----------------------------------------------------------------------
AMPA_SALPA      ----------------------------------------------------------------------
AMPA_SALNS      ----------------------------------------------------------------------
AMPA_SALHS      ----------------------------------------------------------------------
AMPA_SALG2      ----------------------------------------------------------------------
AMPA_SALEP      ----------------------------------------------------------------------
AMPA_SALDC      ----------------------------------------------------------------------
AMPA_SALCH      ----------------------------------------------------------------------
AMPA_SALA4      ----------------------------------------------------------------------
AMPA_VIBVY      ----------------------------------------------------------------------
AMPA_VIBVU      ----------------------------------------------------------------------
AMPA_GEOSW      ------------------------------------------------------LATYEFPGYKQKKNEE
AMPA_CHLMU      -----------------------------------------VEEFLTNLAAGVLSLNYNYPTYHKVDASL
AMPA_ACTP2      ---------------------------------------------VRFAIEAIQESLYSYNDFKSIKPER
AMPA_SALTI      ----------------------------------------------------------------------
AMPA_EXIS2      ------------------------------------------------------LSTYEVKHYKTNTRAT
AMPA_CHLCV      -----------------------------------------IEDFLTNLTSGILSLNYNYPKYTKESSND
AMPA_SHISS      ----------------------------------------------------------------------
AMPA_SHIFL      ----------------------------------------------------------------------
AMPA_SHIF8      ----------------------------------------------------------------------
AMPA_SHIBS      ----------------------------------------------------------------------
AMPA_SHIB3      ----------------------------------------------------------------------
AMPA_ESCF3      ----------------------------------------------------------------------
AMPA_ENT38      ----------------------------------------------------------------------
AMPA_ECOUT      ----------------------------------------------------------------------
AMPA_ECOSM      ----------------------------------------------------------------------
AMPA_ECOSE      ----------------------------------------------------------------------
AMPA_ECOLU      ----------------------------------------------------------------------
AMPA_ECOLI      ----------------------------------------------------------------------
AMPA_ECOLC      ----------------------------------------------------------------------
AMPA_ECOL6      ----------------------------------------------------------------------
AMPA_ECOL5      ----------------------------------------------------------------------
AMPA_ECOK1      ----------------------------------------------------------------------
AMPA_ECOHS      ----------------------------------------------------------------------
AMPA_ECODH      ----------------------------------------------------------------------
AMPA_ECOBW      ----------------------------------------------------------------------
AMPA_ECO8A      ----------------------------------------------------------------------
AMPA_ECO81      ----------------------------------------------------------------------
AMPA_ECO7I      ----------------------------------------------------------------------
AMPA_ECO5E      ----------------------------------------------------------------------
AMPA_ECO57      ----------------------------------------------------------------------
AMPA_ECO55      ----------------------------------------------------------------------
AMPA_ECO45      ----------------------------------------------------------------------
AMPA_ECO27      ----------------------------------------------------------------------
AMPA_ECO24      ----------------------------------------------------------------------
AMPA_CITK8      ----------------------------------------------------------------------
AMPA_SHIDS      ----------------------------------------------------------------------
AMPA_KLEP7      ----------------------------------------------------------------------
AMPA_DESAH      -------------------------------------------------VEGICLGDYRFVRYKQPESKE
AMPA_AQUAE      ---------------------------------------------------GAILGNYRFDKYKSKKEDE
AMPA_YERPY      ----------------------------------------------------------------------
AMPA_YERPS      ----------------------------------------------------------------------
AMPA_YERPP      ----------------------------------------------------------------------
AMPA_YERPN      ----------------------------------------------------------------------
AMPA_YERPG      ----------------------------------------------------------------------
AMPA_YERPE      ----------------------------------------------------------------------
AMPA_YERPB      ----------------------------------------------------------------------
AMPA_YERPA      ----------------------------------------------------------------------
AMPA_YERP3      ----------------------------------------------------------------------
AMPA_KLEP3      ----------------------------------------------------------------------
AMPA_METPP      ----------------------------------------------------------------------
AMPA_VIBCM      ----------------------------------------------------------------------
AMPA_VIBCH      ----------------------------------------------------------------------
AMPA_VIBC3      ----------------------------------------------------------------------
AMPA_HAMD5      ----------------------------------------------------------------------
AMPA_GEOUR      -------------------------------------------------VEGFALGSYSFDEYKTGKEPK
AMPA_BDEBA      ---------------------------------------------------GLILTSYVFNELMSGK-KE
AMPA_YERE8      ----------------------------------------------------------------------
AMPA_CHLAB      -----------------------------------------VEDFLTNLTSGILSLNYNYPKYTKEAKKT
AMPA_BACCR      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACC2      ------------------------------------------------------LGTYELQTYKSDKKEE
AMPA_TRIEI      ---------------------------------------------------GIELALHQDNRFKSEPEND
AMPA_BACC4      ------------------------------------------------------LGTYELQTYKSDKKDE
AMPA_ALISL      ---------------------------------------------------------YTFNQFKSNKPET
AMPA_PROMA      ----------------------------------------------------------------------
AMPA_HAEPS      ---------------------------------------------IRFAIEAIQENGYQYNEFKSVKPER
AMPA_BACSU      ----------------------IHKDRKQETAVLLDTFISEDADAAHALAESCLLASYEVQDYKHKSNKQ
AMPA_CHLPD      ----------------------------------------------------------------------
AMPA_BACP2      ----------------------LHQDKKQAVSVLLDTFIGKAQDAAHTLSESCLLATYELQDFKHKTNEP
AMPA_PROM4      ----------------------------------------------------------------------
AMPA_CYAP8      -------------------------EKVKTLGINLPVVNNDGAKTASAIAEGILLALHQDNRFKSDPQEN
AMPA_GLOVI      ----------------------------------------------------------------------
AMPA_BLOFL      ---------------------------------------------------------YIFNKFKNKKNIT
AMPA_VIBFM      ---------------------------------------------------------YTFNQFKSNKPET
AMPA_CHLFF      ------------------------------------------EDFLSNLTSGILSLNYNYPKYKECQSSE
AMPA_CORGL      ----------------------------------------------------------------------
AMPA_VIBF1      ---------------------------------------------------------YTFNQFKSNKPET
AMPA_SYNS3      ----------------------------------------------------------------------
AMPA_ACIBL      ---------------------------------------------------GAVVANPDYNYYHSDRDEL
AMPA_NITMU      ----------------------------------------------------------------------
AMPL1_ARATH     ---------------------------------------------------GIVLGLFEDGRYKSESKKP
AMPA_PHOLL      ----------------------------------------------------------------------
AMPA_SYNPX      ----------------------------------------------------------------------
AMPA_PROM9      ----------------------------------------------------------------------
AMPA_ANAVT      ---------------------------------------------------GVQLALYQDNRFKSDPDDE
AMPA_CHLTR      -----------------------------------------VEEFLTNLAAGVLSLNYNYPTYHKVDTSL
AMPA_POLSJ      ----------------------LKNGNTQRVVVSLAAMNNAQPEIVRAAVVACSEAAYVYSTTKSKVSPV
AMPA_DESDA      ----------------------------------------------------------------------
AMPA_CHLTB      -----------------------------------------VEEFLTNLAAGVLSLNYNYPTYHKVDTSL
AMPA_CHLT2      -----------------------------------------VEEFLTNLAAGVLSLNYNYPTYHKVDTSL
AMPL_BOVIN      ---------------------------------------------------GAVLGLYEYDDLKQKR-KV
AMPA_TREDE      ----------------------------------------KLNNLCNYIAEGMLHATYKYDKFKSDRKEQ
AMPA_CHLTA      -----------------------------------------VEEFLTNLAAGVLSLNYNYPTYHKVDTSL
AMPL3_ARATH     ---------------------------------------------------GTVLGLFEDSRYKSESKKP
AMPA_ACAM1      ----------------------------------------------------------------------
AMPL_HUMAN      ---------------------------------------------------GAVLGLYEYDDLKQKK-KM
AMPA_COREF      ----------------------------------------------------------------------
AMPA_ACIF5      ----------------------------------------------------------------------
AMPA_ACIF2      ----------------------------------------------------------------------
AMPA_PROMP      ------------------------------------------------FGESARLSAYKDNRFNSKRDDK
AMPA_PROM0      ----------------------------------------------------------------------
AMPA_ANASP      ---------------------------------------------------GLQLALYQDNRFKSDPEDE
AMPA_THEEB      ----------------------------------------------------------------------
AMPA_SYNR3      ----------------------------------------------------------------------
AMPA_ROSCS      ----------------------------------------------------------------------
AMPA_STRM5      ----------------------------------------------------------------------
AMPA_BORPE      ----------------------------------------------------------------------
AMPA_BORPA      ----------------------------------------------------------------------
AMPA_BORBR      ----------------------------------------------------------------------
AMPA_PROMS      ----------------------------------------------------------------------
AMPL_RAT        ---------------------------------------------------GAVLGLYEYDDLKQKK-KV
AMPA_STRMK      ----------------------------------------------------------------------
AMPA_SYNJB      ----------------------------------------------------------------------
AMPA_BACA2      ----------------ARVFQQVHQDKKQEVSVLLDTVSGEVP--AADAAHALSLAVYEVQDYKHKSNEE
AMPA_BORPD      ----------------------------------------------------------------------
AMPL_MOUSE      ---------------------------------------------------GAVLGLYEYDDLKQKK-KV
AMPA_STRGG      ----------------------------------------------------------------------
AMPL2_ARATH     ---------------------------------------------------GTVLGLFEDSRYKSESKKK
AMPA_WOLSU      ---------------------------------------------------GFLLGDYNFETYKSQKS-E
AMPA_CYAP4      ----------------------------------------------------------------------
AMPL2_ORYSJ     ---------------------------------------------------GTVLGLHEDSRYKSESKKV
AMPA_MICAN      ----------------------------------------------GAITEGLLLATHQDTRFKSTKEEE
AMPA_POLNA      ----------------------------------------------------------------------
AMPA_ACIC5      --------------------------------------------------HGAAVADFDPDFYRSRKDKS
AMPA_SYNSC      ----------------------------------------------------------------------
AMPA_SYNS9      ----------------------------------------------------------------------
AMPA_SYNP2      ---------------------------------------------------GMYLGFYEDNRFKSEQKDP
AMPA_CYAP7      --------------------------KIKTLGISLPVFNNAPTLTTGAIVEGVLLALHTDLRFKSEPEDE
AMPA_CYAA5      -------------------------EKVKTLAIQFPVVDNDAAQTTAAIAEGMILSLHQDNRFKSEPEDE
AMPA_BACC7      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_DESDG      ----------------------------------------------------------------------
AMPA_BACCZ      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACCQ      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACC1      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_PROMM      ----------------------------------------------------------------------
AMPA_BACHK      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACLD      ----------------------IHKDRKQELTVMLDSFVSEAADAAHALAESCMLSCYEVQDYKHRSNVP
AMPA_BACC3      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACC0      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACAN      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACAH      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACAC      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_BACAA      ------------------------------------------------------LGTYELQTYKSDKKDR
AMPA_HELAH      --------------------------------------NALLENLKALFL-GLKLGMYEYDTFKSNK-KE
AMPA_RHOSR      ----------------------------------------------------------------------
AMPA_TROWT      ------------------------------------------KDKLSAIVEGAFLGAYRFDKYRSKKSEC
AMPA_TROW8      ------------------------------------------KDKLSAIVEGAFLGAYRFDKYRSKKSEC
AMPA_NEIMA      ---------------------------------------------------------YRFDRYXXXXXXX
AMPA_SYNY3      ----------------------------------------------------------------------
AMPA_RHOOB      ----------------------------------------------------------------------
AMPA_SYNJA      ----------------------------------------------------------------------
AMPL_DICDI      ----------------------------------------------------------------------
AMPA_BACWK      ------------------------------------------------------LGTYELQTYKADKKDR
AMPA_MYCSA      -----------------------------------------IKGVVDAFTKGINFSAFQYYNLKTKRVNE
AMPA_SOLUE      -------------------------------------------NFASAAVEGALLGNFEPDRYKTGNEKK
AMPA_STRAW      ----------------------------------------------------------------------
AMPA_RHOE4      ----------------------------------------------------------------------
AMPA_PROM2      ----------------------------------------------------------------------
AMPL1_SOLLC     ---------------------------------------------------GVVLGSFEDNRFRSESKKS
AMPA_HELHP      ---------------------------------------------------------YECVSYKTKTPKE
AMPA_NOSP7      ---------------------------------------------------GVELALYQDIRFKSEPEDE
AMPA_MYCLE      -------------------------------------------------VEGLMLGSYRFTDFRSRKTKI
AMPA_MYCPN      ----------------------------------------------------------------------
AMPL_XENTR      ----------------------------------------------------------------------
AMPA_STRCO      ----------------------------------------------------------------------
AMPA_HELPG      --------------------------------------------------------------FKSNK-KE
AMPA_ALKMQ      ---------------------------------------------------GTKLGLYQFNHYKTKEQEE
AMPA_MYCPA      -------------------------------------------------VEGLILGSYRFTEFRSAKDKG
AMPA_HELPJ      ----------------------------------------------------------------------
AMPA_HELPH      ----------------------------------------------------------------------
AMPA_HELPS      --------------------------------------------------------------FKSNK-KE
AMPA_HELPY      --------------------------------------------------------------FKSNK-KE
AMPA_DESPS      -------------------------------------------------VEGVLLGDYRFLKYMSKKDAK
AMPA_AERPE      ------------------------------YLVGLDTVSSTEA------VIGALLGAYRLEEFKNTRKRK
AMPA_SYNFM      ----------------------------------------------------------------------
AMPA_HELP2      ----------------------------------------------------------------------
AMPA_MYCUA      -------------------------------------------------VEGLILGSYRFSAFRSAKTKD
AMPA_MYCTU      -------------------------------------------------VEGLILGSYRFSAFRSDKTKI
AMPA_MYCTA      -------------------------------------------------VEGLILGSYRFSAFRSDKTKI
AMPA_MYCSS      -------------------------------------------------IEGLILGSYRFTEFRSAKTKD
AMPA_MYCSK      -------------------------------------------------IEGLILGSYRFTEFRSAKTKD
AMPA_CAMJE      -------------------------------------------------VEGVLFGAYKFDKYKSEKKTS
AMPA_LEIXX      ----------------------------------------------------------------------
AMPA_MYCMM      -------------------------------------------------IEGLILGSYRFSAFRSAKTKD
AMPA_MYCBT      -------------------------------------------------VEGLILGSYRFSAFRSDKTKI
AMPA_MYCBP      -------------------------------------------------VEGLILGSYRFSAFRSDKTKI
AMPA_MYCBO      -------------------------------------------------VEGLILGSYRFSAFRSDKTKI
AMPL_SOLTU      ---------------------------------------------------GVMLGIFEDNRFRSEKTPA
AMPA_NOCFA      ---------------------------------------------------GFYLGAYTFTPFRSAKSRP
AMPA_HALHL      ----------------------------------------------------------------------
AMPL2_SOLLC     ---------------------------------------------------GAVLGTFEDNRFKSESKKP
AMPA_MYCSJ      -------------------------------------------------IEGLILGSYRFTEFRSAKTKD
AMPA_SYNE7      ----------------------------------------------------------------------
YA55_SCHPO      ----------------------------------------------------------------------
AMPA_SYNP6      ----------------------------------------------------------------------
PEPB_VIBPA      ----------------------------------------------------------------------
PEPB_VIBSL      --------------------------------------------------------------YRGPKKKN
AMPA_BACCN      ------------------------------------------------------LGTYRLQTYKTDKKEH
PEPB_VIBHB      ----------------------------------------------------------------------
AMPA_CHRSD      ----------------------------------------------------------------------
PEPB_VIBVY      ----------------------------------------------------------------------
PEPB_VIBVU      ----------------------------------------------------------------------
PEPB_ENTS8      -------------------------------------------------------KSWAFWMYRGPKGKR
AMPL1_ORYSJ     ----------------------------------------------------------------------
AMPA_CLAM3      ----------------------------------------------------------------------
PEPB_HAEIN      ----------------------------------------------------------------------
AMPA_MYCGE      ---------------------------------------------------------------KPEKNVE
PEPB_VIBCH      ----------------------------------------------------------------------
PEPB_HAEI8      ----------------------------------------------------------------------
AMPA_STACT      ----------------------------------------------------------------------
PEPB_PASMU      ----------------------------------------------------------------------
AMPA_SYMTH      ----------------------------------------------------------------------
AMPA_MICLC      ----------------------------------------------------------------------
AMPA_PROAC      ----------------------------------------------------------------------
PEPB_SALTI      --------------------------------------------------------------YKGPKGVR
PEPB_PHOLL      ----------------------------------------------------------------------
PEPB_ENT38      ----------------------------------------------------------------------
PEPB_PECCP      --------------------------------------------------------------YRGPKGQR
PEPB_ERWCT      --------------------------------------------------------------YRGPKGQR
PEPB_KLEP7      ----------------------------------------------------------------------
PEPB_ESCF3      ----------------------------------------------------------------------
PEPB_SHIFL      ----------------------------------------------------------------------
PEPB_ECO5E      ----------------------------------------------------------------------
PEPB_ECO57      ----------------------------------------------------------------------
PEPB_SHISS      ----------------------------------------------------------------------
PEPB_SHIF8      ----------------------------------------------------------------------
PEPB_SHIDS      ----------------------------------------------------------------------
PEPB_ECOSE      ----------------------------------------------------------------------
PEPB_ECO8A      ----------------------------------------------------------------------
PEPB_ECO55      ----------------------------------------------------------------------
PEPB_ECO24      ----------------------------------------------------------------------
PEPB_ECOUT      ----------------------------------------------------------------------
PEPB_ECOLI      ----------------------------------------------------------------------
PEPB_ECOLC      ----------------------------------------------------------------------
PEPB_ECOL6      ----------------------------------------------------------------------
PEPB_ECOL5      ----------------------------------------------------------------------
PEPB_ECOK1      ----------------------------------------------------------------------
PEPB_ECOHS      ----------------------------------------------------------------------
PEPB_ECODH      ----------------------------------------------------------------------
PEPB_ECOBW      ----------------------------------------------------------------------
PEPB_ECO81      ----------------------------------------------------------------------
PEPB_ECO45      ----------------------------------------------------------------------
PEPB_ECO27      ----------------------------------------------------------------------
PEPB_ECOSM      ----------------------------------------------------------------------
PEPB_ECOLU      ----------------------------------------------------------------------
PEPB_SHIBS      ----------------------------------------------------------------------
PEPB_SHIB3      ----------------------------------------------------------------------
PEPB_KLEP3      ----------------------------------------------------------------------
PEPB_CITK8      ----------------------------------------------------------------------
PEPB_SALAR      --------------------------------------------------------------YKGPKGVR
PEPB_SALTY      --------------------------------------------------------------YKGPKGVR
PEPB_SALPC      --------------------------------------------------------------YKGPKGVR
PEPB_SALPB      --------------------------------------------------------------YKGPKGVR
PEPB_SALNS      --------------------------------------------------------------YKGPKGVR
PEPB_SALG2      --------------------------------------------------------------YKGPKGVR
PEPB_SALEP      --------------------------------------------------------------YKGPKGVR
PEPB_SALDC      --------------------------------------------------------------YKGPKGVR
PEPB_SALA4      --------------------------------------------------------------YKGPKGVR
PEPB_SERP5      ----------------------------------------------------------------------
PEPB_SALCH      --------------------------------------------------------------YKGPKGVR
PEPB_YERPY      ----------------------------------------------------------------------
PEPB_YERPS      ----------------------------------------------------------------------
PEPB_YERPP      ----------------------------------------------------------------------
PEPB_YERPN      ----------------------------------------------------------------------
PEPB_YERPG      ----------------------------------------------------------------------
PEPB_YERPE      ----------------------------------------------------------------------
PEPB_YERPB      ----------------------------------------------------------------------
PEPB_YERPA      ----------------------------------------------------------------------
PEPB_YERP3      ----------------------------------------------------------------------
PEPB_ECO7I      ----------------------------------------------------------------------
AMPL_CAEEL      ----------------------------------------------------------------------
PEPL1_PONAB     ----------------------------------------------------------------------
PEPL1_HUMAN     ----------------------------------------------------------------------
PEPL1_MOUSE     -----------------------------------------------------------------RAEKR
YH24_CAEEL      ---------------------------------------------------------------KQKLNQL


                         +         .         .         .         .         *         .:210
query           TVLINVIGNKNKISIQDHLRFKALEEGSFFARDLVSEPGNVLHPDEYAKRINTLKKFGLKINIYDEKKLK
AMPA_EHRRG      SVYLNVLFSKNDPQEVTALDLKAEGESIFLARSFVSEPPNILYPETYAQMIEELSKVGVTVEVFDEDYMK
AMPA_EHRRW      SVYLNKLVLFSKSEPQEVTALKAEGESIFLARSFVSEPPNILYPETYAQMIEELSKVGVTVEVFDEDYMK
AMPA_MESSB      ----GIKARDKKFTIQXXXXXXXLGDGVYLARDLVNEPANVLGPVEFAAQAKALESLGVKVDVLTEREMK
AMPA_XANP2      TLVSDEAGTKRAATTAD-----AVGDGVLFARDLVNEPANVLDPPEFARRAEELSSVGVEIEVLDDAGLA
AMPA_BRASB      EXXXXXXXXXXXXXXXXXXXXXXVTDGVILARDLVNEPPNVLYPEEFAKRASALRKLGVTVEILDVPAMK
AMPA_PHYAS      NLEITFITENAELCQKEFDDVKAILGGVNLTKELVNEPANILGTNEFVERTQQLQTLGVEVEVLNKETLE
AMPA_BRAJA      RADISLXXXXXXXXXXXXXXXXHVVDGVIIARDLVNEPPNVLFPEEFARRASLLRKLGVKVEVLDVKAMD
AMPA_RHISN      VVKVTIVTGMVIAAKKAFATVQSIGEGVFLARDLVNEPANVLGPVEFAARAKELEKLGVEVETLTEREMK
AMPA_OCHA4      ENGDPKHAAKISICVADHTAKRAFEDGVIQARNLVNEPANILGPVEFAQEAEKLEKLGVKIEVLGEKEMK
AMPA_RHOPT      NXXXXXXXXXXXXXXXXXXXXSHVVDGVILARELVNEPPNVLYPEEFAKRAAQLKKLGVEVQILDVKAMT
AMPA_RHOPA      NXXXXXXXXXXXXXXXXXXXXSHVVDGVILARELVNEPPNVLYPEEFAKRAAQLKKLGVEVQILDVKAMT
AMPA_RHIME      PVKVTIVTGTVIAAKKAFMTAQAVGEGVFLARDLVNEPANVLGPVEFAARAKELERLGVDVEILTEREMK
AMPA_NITWN      DDAVNXXXXXXXXXXXXXXXXNHVVNGVIIARDLVNEPPNVLYPEEFARRASRLRAMGVGIDVLDVKAMT
AMPA_RHILW      SVKVTIVTTDPAGAKKAFSDSEAIAGGVNLARDLVNEPPNVLGPVEFAAKAKELEKLGIEVEILTEKEMR
AMPA_RHIEC      SVKVTIVTADATGARKAFSESEAIAGGVNLARDLVNEPPNALGPVEFAARAKELENLGVEVEILTEKEMR
AMPA_RHIL3      SVKVTIVTADPAGAKKAFSDSEAIAGGVNLARDLVNEPPNVLGPVEFAAKAKELEKLGVEVEILTEREMR
AMPA_SINMW      TQKPXXXXXXXXXXXXXXXXFQAVGEGVFLARDLVNEPANVLGPVEFAARAKELEKLGVEVEILTEREMK
AMPA_OLICO      ------------------IRDAHVANGVVLARELVNEPPNVLYPAEFARRAAQLRKLGVKVEIFDVKAME
AMPA_AGRT5      XVDVTIVTAAHKDAEKASAVSEAIAGGVILARDLVNLPPNVLGPVEFAEKAEELRKLGVDVEILGEKELK
AMPA_RHIE6      SVKVTIVTADASGAKKAFSDSEAIAGGVNLARDLVNEPPNALGPVEFAARAKELETLGVEVEILTEKEMR
AMPA_RHOPB      DTPLNVAAAKKAFAPQNHV-----VDGVIMARELVNEPPNVLFPVEFARRASQLRKLGVGVEVLDVPAMK
AMPA_WOLPM      TVLVKDEQLSNAERSFEHLRQEG--ESIFLARSFITEPPNILYPESYADHIKKLTKLGLEIEVLDKKQME
AMPA_RHOP5      DAPLDA---SVAIAVRDVAATKGLVDGVNIARELVNEPPNVLYPAEFARRASQLSKLGVGIEVLDVPAMT
AMPA_RHOP2      DAXXXXXXXXXXXXXXXXXXXXXVVDGVILARELVNEPPNVLYPEEFAKRAAQLKKLGVDIQILDVKAMT
AMPA_RHOPS      -------------------------DGVILARELVNEPPNVLYPEEFAKRAAQLRKLGVQVEILDVKAMT
AMPA_AGRRK      -------------------------DGVILARDLVNEPPNVLGPVEFXXXXXXLEKLGVEVEILTEREMR
AMPA_RHILO      -------------------------DGVLLARDLVNEPANILGPVEFAARAKELETLGVKVEILTEKEMK
AMPA_NITHX      TALVTIXXXXXXXXXXXXXPDNHVVDGIIIARDLVNEPPNVLYPEEFARRASRLRRVGVGIDILDVKAMT
AMPA_RICBR      TLADKFVVESFEISTDNNAEAKLIAEGVFFTRDISNEPSNIKTPQIYAERIDILEELNVDVSILGEREMK
AMPA_RICB8      TLADKFVVESFEISTDNNAEAKLIAEGVFFTRDISNEPSNIKTPQIYAERIDILEELNVDVSILGEREMK
AMPA_CAUCR      ----------------------ALADAIVFSRNLVSEPANILHPEEFAARAKGLESLGLEVEILGEAEMA
AMPA_PHYMT      XILELVIITKNAENCQKELKVQAICEGVNLTKELVNEPANILGTEEFVEKIKKLEKLNVKVQVLDKEKLK
AMPA_GLUOX      RPVLKTLHVAVSDVAAAQTRWAALDQGVILTRNLVSEPPNVLYPQTFTQRIEELRELGLTVEVLDEKAMT
AMPA_RICCK      EKFIEVFTDNNTEAAKLFEVKKLVAEAVFFTRDISNEPSNIKTPQVYAERIDILEPLGVDVDIIGEREMK
AMPA_BRUME      NGEPKHAAKITVCVADTHSARKAFEDGVIQARNLVNEPANILGPVEFXXXXXXXXXXXXXXXXXXXXXXX
AMPA_AGRVS      ---------------------RAVVDGVLLARNLVNLPANVLGPVEFADRAKALEALGVEVEILTETEMA
AMPA_BRUO2      NGEPKHAAKITICVADTHSARKAFEDGVIQARNLVNEPANILGPVEFXXXXXXXXXXXXXXXXXXXXXXX
AMPA_BRUSU      NAKITICVADTHSARKTFEVAEAVADGVIQARNLVNEPANILGPVEFXXXXXXXXXXXXXXXXXXXXXXX
AMPA_RICFE      KFAVESIEIFTDNSTEAAKLFKLIAEAVFFTRDICNEPSNIKTPQVYAERIDILEPFGVDVDVIGEREMK
AMPA_RICM5      KFAVESIEIFTDNSTETAKLFKLIAEAVFFTRDISNEPSNIKTPQVYAERIDILEPLGVDVDVIGEREMK
AMPA_RICPR      EKFIEILTDNNSEAMKLFEVKKLIAEAVFFTRDISNEPSNIKTPQVYAERIEILEPLGVNIDVIGEHDIK
AMPA_RICPU      KFAVESIEIFTDNSTETAKLFKLIAEAVFFTRDISNEPSNIKTPQVYAERIDRLEPLGVDVDVIGEREMK
AMPA_RICCN      KFAVESIEIFTDNSTETAKLFKLIAEAVFFTRDISNEPSNIKTPQVYAERIDRLEPLGVDVDVIGEREMK
AMPA_RICAE      KFAVESIEIFTDNSTETAKLFKLIAEAVFFTRDISNEPSNIKTPQVYAERIDRLEPLGVDVDVIGEREMK
AMPA_RICRS      KFAVESIEIFTDNSTETAKLFKLIAEAVFFTRDISNEPSNIKTPQVYAERIDRLEPLGVDVDVIGEREMK
AMPA_RICRO      KFAVESIEIFTDNSTETAKLFKLIAEAVFFTRDISNEPSNIKTPQVYAERIDRLEPLGVDVDVIGEREMK
AMPA_METPB      DAALSLLVADPSGXXXXXXXXXXXXEGVILARNLVNEPPNVLYPEEYARRVSELTSLGVEIEILDVARMK
AMPA_DINSH      LGPITVCATKXXXXXXXXXXXXXXXXGVFFTRDLVNEPANVLTTTEFADRLTAMADLGLEVSVLEEADME
AMPA_METEP      DAALTLXXXXXXXXXXXXXXXXXXXXGVILARNLVNEPPNVLYPEEYARRVSELTQLGVEVEILDVARMK
AMPA_RHOS5      PGPVTMMVANPETVXXXXXXXXXXXXXIFFTRDLVNEPANVLSTFDFAARLAAMHXXXXXXXXXXXXXXX
AMPA_RICTY      EKFIEIFTDNNSEAIKLFEVKKLIAEAVFFTRDISNEPSNIKTPQVYAERIDILEPLGVNVDVIGERDIK
AMPA_METC4      ----DEAGAALTLRVADXXXXXXXXXXXILARNLVNEPPNVLYPEEYARRVSELTQLGVEVEILDVARMK
AMPA_METRJ      VTALTLLLADHXXXXXXXXXXXSLSDGVILARDLVNEPPNVLFPAEFARRASELAKLGVEIEVLEPARMR
AMPA_PSEPW      RALKKITLLADKAGLTEVERAAAIATGMAFTRDLGNLPPNLCHPSYLAEQAKELGKAGLKVEVFDEKKIK
AMPA_PSEU5      RALQKIIDKAEQAGVERAARASAIATGMAFTRDLGNLPPNVCHPTFLADQARQLSKAGVKLDVLDEKKLR
AMPA_PSEFS      ITLLTIKAAQAEVE-RAVTHAQAIANGMSFTRDLGNLPPNICHPTFLGEQAKALKEFGLKVEVLDEKKIK
AMPA1_SHEON     NYQIGV--DDLSLNQKHHKNLQAVEAGVFLARDLTNAPAGNMYPESFANEARKLKSLGVKVTVLEAKDIE
AMPA_PSEPF      RALKKITLLTIKAAQAEVQRATAIANGMAFTRNLGNLPPNICHPTFLGEQAKNLKEFDLKVEVLDEKKIK
AMPA_CHLL2      ------------------------------ARDLVNLPGNLLQAEDIAAAVESGKRCGFEVNVFGKEEIE
AMPA_PELCD      LILIADQGSLEGVAAAVE-RARHIGHGVALARDLVNQPGNVKSPEFLAERARQLAECGLSCTVLEQEQLE
AMPA_PSESM      RPLKKITLLTDKVSVADVERAQAIATGMALTRDLGNLPPNICHPTYLGEEAKALGKANLKVEIHDEKKLA
AMPA_THISH      RIILSVPSRADLLPGEDAVRVAAISVGTKLTRDLANLPGNICNPTYLAEQALQLKKTGLKVEILEEADME
AMPA_SACD2      ATLKKVVFVATNSAETKTLRNSAMGKGINAARELGNLPGNICTPNYLAEQAKQLAAGCKKLTALGEKQME
AMPA_PSEPG      TLLADKAGQAEVERAVKHA--SAIATGMAFTRDLGNLPPNLCHPSFLAEQAKDLGKAGLKVEVLDEKKIK
AMPA_CLOPE      VEVTVHIGGHNINEEEVELCEKAIDEAMLLARDLVNEPANNMYPETLAKEVKNISKYGFEVEVFDENQIE
AMPA_PSEPK      TLLADKAGQAEVERAVKHA--SAIASGMAFTRDLGNLPPNLCHPSYLAEQAKELGKAALKVEVLDEKKIK
AMPA_PSEA7      ---------------------QAIANGMALTRDLGNLPPNVCHPTFLGEQAKALAKEGLKVEVHDEQKLR
AMPA_PSEU2      RALKKITLLTDKVKAADVERAQAIATGMALTRDLGNLPPNICHPTYLGEEAKALGKANLKVEVHDEKKLA
AMPA_PSEAE      ---------------------QAIANGMALTRDLGNLPPNVCHPTFLGEQAKGLAKEGLKVEVLDEKKLR
AMPA_PSEA8      ---------------------QAIANGMALTRDLGNLPPNVCHPTFLGEQAKGLAKEGLKVEVLDEKKLR
AMPA_PSEP1      TLLADKAGQAEVERAVKHA--SAIASGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAALKVEVLDEKKIK
AMPA_CLOTE      NVYLDILEEKKEETINTINESKNLIEGIFLARNLVNEPAIYMTPTVLANNANQLESLGVEVKIYGKEKIK
AMPA_CLOPS      VEVTVHIGGHNEIEFCEKVIDEALSETTCLARDLVNEPANNMYPETLAKEVKNISKYGFEVEVFDENQIE
AMPA_PSEPU      TLLADKAGQAEVERAVKHA--SAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAALKVEVLDEKKIK
AMPA_METFK      KLQVHVTRRSDVAEGEKGLRQKALAAGVSFAKDLGNLAPNYCTPSYLAEQAEALSSHGLQVEVLEKEDIE
AMPA_PSEAB      ---------------------QAIANGMALTRDLGNLPPNVCHPTFLGEQAKGLAKESLKVEVLDEKKLR
AMPA_FUSNN      FLEVSYLTDKK---VPKLIEGYELAKISNIVKDLVNEQAEVLNPKELADRATKLKKFGFDVEILDEKKAQ
AMPA_ALHEH      ----------------------AVGRGMSLARDLGNLPGNVCTPSYLADQAKALKRFDLKVQSLDRKDMK
AMPA_PSEE4      RALKKITLLADKAGLAEAERASAIATGMAFTRDLGNLPPNVCHPSFLAEQXXXXXXXXXXVEVLDEKKIK
AMPA_CENSY      SPRLHILGGGPSAAIKDA---QSITAGVAFARGLANMPPNECPPDKLGRKMCTGKK--MRCIVLKKPELK
AMPA_ACISJ      ALLRVTLGVPNAGAAQEFATATAVAAGVEFAREWANRPANHATPTLVANAAKTLAKYGVQCQVLGPAEVA
AMPA_LEGPC      HKLESVIFHLPGATEKSLEMAKAIVTGVEFCRDLANMPANICTPTYLGEQISLSKQFDISCQVMGPEEIK
AMPA_DIAST      ALLRVTLGVPDAGAAQEFATATAVAAGVEFAREWANRPANHATPTLVANAAKTLAKYGVQCQVLGPTEVA
AMPA_DECAR      KLTISVERRNELAPAEEALQGLAIAEGMAMAKTLGNLPPNICHPTYLAEQAQAMEEFKLGCEILDRAEME
AMPA_LEGPL      HKLESVIFHLPGATEKSLEMAKAIVSGVEFCRDLANMPANICTPTYLGEQISLSKQFDISCQVMGPEEIK
AMPA_ALCBS      SNLAKLTAEKDTTLTKAHKTGKAVGLGVNVARDLGNLPPNDCYPEYLSGVARDLGKEKLTVKVLSQAQAE
AMPA_VESOH      SGIERITIQSTMDSVYGLMKGQAIADGMSLTRHLGDLPSNVCTPSYLATAISLAQEFNLECEVLEEVDME
AMPA_ACIAD      QLQIHLITAQTGLTTQQLDLIQAIASGQDLARDLGNRPGNICFPEYLADQAKALAEFPLKVTILDEQQMA
AMPA_RALEJ      KVVLAVDANDAKAATQAVVRGTAIANGMELTRDLGNLPSNICTPTYLANTARAIKRHKLKVEVLGRKQIE
AMPA_BURP8      TIVFSVDAADEKLAKVAVKQGVALANGMDLTKDLGNLPGNVCTPTYLGNTAKKLAKWKLKVEVLGQKQIE
AMPA_SHEDO      ----------------------AVSAGMHLCRDVANMPPNICNPAYLASQARQMAETHLKVTTIGEEQMA
AMPA_LEGPA      HKLESVIFHLPGATEKSLEMAKAIVTGVEFCRDLANMPANICTPTYLGEQISLSKQFDISCQVIGPEEIK
AMPA_AZOVD      PVLKKLVLLCDKAGQAEVERAQAIVDGMALTRDLGNLPPNLCHPTSLASEAKALAKTTXXXXXXXXXXXX
AMPA_GEOSM      RFAFEEMTLMAPQPEREMARAVAEQRGVQLARDLVSHPGNVVTPGXXXXXXXXXXXXXXXVRVYEQDELE
AMPA_ACIBY      FVLVDLISSQTSLDENQLALVHAVQSGQSYARDLGNRPGNICFPXXXXXXXXXXXXXFLKVTVLNEQQMA
AMPA_ACIBT      FVLVDLISSQTSLDENQLALVHAVQSGQSYARDLGNRPGNICFPXXXXXXXXXXXXXFLKVTVLNEQQMA
AMPA_ACIBC      FVLVDLISSQTSLDENQLALVHAVQSGQSYARDLGNRPGNICFPXXXXXXXXXXXXXFLKVTVLNEQQMA
AMPA_ACIB5      FVLVDLISSQTSLDENQLALVHAVQSGQSYARDLGNRPGNICFPXXXXXXXXXXXXXFLKVTVLNEQQMA
AMPA_ACIB3      FVLVDLISSQTSLDENQLALVHAVQSGQSYARDLGNRPGNICFPXXXXXXXXXXXXXFLKVTVLNEQQMA
AMPA_TERTT      ------------------LKGAAIGEGMNLTRQLGNLPGNICTPAYLVEQAKQLAAACPKLTTLNEKQIE
AMPA_BURP1      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA2_SHEON     ----------------------AVSSGMHLCRDVANMPPNICNPAYLASQARQLAEINLHVSTVGEEQMA
AMPA_BURPS      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_BURP6      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_BURP0      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_BURMS      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_BURMA      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_BURM9      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_BURM7      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKIAKWGLKVDVLGLKQIQ
AMPA_HAES2      SLVLNVPTELQQNALQAISYAQAIALGVKYAKDIANCPPNVCNPTYLAEQAQSLAKHSNLINVQGEKEMA
AMPA_CHLT3      LKSGKSEDDEPKQAVEELVLAKGAETGDIIARDLVNSPSNYMTALDFAERVKASEKHGFKVTVFDKAKIE
AMPA_AZOSE      -------------------RGQAIAEGMALAKDLGNLPGNFCTPSYLADTAVALKQYKLKVEVLDRDDME
AMPA_SHEFN      ----------------------AVSAGMHLCRDVANMPPNICNPAYLASQARQMAEVNLNVTTIGEEQMA
AMPA_NITEU      ----------------------AIAHGMKVTKDLGNLAPNICTPSYLAGQAEEMARFNLKFSVLEEKDME
AMPA_CHRVO      VKLTLAVPRRSDLADGEKQRGLAIGNGMKLAKDLGNLPGNVCTPSEEARKV--AETFGAEAEILGPREIA
AMPA_ALKOO      LYLLNEEESINKDLEKGFQTGAKLAQGTIIARNLVNEPSNVLTPTAMAKAIEIANNHGLEISILEKEDME
AMPA_ACIBS      FVLVDLISSQTSLDENQLALVHAVQSGQSYARDLGNRPGNICFPXXXXXXXXXXXXXFLKVTVLNEQQMA
AMPA_NITEC      QPIIFLIGDERAGAEQAFKQGAAIACGMNVTKDLGNLAPNICTPTYLAEQAGEMAKYNLKLSVLEEKDME
AMPA_BURTA      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKKLAKWGLKADVLGLKQIQ
AMPA_SHEPW      ----------------------AVSAGMHLCRDVANMPPNICNPAYLASQARQIAENNLTVTTVGEEQME
AMPA_BURM1      --------------------------GMDLTRDLGNLPGNVCTPTYLANTAKQLAKWGMKAEVLGLKQIQ
AMPA_BURXL      --------------------------GMDLTRDLGNLPSNVCTPTYLANTAKKLAKWKLKVEVLGEKQCE
AMPA_RALME      KIVLAVDVGDAKAASQAAVRGTAIANGMELTRDLGNLPSNICTPTYLANTARGIKRHKLKVEILGRKQIE
AMPA_HAES1      NSVLNEFIFDVQPELQQDALLQAIALGVKHAKDIANCPPNICNPTYLAEQAQSLAKHSNLINVQGEKEMA
AMPA_CUPTR      KVVIAVDSGDARAATQAAVRGTAIANGMELTRDLGNLPSNICTPTYLANTARSIKRHKLKAEILGRKQIE
AMPA_BURVG      SVVFSVDPSDEXXXXXXXXXXXXXXNGMDLTRDLGNLPGNVCTPTYLGNTAKKLAKWGLKAEVLGLKQIQ
AMPA_BURPP      --------------------------GMDLTRDLGNLPSNVCTPTYLANTAKKLAKWKLKVEVLGEKQCE
AMPA_WIGBR      KIYMKYIHDENEIK-QANIAISSISKGIIITKNLGNMPSNFCDPHYLSHQSYILKKYSEKISIMDHKKIK
AMPA_JANMA      ----------------------AVANGIDLTKDLGNFPANVCTPTYLANTAKKMKEFKLEVEVLDRKQLQ
AMPA_HAEIN      SVLESFIFNTDCAQAQQAISHNAISSGIKAARDIANMPPNICNPAYLAEQAKNLAETALSLKVVDEEEMA
AMPA_HAEIE      SVLESFIFNTDCNQAQQAISHNAISSGIKAARDIANMPPNICNPAYLAEQAKNLAETALSLKVVDEEEMA
AMPA_HAEI8      SVLESFIFNTDCNQAQQAISHNAISSGIKAARDIANMPPNICNPAYLAEQAKNLAETALSLKVVDEEEMA
AMPA_SHELP      ----------------------AVSTGTQLCRDVANMPPNICNPAYLASQARQIAENNLTVTTVGEEQMA
AMPA_RALEH      KVVIAVDTGNARAATQAVVRGTAIANGMELTRDLGNLPSNICTPTYLANTARGIKRHKLKAEVLGRKQIE
AMPA_PARUW      TLLINFISNKHVLALAEEVA--AICDGVYYTRDLINGNADEITPQYLAKCAQGLSQEQIKTTVFDKKRLE
AMPA_MANSM      SKLAEIIFYTEENHEQAELAIRAISSGVKAAKDIANCPPNICNPAYLAEQANQLRSSLIETTVIGEKEMR
AMPA_CHLP8      ------------------------------ARDLVNLPGNHLSAEDLADAAREAKRGGFEVTVFDKKKIT
AMPA_RHOFD      VIQRVVVAVSNSSGFKPVFRAVAAVTGIEFAKEWANRPANHATPALLAGAARSLAKLAIKCEVLGPKQVE
AMPA_SHESH      ----------------------AVSAGMRLCRDVANMPPNICNPAYLASQARQMGENSLTVTTVGEEQMA
AMPA_HAEIG      SVLESFVFNTDCNQAQQAISHNAISSGIKAARDIANMPPNICNPAYLAEQAKNLAETALSLKVVDEEEMA
AMPA_ACTSZ      VKLRNVIFHADDKQAQLAVQHSAIALGVKLARDIANCPPNVCNPNYLAAQAKKLEKQTLTTAVLGEKEMA
AMPA_COLP3      ----------------------AIAEGITTCKNVANMPPNICNPAYLAEQAKILENDYDKVTIVDEKEME
AMPA_GEOSL      TELVNLFEPGTDTADAERLLAATICEAVSFARDLVSQPGNVATPLFLAKALEFSARLGIACTVLDRDEME
AMPA_IDILO      KLVFNVPSRKEALGEQAVQHALAVATGMDICRNVANMPPNICTPRYLADQAKLMADNNLTVATVEEAEME
AMPA_PERMH      RIKELQIRVKRRFKNKAEQSVKVLAESQNFTRDIVNEPGNVITPEKLAQIAQDLREYGFEVKIYDEEEIE
AMPA_HAEDU      VIIFNVANQQDLLEAERGLKHQAIASGMIYAKNMANCPPNICNPAYLAELAQGLATDYQQIQIVDEAEMA
AMPA_PSYIN      NLTFNVTSRKELARAELGLQHAAVASGAKACKDLANMPPNICTPLYLSEQAIALGQRFEKITIVDSEQMA
AMPA_RALPJ      -------------------RGTAIANGMDLTRDLGNLPSNICTPTYLANTARQIAKFKLKVEVLGRKQIE
AMPA_HAHCH      TKVVKVAGDKRDXXXXXXXXXXXXXXGMSLTKDLGNLPGNVCTPDYLAKQAKALAKESLKAEALGEKEMK
AMPA_PSEA6      ----------------------AVSLGSKTTRDVANMPPNICNPMYLFEQAKALEAENLHVDSVNEKQMD
AMPA_THICR      --------------------------GMALTQDLANMPSNYCTPTYLAETAEAMAKYGFDVNILEQDEMI
AMPA_PHOPR      RKLVFNVPTRRELSLGERAHGLAVASGVKASKDLGNMPPNVANPAYLASQARRLADDTVTTKIIGEQEMK
AMPA_PELLD      ------------------------------ARNLVNLPGNHLQAEDIARAAAASKQYGYGVTVLRKKEIE
AMPA_CHLPN      TPLVTVIGIVPKMADAIFRKEAAIFEGVYLTRDLVNRNADEITPKKLAEALNLGKEFSIDTKVLGKDAIA
AMPA_PROMH      ----------------------AIASGIKACKDLANMPPNICNAAYLASQARQLADSSANVSVIGEEQMK
AMPA_CHLTE      ------------------------------ARDLVNLPGNHLSAEDLAEAIEAGKRGGFEVTVFDKKKIV
AMPA_XANCP      ----------------------ATAEGVEFARELGNLPPNYCTPAYLAETAAAFAKFGAEAEILDEQQME
AMPA_XANCB      ----------------------ATAEGVEFARELGNLPPNYCTPAYLAETAAAFAKFGAEAEILDEQQME
AMPA_XANC8      ----------------------ATAEGVEFARELGNLPPNYCTPAYLAETAAAFAKFGAEAEILDEQQME
AMPA_SERP5      ----------------------AVSSGIKAAKDLGNMPPNICNAGYLASQARQLASTNITTRVIGEQQMK
AMPA_HERAR      --------------------------GIDLTKDLGNLPANVCTPTYLANTAKKMKEFKLQVEVLDRKQLQ
AMPA_BURCM      --------------------------GMDLTRDLGNLPGNVCTPTNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_BURA4      --------------------------GMDLTRDLGNLPGNVCTPTNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_XANOR      ----------------------ATAEGVEFARELGNLPPNYCTPAYLADTAAAFAKFGAEAEILDEAQME
AMPA_XANOP      ----------------------ATAEGVEFARELGNLPPNYCTPAYLADTAAAFAKFGAEAEILDEAQME
AMPA_XANOM      ----------------------ATAEGVEFARELGNLPPNYCTPAYLADTAAAFAKFGAEAEILDEAQME
AMPA_TOLAT      ----------------------AISNGMKICRDVANMPPNICTPAYLASQARRLADSCQYITVIGEQQMA
AMPA_RHOBA      -------------------------------RRLVNEPPSIMNPTGFAQYAEKIASCGLTCEVWDEKKLE
AMPA_BURS3      SVVFSVDPSDEXXXXXXXXXXXXXXNGMDLTRDLGNLPGNVCTPTNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_XANC5      ----------------------ATAEGVEFARELGNLPPNYCTPAYLAETAAAFAKFGAEAEILDEAQME
AMPA_RALSO      --------------------------GMELTRDLGNLPSNICTPTYLANTARQIAKFKLKVEVLGRKQIE
AMPL_ENCCU      S-------KKIAINSQSHAVKKAVVVGNAFARFLGDTPANLMNPTEYATKYLQDKK-NVTFEVFDKSFME
AMPA_PASMU      DVALTIFSAEGDVAQQAVNHAKAIALGVRAAKDVANCPPNVCNPVYLAEQANALATRSIKTTVLGEKDMA
AMPA_EDWI9      --------------------------------------------DNYAGAVTT--------RVIGEQQMK
AMPA_BUCAP      SISFHIIEKKDFHIANNSLKHAAINSGITAAKNLADLPPNICNPSLQAQKLSEKYKDKIHVTSIDIKEMN
AMPA_XANAC      ----------------------ATAEGVEFARELGNLPPNYCTPAYLADTAAAFAKFGAEAEILDEAQME
AMPA_AERHH      ----------------------AVAKGVRVCRDVANMPPNVCNPAYLASQARRLADANITTKVIGEQEMA
AMPA_LEPIN      -------------------------------RHIAHLPANHFTPEEFVSRSKEIAKDGLKITVFDEPQLK
AMPA_LEPIC      -------------------------------RHIAHLPANHFTPEEFVSRSKEIAKDGLKITVFDEPQLK
AMPA_BUCAT      SITLNIIKKNDLFIAKTALKHAAIDHAITSTKNLSNLPPNICNPLYLSYKAQELSKKNIVVEIIDIKKMK
AMPA_AERS4      ----------------------AVAKGVRVCRDVANMPPNVCNPAYLASQARRLADSNITTKVIGEQEMA
AMPA_BURCH      --------------------------GMDLTRDLGNLPGNVCTPGNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_BURCA      --------------------------GMDLTRDLGNLPGNVCTPGNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_BUCAI      SITLNIIKKNDLFIAKTALKHAAIDHAITSTKNLSNLPPNICNPLYLSYKAQELSKKNIVVEIIDIKKMK
AMPA_BUCA5      SITLNIIKKNDLFIAKTALKHAAIDHAITSTKNLSNLPPNICNPLYLSYKAQELSKKNIVVEIIDIKKMK
AMPA_ACTP7      RVIFNVANRKDLADAERALEHKAISTGVAFAKXXXXXXXXXXXXXYLAELAKGLEYDNIRTTVIDEAEMA
AMPA_ERWT9      --------------------------------------------DAYSKNITT--------RVIGEQQMK
AMPA_ACTPJ      RVIFNVANRKDLADAERALQGKAISTGVAFAKXXXXXXXXXXXXXYLAELAKGLEYDNIRTTVIDEAEMA
AMPA_DESVH      ---------------------EAVALGMGVARDLVNGPANIVTPAFLASEAEALRKHGFRVEVLGRDELS
AMPA_METCA      ---------------------QAIAHGMTLARNLGNLPGNVCTPAYLAEQALKLGKEKLKVSVLEESDME
AMPA_AZOSB      -------------------RGQAVAEGMALAKDLGNLPGNVCTPAYLADTAEALKQFKFDVEVLERADME
AMPA_BURCJ      --------------------------GMDLTRDLGNLPGNVCTPTNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_BURCC      --------------------------GMDLTRDLGNLPGNVCTPTNTAKKI--AKDWGLKAEVLGLKQIQ
AMPA_XYLFM      ---------------------QAIAEGVEYARALGNLPPNICTPAYLAE---TTAHFGATCEILDESNME
AMPA_XYLFA      ---------------------QAIAEGVEYARALGNLPPNICTPVYLAE---TTAHFGATCEILDESKME
AMPA_SYNPW      --------------------------GVELARELVAAPPNSVTPAELARTASHLAEHGLELTILERSDCE
AMPA_SODGM      -------------------------------------PPNICNPAYLASQARQLADYGTTTRVIGEQQMK
AMPA_ERWCT      --------------------------------------------------------------VIGEEQMK
AMPA_PECCP      --------------------------------------------DTYSQNIIT--------RVIGEQQMK
AMPA_BORA1      ALITQIIERAEAAQTQQGLREAAIANGMALTRTLGNLPGNICTPTETARKLAREFKTLIKVEVLDRKQVE
AMPA_VIBHB      ----------------------AIASGVKASKDLGNMPPNIANPAYLASQARRLADDTVSTKIIGEQEME
AMPA_GEOTN      DYALESL---TVYTAADAAEIEALFVGSVYARTLVNTPGNLLTASDLADAVELAKRYDFDYEILEKEEME
AMPA_XYLFT      ---------------------QAIAEGVEYARALGNLPPNICTPAYLAE---TTAHFGATCEILDESNME
AMPA_XYLF2      ---------------------QAIAEGVEYARALGNLPPNICTPAYLAE---TTAHFGATCEILDESNME
AMPA_NITOC      -------------------------KGVNLARDLGNLPGNICTPTYLADEARRLAKESLKAKILEQAEME
AMPA_SULSY      EVQVNIPKNQDKDRLNEFVRIEILAEAQNFTRDLVNEPANVINTIQFAEIAEKLKEYGFXXXXXXXXXXX
AMPA_CORDI      KVTFISLGDK-KAAKEEFTVGQIIAESVALCRDLVNAPSSHLYPESYAAIIDTAEKIGLGVEILDEKKLE
AMPA_BUCBP      ----------------------AISKGKKIARDLSNMPPNICNSSYLADQAMKLSQYYIDVEIINDIDMN
AMPA_VEREI      SLSRCVLGVPDAAGARPGFDCGALVAGVEFAREWSNRPANHATPSLLADAAKTLGRLPIQCKVHGPAQVR
AMPA_VARPS      ---------------------RATVAGIELAKEWGNRPGNYCTPTXXXXXXXXXXXXPVKCEVLGPKEVQ
AMPA_BAUCH      --------------------------------DLANMPPNICNSAYLASKAHELANSNKHINVLGKQQMK
AMPA_VIBPA      RKLVFNVPTRRELSLGEKAHGLAIASGVKASKDLGNMPPNVANPAYLASQARRLADDSVTTKIIGEQEME
AMPA_SALAR      --------------------------------------------DSYSKKVIT--------RVIGEQQMR
AMPA_SALTY      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALSV      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALPK      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALPC      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALPB      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALPA      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALNS      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALHS      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALG2      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALEP      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALDC      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALCH      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_SALA4      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_VIBVY      ----------------------AIASGVKACKDLGNMPPNIANPAYLASQARRLADDTITTKIIGEQEME
AMPA_VIBVU      ----------------------AIASGVKACKDLGNMPPNIANPAYLASQARRLADDTITTKIIGEQEME
AMPA_GEOSW      SITIYTEADQAEIEASVFVG-SVYGKATNSARTLVNTPSNLLTAADLANAVELANKYEFEYEILEKDDME
AMPA_CHLMU      PLLVTVLGIVPKVGDKIFRKEESLFEGVYLTRDLVNTNADEVTPEKLAAVAKGLEFASLDVKILDRKAIL
AMPA_ACTP2      RVIFNVANRKDLADAERALEHKAISTGVAFAKXXXXXXXXXXXXXYLAELAKGLEYDNIRTTVIDEAEMA
AMPA_SALTI      --------------------------------------------DSYSKNVIT--------RVIGEQQMR
AMPA_EXIS2      YDLVTIWSDAGEQAVE---RGAALAQATNLARRLVTMPGNLLTAPALADEARFIERHGHELKILEKADME
AMPA_CHLCV      PLLVNVLGIVPKIADRIFRKEENIFEGVYLTRDLVNGNADEVTPQKLANIAKGMAKESMDVKILNKDAIL
AMPA_SHISS      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_SHIFL      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_SHIF8      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_SHIBS      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_SHIB3      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ESCF3      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ENT38      --------------------------------------------DSYSKNIVT--------RVIGEQQMK
AMPA_ECOUT      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOSM      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOSE      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOLU      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOLI      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOLC      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOL6      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOL5      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOK1      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOHS      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECODH      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECOBW      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO8A      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO81      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO7I      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO5E      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO57      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO55      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO45      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO27      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_ECO24      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_CITK8      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_SHIDS      --------------------------------------------DSYSKNVIT--------RVIGEQQMK
AMPA_KLEP7      --------------------------------------------DTYSKNVIT--------RVIGEQQMR
AMPA_DESAH      REYLGLVSGKTDPAVEKGMDLRRAALAACEARNMANEPXXXXXXXXXXXXXXXXXXXSLGCRILEKSDME
AMPA_AQUAE      KFEIKVLINRGD---EEGIRLKIFAEAQNYARNLVNEPGNVINPTXXXXXXXXXXXFGLECKVYDEKQIQ
AMPA_YERPY      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPS      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPP      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPN      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPG      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPE      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPB      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERPA      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_YERP3      ----------------------AIASGIKAAKDLGNMPPNICNAAYLASQARQLASTNTVTRVIGEQQMK
AMPA_KLEP3      --------------------------------------------DTYSKNVIT--------RVIGEQQMR
AMPA_METPP      -------------------RGAAIALGVALARECANRPGNHCTPSFLAAEARKLAKLPIKVDVLDRKACE
AMPA_VIBCM      ----------------------AISSGVKACKDLGNMPPNIANPAYLASQARRLADDSITTKIIGEEEME
AMPA_VIBCH      ----------------------AISSGVKACKDLGNMPPNIANPAYLASQARRLADDSITTKIIGEEEME
AMPA_VIBC3      ----------------------AISSGVKACKDLGNMPPNIANPAYLASQARRLADDSITTKIIGEEEME
AMPA_HAMD5      ----------------------ALAVGINEAKNLANTPPNICNPAYLASARKWAEKFNVRVSVVNEDEMK
AMPA_GEOUR      TDLEEATLLFAEAGDLDYNVNKVLAETATFARDLVSQPGNVLVPSYLAEKGREIARYGLSCTVLEREEMA
AMPA_BDEBA      TKEINVMGNDKAVKA-------AFNEGAIFSRRLGDLPGNLMTPTILADSAVEGAKANLKVTVWDKARIK
AMPA_YERE8      ----------------------AVASGIKAAKDLGNMPPNICNAAYLASQARQLADFSTNIRVIGEQQMK
AMPA_CHLAB      DPLVTVLGIVPKIADRIFRKEESIFEGVYLTRDLVNGNADEVTPEKLANIAKGLAKQSVDAKVLNKDAIL
AMPA_BACCR      VELFMAITSEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVLEKEEME
AMPA_BACC2      LEKFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVLEKEEME
AMPA_TRIEI      LEKVELIGLAASDEAIAHAR--KICSGVIFARELVAAPANSCTPITMAETAQTLKEFGLTLEILEKEDCE
AMPA_BACC4      LEKFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVLEKEEME
AMPA_ALISL      RKLVFNVPTRRELSLGEKAHGLSISSGVKASKDLGNMPPNVANPAYLASQARRLADDTVTTKVIGEEEMK
AMPA_PROMA      --------------------------GVELARELVAAPPNELTPAALAKAVEIAKKFKWNYKILNRKECE
AMPA_HAEPS      KIVFN-IANRKDLTVSE----QAVEQGKAVALGVIAAKXXXXXXXXXXKYLSGLAKGNITTTVLDEKEMA
AMPA_BACSU      IEAVYVVTDEDTQEVQAGLRVQAYGQGTNSARTLVNMPGNMLTATDLASYAEELAKYDFECEILEKSEME
AMPA_CHLPD      ------------------------------ARDLVNLPGNYLQAEDIAKAADSGSRNGFAVKVLRKKEME
AMPA_BACP2      DRFIEFVTDHDTTEIQASLKVGEVYGQSVSARTLVNMPPNMLTSSDLASYAAELAKYEFEIEILDKEQME
AMPA_PROM4      --------------------------GVKLARELVGAPPNSLTPSALANQAKEINQFGLEAKILGQEECQ
AMPA_CYAP8      ALKVDILGCGEATEAIN--RAQTLSSGVILARELVNSPANTITPVTFAETAQEIAQTGLTCEILEQEDCE
AMPA_GLOVI      -------------------RGNILAEGTIFARELVSAPANYVTSVTLAEQATAIAEAGLECEILEKEDCE
AMPA_BLOFL      YEIISYIDKLDKQAVKDGL---AIAKGLNIAKNLGNMPSNYCTPNYLSNKVQELSNYNLDIEIINELQLK
AMPA_VIBFM      RRPLRKLVFNVPTRRELNLGEKAIAHGLSIAKDLGNMPPNVANPAYLASQARRLADDTVTTKIIGEEEMK
AMPA_CHLFF      PLLVTVLGIVPKIADRIFRKEESIFEGVYLTRDLVNGNADEVTPQKLANIAKGLAKESVDAKILNKDAIL
AMPA_CORGL      -------------------------ESVLLARDLVNTPSSHLYPESYSVASNEASKHGLQTTILDEKQLA
AMPA_VIBF1      RRPLRKLVFNVPTRRELNLGEKAIAHGLSIAKDLGNMPPNVANPAYLASQARRLADDTVTTKIIGEEEMK
AMPA_SYNS3      --------------------------GVELARELVAAPPNSVTPSALAESAAQMAEHGLDLKVLERSDCE
AMPA_ACIBL      TILVPANGHANDLEAEGHV----IGESQNFTRDLVNEPGNRMTPTILGQRAKKMEEVGIQCDVYSTDFLH
AMPA_NITMU      ----------------------AVGDGMSLAKDLGNLAPNICTPTYLAEQMNMAKTYKLKVTVLEQKDME
AMPL1_ARATH     SLAVDIIGFGTGAEVEKKLKYEDVSYGVIFGRELINSPANVLTPEEAAKVASTYSDV-FTANILNEEQCK
AMPA_PHOLL      --------------------------------------------------------------VIGEEQMK
AMPA_SYNPX      ------------------------------------------------------RNHGLELTVLERADCE
AMPA_PROM9      -------------------------EGVELARRLVAAPPNSLTPQEMSMQASQIAKHGLEVKILEAKECE
AMPA_ANAVT      TVLLGFAGQEAAIN-----RANQIVSGVILARQLVAAPANSVTPITMAETAQQIAQYGLQIEILEQEDCE
AMPA_CHLTR      PFLVTVMGIVSKVGDKIFRKEESLFEGVYLTRDLVNTNADEVTPEKLAAVAKDLEFASLDVKILDRKAIL
AMPA_POLSJ      KLQRVVIGNELSVARPGFDKALALVKGIEFAKEWANRPANHATPTXXXXXXXXXXXXNIKVEVLGPKEVA
AMPA_DESDA      ------------------------------ARDLASTPPNLLYPEKLAERARELREKGFACTVLDEHELE
AMPA_CHLTB      PFLVTVMGIVSKVGDKIFRKEESLFEGVYLTRDLVNTNADEVTPEKLAAVAKGLEFASLDVKILDRKAIL
AMPA_CHLT2      PFLVTVMGIVSKVGDKIFRKEESLFEGVYLTRDLVNTNADEVTPEKLAAVAKGLEFASLDVKILDRKAIL
AMPL_BOVIN      VVSAKLHGSEDQEAWQRGVLFAS---GQNLARRLMETPANEMTPTKFAEIVENLKSASIKTDVFIRPKIE
AMPA_TREDE      TITVNYNPEKGKEDRAEKGINEAVKEAVFLTRDLVNQPANVIYPETXXXXXXXXXXXGVKVTVHGKKEIE
AMPA_CHLTA      PFLVTVVGIVSKVGDKIFRKEESLFEGVYLTRDLVNTNADEVTPEKLAAVAKGLEFASLDVKILDRKAIL
AMPL3_ARATH     SLKVDIIGFGSGPELEKKLKYEHVSYGVIFGKELVNSPANVLTPAEEALNLASMYSDVMTANILNEEQCK
AMPA_ACAM1      --------------------------GVILTRELVAAPANVVTPSALAETAAQIAEHGLTLEVLEREECE
AMPL_HUMAN      AVSAKLYGSGDQEAWQKGVLFAS---GQNLARQLMETPANEMTPTRFAEIIENLKSASSKTEVHIRPKIE
AMPA_COREF      ------------------------------ARDLVNTPSSHLYPESYAVAANEASRYGLKTEILDENQLA
AMPA_ACIF5      --------------------------------DMANEPGNICTPTWLAEQAEAMARLGIKSTILGPDAME
AMPA_ACIF2      --------------------------------DMANEPGNICTPTWLAEQAEAMARLGIKSTILGPDAME
AMPA_PROMP      KVLNEIXXXXXXXXXXXXXETEYICEGVELARRLVAAPPNSLTPLEMSIQASKIAKHGLEIKILEKNECE
AMPA_PROM0      -------------------------EGVELARRLVAAPPNSLTPQEMSIQASQIAKHGLEVKILEAKDCE
AMPA_ANASP      TVLLGFAGQEAAIN-----RANQIVSGVILARQLVAAPANSVTPITMAETAQQIAQYGLQIEILEQEDCE
AMPA_THEEB      -------------------RAQQICDGVILARELVNAPANEVTPXXXXXXXXXXXXYGLTAKILEREDCG
AMPA_SYNR3      ---------------------EAICQGVMLARELVAAPPNVVNALSLESTARSIAQFGCELTVLDEAACR
AMPA_ROSCS      --------------------------------DLANLPPNDLTPXXXXXXXXXXXAFDLPITVLGPAEMR
AMPA_STRM5      -----------------------------FARELGNLPPNYCTP-AYLAEVGV--KFGAEAEILDEHQME
AMPA_BORPE      ----------------------AIAHGMELTRTLGNLPGNVCTP---AYLGNTAKKLALKVEVLERKQVE
AMPA_BORPA      ----------------------AIAHGMELTRTLGNLPGNVCTP---AYLGNTAKKLALKVEVLERKQVE
AMPA_BORBR      ----------------------AIAHGMELTRTLGNLPGNVCTP---AYLGNTAKKLALKVEVLERKQVE
AMPA_PROMS      -------------------------EGVELARKLVAAPPNSLTPQEMSLQASKIAKHGLEVKILEAKDCE
AMPL_RAT        AVSAKLHGSGDLEAWEKGVLFAS---GQNLARQLMESPANEMTPTRFAEVIENLKSASSKTEVHIRTKIE
AMPA_STRMK      -----------------------------FARELGNLPPNYCTP-AYLAEVGV--KFGAEAEILDEHQME
AMPA_SYNJB      --------------------------GTILARELVAAPANIVTPLALADTARQLQEYGLEVEILGQEECE
AMPA_BACA2      LKSVCAVTEEDLREVQAGLNVAAYGQGTNSARTLVNMPGNMLTATDLASYAAELAKYDFECEILEKDEME
AMPA_BORPD      --IVQVVERGEAAQTQQGLRESAIAHGMELTRTLGNLPGNVCTPTYLGDTARKLARESLKVEVLDRKQVE
AMPL_MOUSE      AVSAKLHGSGDLEAWEKGVLFAS---GQNLARHLMESPANEMTPTRFAEIIEKNLKSATKVHIRPKSWIE
AMPA_STRGG      -------------------RSLALVEEINRARDLVNTPPNDLYPESFAAVATAAKEHGVKVQVLDEKALV
AMPL2_ARATH     SVVFIGFGTENKLKYAEHVSY-----GVIFTKELVNSPANVLSPAVLAEEASNLASMYSNVNILKEEQCK
AMPA_WOLSU      SKLTQIL-----ISLQTHLRQSAIARAVNLARELVNTPPEDATPXXXXXXXXXXXEHQLECRIEDEKFLE
AMPA_CYAP4      ------------------------------------------------------QEYGLDVEVLGQAECE
AMPL2_ORYSJ     HLKVDLIGFGSGPEVDQKLKYNDLSSGVIFGKELVNSPANVLTPAEEASNIASTYSDVFTATILDVEKCK
AMPA_MICAN      TVELLGLGEQASAIAKS----EQICSGVILARELVNAPANTVTPLTMAETAEQIAEYGLSLNILEQEECE
AMPA_POLNA      ----------------------------------------------------------IKTEVLGPKEIE
AMPA_ACIC5      LQSLTLAANAAEAGLREGI---ALGESQNLTRTLVNEPGNRLTPTEQAKKM--CAEQGLRCQVYSSEKLH
AMPA_SYNSC      ------------------------------------------------------KDHGLELKVLERSDCE
AMPA_SYNS9      --------------------------GVELARELVAAPPNYVTPXXXXXXXXXXXHYGMELTILERADCE
AMPA_SYNP2      PALVEILG------IGDQPAAIALGEGVIYARELVNAPANIINPVTLAASVESLASYGLELNILEEADCE
AMPA_CYAP7      TVLLGLAGQETAIN-----QAQIICDGVILARELVNGPANSVTPITMAQTAETLASYGLTLTILEQEDCE
AMPA_CYAA5      TVDILGVGEQSEAINQA----ETVCSGVILARELVAAPANTVTPVTFAETAQNLAKYGLDLEILEKDECE
AMPA_BACC7      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_DESDG      -------------------RGESAAAGIFLTRDLVNGPANLVTPEEQARKLAA--RYGFTVRSMTRQEIA
AMPA_BACCZ      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACCQ      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACC1      VELFTAITAEDTQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_PROMM      --------------------------GVELARQLVAAPANSLTPAALAQTIQLAHEHGLECSVLERSDCA
AMPA_BACHK      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACLD      DQCLQVLTDHDLKEIQASLHVQVYGNATNSARTLVNMPGNMXXXXXXXXXXXXXXKYEFECEILEKAEME
AMPA_BACC3      VKLFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACC0      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACAN      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACAH      VKLFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACAC      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_BACAA      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_HELAH      SVLKEAIANSLEKSAKEALKYAVMTESLNITKNLVNTPGTPIYMAEVAQKV--AKEGNLEIHVYDEKFLE
AMPA_RHOSR      -------------------------------REFVNTPPSHLFPAEFADRAKALTDAGLKVEVLDEKALE
AMPA_TROWT      PEVIRVSHNINGITDSECARAKVIAGSVGLAKDLVNTTGDDLYPAQFASFVKDLEGIDISVESWDEKRLQ
AMPA_TROW8      PEVIRVSHNINGITDSECARAKVIAGSVGLAKDLVNTTGDDLYPAQFASFVKDLEGIDISVESWDEKRLQ
AMPA_NEIMA      XXXXXVFHSAHEAAVKEALRVEAQVYGQSLCRDLGNAAPNECTPEFLARTAKAAEKLGAHAKIIEKDYIK
AMPA_SYNY3      --------------------------GVILAREMVAAPANEVTPLTFTEIATELAQYGLELEVLGQTECE
AMPA_RHOOB      -------------------------------REFVNTPPSHLFPAEFADRAKELTDSGLKVEVLDEKALE
AMPA_SYNJA      --------------------------------------------------------YGLEVEILGREECQ
AMPL_DICDI      ---------------------KILAESQNFARVLMETPANLLTPTNFVQHVSSQMKEKVEMIVREEQWVK
AMPA_BACWK      VELFTAITAEDAQEIEAALTVGYVHRATNSARTLVNMPPNVLTATKLAEAVELAEKYDMDYKVXXXXXXX
AMPA_MYCSA      NSLSFYLENISQDVLNVFKKALILVDAQNFARNLGVTPPNELNSEQLAEIIRKFKKYNLKVKVLERKQIE
AMPA_SOLUE      SLDTFIVAGDTPELESAVARGRILAEAQNFSRDLVNEPANLLTPLGMADAARKMAEFGLECEVLDRDAMQ
AMPA_STRAW      ------------------------------ARDLINTPPNDLNPESFAAVAQAAKEHGIKVQVLDEKALT
AMPA_RHOE4      -------------------------------REFVNTPPSHLYPAEFAARAKALGEAGLTVQVLDEKALE
AMPA_PROM2      -------------------------EGVELARRLVAAPPNSLTPQEMSIQASQIAKHGLGVKILEAKDCE
AMPL1_SOLLC     TLSLDILGLGTGPEIERKIKYEHVCAGVILGRELVNAPANIVTPAEEAKKIASTYSDVISVNILDAEQCK
AMPA_HELHP      IILLD---EKNEVASESVLKVHIVAQSVNEVREIINTIPQVATPKYLAKYAKELSKENLECKILDEEALQ
AMPA_NOSP7      TVLLGFSGQEAAITLANQI-----VSGVNLARELVAAPANAVTPITLAETAQAIAKYGLQVEILEKEDCE
AMPA_MYCLE      TVLANAKDAKKQSA-----HGATVASAVATARDLVNTPPSHLFPAEFAKCAKTLESAGLEVEVLDDKALQ
AMPA_MYCPN      ------------------------------ARQLQDTPSDQLYPEEFVKRFEKAATLGVKITVLKQADLI
AMPL_XENTR      -------------------------EGQNLARHLMEAPANYITPTKFAETFEQLANMGSNVKVFTRSKIE
AMPA_STRCO      -------------------RATAVAEELNRARDLVNTPPNDLDPEXXXXXXXXXKEHGIKVQVLDEKAXX
AMPA_HELPG      SVLKEAIANSLEKSAKEALKYEIMTESLNIVRDLVNTPGTPVYMAEVAQKV--AKENHLEIHVYDEKFLE
AMPA_ALKMQ      RVLQEVYILNEETGITAQLQTEKLAHATMIARDLVNEPGNVLTPTEMAKRAQSIQKHGLELEILEKEDME
AMPA_MYCPA      LQKITVLATA-KDAKQEVAHGXXXXXXXXXXRDLVNTPPSHLFPDEFAKRARALESVGLEVEVLDEKALQ
AMPA_HELPJ      --------NSLEKSAKEALKYEIMTESLNIVRDLVNTPGTPVYMAEVAQKV--AKENHLEIHVHDEKFLE
AMPA_HELPH      --------NSLEKSAKEALKYEIMTESLNIVRDLVNTPGTPVYMAEVAQKV--AKENHLEIHVHDEKFLE
AMPA_HELPS      SVLKEAIANSLEKSAKEALKYEIMTESLNIVRDLVNTPPMIATPAEVAQKV--AKENHLEIHVHDEKFLE
AMPA_HELPY      SVLKEAIANSLEKSAKEALKYEIMTESLNIVKDLVNTPGTPVYMAEVAQKV--AKENHLEIHVHDEKFLE
AMPA_DESPS      VLALSFAGAFDKALERISERAQLAADCGCAARDMAHEPGNGWTPKHFSRYAKKLKSHSLVCTVXXXXXXX
AMPA_AERPE      LQQLWVYGGEPRLDYA-----QAVAEGVYLARDIANAPPHRLPPAKLAAAVEDLSKFNVDVEVFSYDRLL
AMPA_SYNFM      -------------------------------RDLVSSPANRATPAFLADCARRLARDGCRIEVIGLEKAE
AMPA_HELP2      -----------------------MTESLNIVKDLVNTPGTPVYMAEVAQKV--AKENHLEIHVHDEKFLE
AMPA_MYCUA      AGLHKITVLTTTKDARKHCAHXXXXXXXXXXRDLVNTPPSHLYPAELARRAKVLESVGLEVQVLDEKALQ
AMPA_MYCTU      TVLCCAKDAKKRA-----LHGXXXXXXXXXXRDLVNTPPSHLFPAEFAKRAKTLSEVGLDVEVIDEKALK
AMPA_MYCTA      TVLCCAKDAKKRA-----LHGXXXXXXXXXXRDLVNTPPSHLFPAEFAKRAKTLSEVGLDVEVIDEKALK
AMPA_MYCSS      GGLITALSQESKSRARDAARATDIATAVATARDFVNTPPSHLYPDEFAKRAKALEAAGLEVEILDDKALX
AMPA_MYCSK      GGLITALSQESKSRARDAARATDIATAVATARDFVNTPPSHLYPDEFAKRAKALEAAGLEVEILDDKALX
AMPA_CAMJE      TLEKFIISNEEKIGLE---RGEILANATNFTKNIVNEIPEIYTPLKMAEDAQNLAKENKNIKIYDEKFLA
AMPA_LEIXX      -------------------RAATVAEAAGLVKDLVNAPPLDLYPATFAERVEALAALPVSVEVWDETRLA
AMPA_MYCMM      AGLHKVTVLTTAKDARKHCAHXXXXXXXXXXRDLVNTPPSHLYPAELARRAKVLESVGLEVQVLDEKALQ
AMPA_MYCBT      TVLCCAKDAKKRA-----LHGXXXXXXXXXXRDLVNTPPSHLFPAELAKRAKTLSEVGLDVEVIDEKALK
AMPA_MYCBP      TVLCCAKDAKKRA-----LHGXXXXXXXXXXRDLVNTPPSHLFPAELAKRAKTLSEVGLDVEVIDEKALK
AMPA_MYCBO      TVLCCAKDAKKRA-----LHGXXXXXXXXXXRDLVNTPPSHLFPAELAKRAKTLSEVGLDVEVIDEKALK
AMPL_SOLTU      LESLDILGLGTGPEIESKIKYEHVCAGVILGRELVNAPANIVTPGEEAKKIASTYSDVITVNILDAEQCK
AMPA_NOCFA      VAKVEFLVPTADFGEEALFRAQLVAEAVATARDFVNTPPSHLYPAEFAARTQVLAEAGLDVEVLDENALE
AMPA_HALHL      ---------------------QAAGRGANFSRDLGNTPANICTPGYLGEQAEALQRFGVRAEIXXXXXXX
AMPL2_SOLLC     TLKLDILGLGTGPEIEKKIKYAAVCAGVILGRELVNAPANVLTPAEEAKKIASTYSDVFSANILDVEQCK
AMPA_MYCSJ      GGLITALSQESKSRARDAARATDIATAVATARDFVNTPPSHLHPDEFAKRAKALEAAGLEVEILDDKALX
AMPA_SYNE7      ---------------------------------------------------------------------E
YA55_SCHPO      ------------------------------ARSLMECPANYMTSLQFCHFAQELFQNSSKVKVFDEKWID
AMPA_SYNP6      ---------------------------------------------------------------------E
PEPB_VIBPA      ------------LSEEDQTELQARIKATDFTRDIINKTAEEVAPRQLATMIKSVAPEGVTARIVKDKDLL
PEPB_VIBSL      ALEWDALAEADQVELEARIR------ATDWTRDIINKTAEEVAPRQLAEYIKSVAPAGVKAKIVKDKDLL
AMPA_BACCN      VELEKLV----VITAEDAKEIEAALTVGYVARTLVNMPPNMLTATKLAEAVELAEKYDMDYKVXXXXXXX
PEPB_VIBHB      ------------LSEQDQAELHARITSTDFTRDIINKTAEEVAPRQLATMIKSIAPQGVTARIVKDKDLL
AMPA_CHRSD      -------------------------------RTLGNLPGNVCTPRDQAQRLADGADGALNVEIXXXXXXX
PEPB_VIBVY      -------------------RIKATE----FTRDIINKPAEEVAPRQLATMIRSVAPEGVTARIVKDKDLL
PEPB_VIBVU      -------------------RIKATE----FTRDIINKPAEEVAPRQLATMIRSVAPEGVTARIVKDKDLL
PEPB_ENTS8      TVTWAPLDDAQQKELNN--RLKVID----WVRDVINAPAEEMGPEHLAQRVDLLADVGVSYRITKGEDLR
AMPL1_ORYSJ     -----------------------------FAKELVNSPANVLTPAEEASNIASSYSDVLTATILDEEKCR
AMPA_CLAM3      -------------------------------KDLVNTPPLDLYPATFVDAVHE-RTAGLPVDVWDEVALA
PEPB_HAEIN      -----------------------------FVRGIINEPAQSLTPVKLVERAAEFEKSAVSFKIISGEELE
AMPA_MYCGE      VAVQCAVEYHNLVK-----EYETVGEYVNLARELQDTPSDLLYSEVFVKHFEAASKLPVKIKVLKQSDLI
PEPB_VIBCH      -----------------------------WTRDIINKSAEEVAPRQLATMIKSLAPDHVSYRIVKDKDLL
PEPB_HAEI8      -----------------------------FVRGIINEPAQSLTPVKLAERAAEFEKSAVSFKIISGEELE
AMPA_STACT      ------------------------------ARDFSNIPPNILTPEYFADMISAFEETSVEVEVKDAETLQ
PEPB_PASMU      -----------------------------FVREMINLPAEVITPVELARRAAHFDKSAVSFNIISGEELK
AMPA_SYMTH      -------------------------EGVNLARALAWTPGNHLTAAKLAERAAEMRENGIEVEVYDKKGCX
AMPA_MICLC      -------------------------------RDLVNTAPSHLYPATFADAVEDLADSPVSVDVWDEDRLR
AMPA_PROAC      TIVSNARGAKPELN-----KARILADAVYTARDWVDAPANLLYPKTFAASVQSWNLSDVTVDVLDEKALX
PEPB_SALTI      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_PHOLL      -----------------------------WVRDTINMSAEELGPEQLAKRAIDLMCGSVSYRIIKGEDLR
PEPB_ENT38      -----------------------------WVRDTINAPAEELGPEQLAQRAVDLKAAGDKMSITKGEDLR
PEPB_PECCP      TVEWADLSDADKKELNDRLKIVD------WVRDTINLPAEDLGPEQLATRAVDLACDAISYRITKGEDLR
PEPB_ERWCT      TVEWAELNDADKKELNDRLKIVD------WVRDTINLPAEDLGPEQLATRAVDLACDAVNYRITKGEDLR
PEPB_KLEP7      -----------------------------WVRDTINAPAEELGPEQLAQRAVDLLVAGEKISITKGEDLR
PEPB_ESCF3      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_SHIFL      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO5E      -----------------------------WVRDTINAPAEELGPSQLAQRISNVASDRVTYRITKGEDLR
PEPB_ECO57      -----------------------------WVRDTINAPAEELGPSQLAQRISNVASDRVTYRITKGEDLR
PEPB_SHISS      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_SHIF8      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_SHIDS      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOSE      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO8A      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO55      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO24      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOUT      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOLI      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOLC      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOL6      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOL5      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOK1      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOHS      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECODH      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOBW      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO81      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO45      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECO27      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOSM      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_ECOLU      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_SHIBS      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_SHIB3      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
PEPB_KLEP3      -----------------------------WVRDTINAPAEELGPEQLAQRAVDLLVAGEKVSITKGEDLR
PEPB_CITK8      -----------------------------WVRDTINAPAEELGPEQLAQRLCSVACDHVSYRITKGEDLR
PEPB_SALAR      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDHVTYRITKGEDLR
PEPB_SALTY      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALPC      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALPB      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALNS      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALG2      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALEP      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALDC      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SALA4      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_SERP5      -----------------------------WVRDTINMSAEELGPEQLATRVDLMCDIGCEAVSYRITKLR
PEPB_SALCH      TVMWPDLDDAQRQELDNRLTIID------WVRDTINAPAEELGPEQLAQRLCSVACDSVTYRITKGEDLR
PEPB_YERPY      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPS      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPP      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPN      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPG      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPE      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPB      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERPA      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_YERP3      -----------------------------WVRDTINAPAEDLGPEQLAKNLCAVSCDAVSYRITKGEDLR
PEPB_ECO7I      -----------------------------WVRDTINAPAEELGPSQLAQRISNVAGDRVTYRITKGEDLR
AMPL_CAEEL      ----------DKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVEAVKVGNATGSKITVIRGEELL
PEPL1_PONAB     -------------------------DGVRLAARIVDTPCNEMNTDTFLEEINKVKELGIIPTIIRDEELK
PEPL1_HUMAN     -------------------------DGVRLAARIVDTPCNEMNTDTFLEEINKVKELGIIPTIIRDEELK
PEPL1_MOUSE     TVMVELVGQDNPVEVSTLQCLTNATEGVRLAARIVDTPCNEMNTDIFLEEIIQVKELGITPTIIRDEQLK
YH24_CAEEL      GLL--AIGNSDTSARLEKL-VEAYDASFTVCRDVGEAGPERMAPPRVAEYIQGAFANGIKVTVVDDQSLK


                         .         .         .         +         .         .         .:280
query           KLGMNALLGVGQGSIRGSYLVTMEWNGAKNNSNPLAFVGKGVCFDTGGYSLKPAKFMEDMTYDMAGSATV
AMPA_EHRRG      ANQMMALLGVGQGSAKKSRLVVMKWNGGDESESPIAFVGKGVTFDTGGISLKPSKGMWDMKYDMAGSASV
AMPA_EHRRW      ANQMMALLGVGQGSAKKSRLVVMKWNGGDESESPIAFVGKGVTFDTGGISLKPSKGMWDMKYDMAGSASV
AMPA_MESSB      KLGMGALLGVAQGSVRPPRLVVMQWNGGKPKQKPVAFVGKGVVFDTGGISIKPAASMEDMKGDMAGAAAV
AMPA_XANP2      RAGMHTLLGVGQGSIKESRVVIMRWNGGPAGEPPVAFIGKGVTFDTGGISIKPAAGMEDMKGDMGGAACV
AMPA_BRASB      KLGMGALLGVGQGSARPSRTVVMRYNGGKKGDQPVAFIGKGVCFDTGGISIKPAGSMEDMKGDMGGAACV
AMPA_PHYAS      KLGMNALLGVAQGSQRPPYLVVMKWLGGNENEKPVAFVGKGVVFDTGGISLKPSNKMEDMKGDMAGAATV
AMPA_BRAJA      KLGMGALLGVGQGSTRPSRTVIMRWDGGKKGEAPVAFVGKGVCFDTGGISIKPAGSMEDMKGDMGGAACV
AMPA_RHISN      KLGMGALLGVAQGSSRPPRLVVMQWKGGKAKDKPLAFIGKGVVFDTGGISIKPASGMEEMKGDMGGAAAV
AMPA_OCHA4      KLGMGALLGVAQGSVRPPRLVIMEWQGAKSKEKPVAFVGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAV
AMPA_RHOPT      QLKMGALLGVSQGSAHPGRTVIMRWNGGKKGEQPLAFVGKGVCFDTGGISIKPSASMEDMKGDMGGAACV
AMPA_RHOPA      QLKMGALLGVSQGSAHPGRTVIMRWNGGKKGEQPLAFVGKGVCFDTGGISIKPSASMEDMKGDMGGAACV
AMPA_RHIME      KLGMGALLGVAQGSSRPPRLVVMQWKGGKAKEKPVAFIGKGVVFDTGGISIKPASGMEEMKGDMGGAAAV
AMPA_NITWN      KLGMGALLGVGQGSARPSRTVVMRWNGGKKGEPPVAFVGKGVCFDTGGISIKPANGMEEMKGDMGGAACV
AMPA_RHILW      RFGMGALLGVAQGSVRPPRLAVMQWKGGKAKDRPVAFIGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAV
AMPA_RHIEC      RLGMGALLGVAQGSVRPPRLAVMQWKGGKAKDRPVAFVGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAV
AMPA_RHIL3      RLGMGALLGVAQGSVRPPRLAVMQWKGGKGKDRPVAFIGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAV
AMPA_SINMW      KLGMGALLGVAQGSSRPPRLVVMQWKGGKAKDKSVAFIGKGVVFDTGGISIKPASGMEDMKGDMGGAAAV
AMPA_OLICO      KLGMGALLGVSQGSYHPGRMVVMRWNGASNKADPVAFVGKGVCFDTGGISIKPAGSMEEMKGDMAGAACV
AMPA_AGRT5      KLGMNALLGVAQGSARPPRLAVMQWNGGSKKDEPIAFVGKGVVFDTGGISLKPGLGMEDMKGDMGGAAAV
AMPA_RHIE6      RLGMGALLGVAQGSVRPPRLAVMQWKGGRAKDRPIAFIGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAV
AMPA_RHOPB      RLKMGALLGVSQGSTQPGRTVIMRWNGGKKGEQPVAFVGKGVCFDTGGISIKPSGSMEDMKGDMGGAACV
AMPA_WOLPM      EKKMGALLGVAQGSSKEPKLVVIKWNGASKEQKPIAFVGKGITFDTGGVSLKPSRGMESMKYDMAGSATV
AMPA_RHOP5      KLKMGALLGVAQGSARPARTVIMRWNGGKKGAAPIAFVGKGVCFDTGGISIKPSASMEDMKGDMGGAACV
AMPA_RHOP2      QLKMGALLGVSQGSAHPGRTVIMRWNGGKRGEQPVAFVGKGVCFDTGGISIKPSASMEDMKGDMGGAACV
AMPA_RHOPS      RLKMGALLGVSQGSAHPGRTVIMRWNGGKRGAQPVAFVGKGVCFDTGGISIKPSASMEDMKGDMGGAACV
AMPA_AGRRK      RLGMGALLGVAQGSVRPPRLVIMQWKGGKAKEKPVAFIGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAV
AMPA_RHILO      KLGMGSLLGVAQGSPRGARMAVMQWNGGKPKDGPIAFVGKGVTFDTGGNSMKPASGMEDMKGDMGGAAAV
AMPA_NITHX      KLGMGALLGVGQGSARPSRTVIMRWNGGKKGEPPVAFVGKGVCFDTGGISIKSXXXXXXXXXXXXXXXCV
AMPA_RICBR      NLGMGALLGVGQGSQNESKLVVMEYQGANKDAPYIALVGKGVIFDTGGISLKPSNNMHLMRYDMCGSAAV
AMPA_RICB8      NLGMGALLGVGQGSQNESKLVVMEYQGTNKDAPYIALVGKGVIFDTGGISLKPSNNMHLMRYDMCGSAAV
AMPA_CAUCR      KLGMGSLLGVGQGSVRESQLVIMKWMGAADKSQPIAFVGKGVCFDTGGISIKPADGMEDMKWDXXXXXXX
AMPA_PHYMT      ELGMNALLSVAQGSSRPPYLVIMQWNGSDNKEEPLAFVGKGVVFDSGGISIKHSSGMEDMKADMGGAGTV
AMPA_GLUOX      ELGFGALLGVAQGSVHKPRTVIVRHNGGGSEA-PLAFIGKGVTFDSGGISIKPAAGMDEMKTDMGGAATV
AMPA_RICCK      NLGMGALLGVGQGSQNESKLVVMEYKGGSKYPT-IALVGKGVIFDTGGISLKPSSNMHLMRYDMGGSAAV
AMPA_BRUME      XXXXXXXXXXXQGSVRPPRLVVMEWHGAKGKEKPIAFVGKGVVFDTGGISIKPAANMEDMKGDMGGAAAV
AMPA_AGRVS      SLGMGALLGVAQGSVRPPRLAVMQWKGGAPEGQPIAFIGKGVVFDTGGISIKPXXXXXXXXXXXXXXXXV
AMPA_BRUO2      XXXXXXXXXXXQGSVRPPRLVVMEWHGAKGKEKPIAFVGKGVVFDTGGISIKPAANMEDMKGDMGGAAAV
AMPA_BRUSU      XXXXXXXXXXXQGSVRPPRLVVMEWHGAKGKEKPIAFVGKGVVFDTGGISIKPAANMEDMKGDMGGAAAV
AMPA_RICFE      NLGMGALLGVGQGSQNESKLVVMEYKGGNKDVPTIALVGKGVIFDTGGISLKPSSNMHLMRYDMXXXXXX
AMPA_RICM5      NLGMGALLGVGQGSQNESKLVVMEYKGGSKDASTIALVGKGVIFDTGGISLKPSSNMHLMRYDMXXXXXX
AMPA_RICPR      NLGMGALLGVGQGSQNESKLVVMEYKGGSRDDSTLALVGKGVIFDTGGISLKPSSNMHLMRYDMAGSAAV
AMPA_RICPU      NLGMGALLGVGQGSQNESKLVVMEYKGGSKDAPTIALVGKGVIFDTGGISLKPSSDMHLMRYDMXXXXXX
AMPA_RICCN      NLGMGALLGVGQGSQNESKLVVMEYKGGSKDAPTIALVGKGVIFDTGGISLKPSSDMHLMRYDMXXXXXX
AMPA_RICAE      NLGMGALLGVGQGSQNESKLVVMEYKGGSKDAPTIALVGKGVIFDTGGISLKPSSDMHLMRYDMXXXXXX
AMPA_RICRS      NLGMGALLGVGQGSQNESKLVVMEYKGGSKDVPTIALVGKGVIFDTGGISLKPSSDMHLMRYDMXXXXXX
AMPA_RICRO      NLGMGALLGVGQGSQNESKLVVMEYKGGSKDVPTIALVGKGVIFDTGGISLKPSSDMHLMRYDMXXXXXX
AMPA_METPB      ELGMGALLAVAQGSAREPRVAIMRWNGADDPSEPLALIGKGVVFDSGGVSIKSAXXXXXXXXXXXXSAAV
AMPA_DINSH      KLGMGALLGVGQGSESPSKIVVMKWMGGGDGA-PFALVGKGVVFDTGGISIKPSAGMEXXXXXXXXXXXX
AMPA_METEP      EIGMGALLAVAQGSAREPRVVIMRWNGADDAAEPLALIGKGVVFDSGGVSIKSAXXXXXXXXXXXXSAAV
AMPA_RHOS5      XXGMRALLGVGQGSEHPSKLVVMQWKGGPEDQVPLALVGKGVVFDTGGISIKPAAGMEDMTMDMGGAAVV
AMPA_RICTY      NLGMGALLGVGQGSQNESKLVVMEYKGGSRDDSTIALVGKGVIFDTGGISLKPSSNMHLMRYDMXXXXXX
AMPA_METC4      EIGMGALLAVAQGSAREPRVVIMRWNGADDAAEPLALIGKGVVFDSGGVSIKSAXXXXXXXXXXXXSAAV
AMPA_METRJ      ELGMGALLAVAQGSAREPRIVIMRWNGGPAAEAPVALIGKGVVFDSGGVSIKPXXXXXXXXXXXXXXXXX
AMPA_PSEPW      DLGMGAFYAVGQGSEQPPRLIVLQYQGAKKSDKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASV
AMPA_PSEU5      ELGAGAFLAVSQGSDQPGCIIVLQYNGGKKGDKPYALVGKGITFDTGGISLKPGLGMDEMKYDMGGGASV
AMPA_PSEFS      ELGMGSFYAVGQGSDQPPRLIVMQYNGGKKSEKPYALVGKGITFDTGGISLKPGLGMDEMKYDMGGAASV
AMPA1_SHEON     RLNLGALAAVGKGSERPPKLVVAHWPGSKEA--PIALVGKGITFDSGGYNIKATTSIARMKSDMAGAATV
AMPA_PSEPF      SLGMGSFYAVGQGSAQPPRLIVMQYNGGKKSEKPYALVGKGITFDTGGISLKPGAGMDEMKYDMGGAASV
AMPA_CHLL2      ALGMGGLLAVNRGSQHPPTFTVLDYKPEGKVAKTVALVGKGVTFDSGGISLKPSEGMGEMKSDMSGAASV
AMPA_PELCD      REGFGALLAVAQGSARPPRLIVLEYRGGAPDEKPLALVGKGVVFDSGGISLKPGEKMDEMKXXXXXXXXX
AMPA_PSESM      ELGMGSFLAVAQGSAQPPRLIVMNYQGGKKGDKPFVLVGKGITFDTGGISIKPAAGMDEMKFDMCGAASV
AMPA_THISH      KLGMGALLSVSRGSEQPAKLITLEYRGGRKDAKPVVLVGKGITFDTGGISLKPGAEMDEMKFDMCGAASV
AMPA_SACD2      RLGMGAFLSVSKGSDQEGKLILLEYKGAAANKAPHVLVGKGVTFDTGGISLKPGANMDEMKFDMCGAASV
AMPA_PSEPG      DLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASV
AMPA_CLOPE      ELKMESFLSVGKGSDNLPRLIVMRYFGDKDNMDQLALVGKGLTYDSGGYSLKTNAGMVTMKADMXXXXXX
AMPA_PSEPK      DLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASV
AMPA_PSEA7      ELGMGSFLAVAQGSEQPPRLIVLQYNGAKKDQAPHVLVGKGITFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_PSEU2      DLGMGSFLAVAQGSAQPPRLIVMNYQGGKKGDQPFVLVGKGITFDTGGISIKPASGMDEMKFDMCGAASV
AMPA_PSEAE      ELGMGSFLAVAQGSDQPPRLIVLQYNGAKKDQAPHVLVGKGITFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_PSEA8      ELGMGSFLAVAQGSDQPPRLIVLQYNGAKKDQAPHVLVGKGITFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_PSEP1      DLGMGAFYAVGQGSDQPPRLIMLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASV
AMPA_CLOTE      ELGMEAFLAVSKGSFEESQLIVMNYKGNSNSDKKLALVGKGLTYDSGGYSIKPTSSMINMHSDMAGSASV
AMPA_CLOPS      ELKMESFLSVGKGSDNLPRLIVMRYFGDKDNMDQLALVGKGLTYDSGGYSLKTNAGMVTMKSDMXXXXXX
AMPA_PSEPU      DLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASV
AMPA_METFK      KLGMGSFLGVTKGSVQPPKLIVLQHRKGKKSQKPVVLVGKGITFDTGGISLKPGADMDEMKYDMCGAASV
AMPA_PSEAB      ELGMGSFLAVAQGSDQPPRLIILQYNGAKKDQAPHVLVGKGITFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_FUSNN      KLGMNAYLSVARAAHHRPYVIVMRYKGNAKSKYTFGLVGKGLTYDTGGLSLKPTDSMLTMRCDMGGAATM
AMPA_ALHEH      KLGMGALLAVAQGSQEEPRLIAMEWNGGKKDEQPYVLVGKGITFDTGGISLKPGAAMDEMKFDMCGAASV
AMPA_PSEE4      ELGMGAFYAVGQGSDQPPRLIVLNYQGGKKSEKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASV
AMPA_CENSY      KXXXXXXXXXXXXSSNEPRLIIVEYNGGKKGQKPIVLVGKAVTFDTGGISIKPGEKMDEMKFDKCGGCTV
AMPA_ACISJ      KLGMGAFLAVAQGSDQPLRLVELRYNGAARTQAPVVLVGKGITFDTGGISLKPAAEMDEMKFDMGGAASV
AMPA_LEGPC      EMGMGALLAVAQGSDQPPRLIDIHYHGNKN-STPVILVGKGITFDSGGLSIKPANAMDEMKYDMSGAASV
AMPA_DIAST      KLGMGAFLAVAQGSDQPLRLVELRYNGAARTQAPVVLVGKGITFDTGGISLKPAAEMDEMKFDMGGAASV
AMPA_DECAR      KLGMHSLLSVARGSHQPPKLIVLTYKGARASEKPIVLVGKGVTFDTGGISLKPGAEMDEMKYDMCGAASV
AMPA_LEGPL      EMGMGALLAVAQGSDQPPRLIDIHYHGNKNSA-PVILVGKGITFDSGGLSIKPANAMDEMKYDMSGAASV
AMPA_ALCBS      KMGMGAFHAVAKGSERQGQIIVMEYKGAKTKQGPVALVGKGITFDTGGISLKPGATMDEMKYDMGGAASV
AMPA_VESOH      KLGMGSLLAVSKGSSEPPKLISLSYRG-NGNEKPIVLVGKGVTFDSGGISLKPGTGMDEMKYDMCGAASV
AMPA_ACIAD      DLGMNAFLAVSQGSDRPGRIITLEYN-AQLEQAPVVLVGKGVTFDTGGISIKPAQGMDEMKFDMCGAASV
AMPA_RALEJ      ALNMGSFLAVTKGSVEPPQFIVLRYDGAGAKQAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAASV
AMPA_BURP8      ALKMGSFLAVTQGSVEPPQFIVLQYQGGAAKAAPVVLVGKGITFDTGGISLKPGDSMDEMKYDMCGAGSV
AMPA_SHEDO      KLGMNSYLAVGRGSSNESIMTVMEYKGAVDSADPIVLVGKGLTFDSGGISLKPGEAMDEMKYDMGGAAGV
AMPA_LEGPA      EMGMGALLAVAQGSDQPPRLIDIHYHGNKNSA-PVILVGKGITFDSGGLSIKPANAMDEMKYDMSGAASV
AMPA_AZOVD      XXGMGAFLAVAQGSDQPPRLIVLDYQGGKKDEQPFVLVGKGITFDSGGISLKPGSGMDEMKYDMCGAASV
AMPA_GEOSM      SLGMNALLGVGKGAAEPPRLIVLRYRGEGAKGRPVVLVGKGITFDSGGISIKPGPGMEEMKTDMAGAAAV
AMPA_ACIBY      DLGMYAFLAVSKGSERPGRIVTLEYQ-AQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_ACIBT      DLGMYAFLAVSKGSERPGRIVTLEYQ-AQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_ACIBC      DLGMYAFLAVSKGSERPGRIVTLEYQ-AQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_ACIB5      DLGMYAFLAVSKGSERPGRIVTLEYQ-AQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_ACIB3      DLGMYAFLAVSKGSERPGRIVTLEYQ-AQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_TERTT      KLGMGAFHSVAKGSDLDAQLIIMEYKGAGGKSQPHVLVGKGITFDTGGISLKPGANMDEMKFDMGGAASV
AMPA_BURP1      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA2_SHEON     KLGMNSYLAVGRASANESIMTVMEYKGAVDSTEPIVLIGKGLTFDSGGISLKPGEAMDEMKYDMGGAAGV
AMPA_BURPS      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURP6      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURP0      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURMS      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURMA      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURM9      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURM7      ALKMGSFLSVAKGSVEPPQFIVLQYRGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_HAES2      ELNMFSYLAVSQGSANEAKMSVIEYNHPDKNAKPIVLVGKGLTFDAGGISLKPADSMDEMKYDMCGAASV
AMPA_CHLT3      ELKMGGLLGVNKGSVIPPTFSIMEYKPEGESLGRVALVGKGVMFDTGGISIKPSSXXXXXXXXXXXXXXV
AMPA_AZOSE      KLGMGSLLSVARGSHQPPRFIVMHYKGGKSKDKPVVLVGKGITFDSGGISLKPGAEMDEMKFDMCGAASV
AMPA_SHEFN      KLGMNSYLAVGRASANESIMTVMEYQGAVDSTEPIVLVGKGLTFDSGGISLKPGEAMDEMKYDMGGAAGV
AMPA_NITEU      ELGMGALLAVARGSHQPAKLIVLEYHGGKDSEKPVALVGKGVTFDAGGISLKPAAEMDEMKYDMGGAASV
AMPA_CHRVO      ELGMHSFLSVAKGSAEEARLIVLKHHGAKDNDKPIVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAATV
AMPA_ALKOO      KLGMGSFLGVTKGSEEPPKLIAIKYFGNKEDEEIIGLVGKGLTFDSGGISLKPGAGMDAMKSDMGGAAAV
AMPA_ACIBS      DLGMYAFLAVSKGSERPGRIVTLEYQ-AQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
AMPA_NITEC      ALGMGALLAVARGSHQPAKLIVLEYHGREGIEKPVVLVGKGVTFDTGGISLKPAVDLDEMKYDMGGAASV
AMPA_BURTA      ALKMSSFLSVAKGSVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAGSV
AMPA_SHEPW      KLGMNSYLAVGRGSDNESVMTIMEYKGAVDNTQPIVLIGKGLTFDSGGISLKPGEGMDEMKYDMGGAAGV
AMPA_BURM1      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPIVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURXL      ALKMGSFLSVTAGSVEPAQFIVLQYQGGAAKAAPVVLVGKGVTFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_RALME      ALNMGAFLAVTKGSVEPPQFIVLRYDGASAKQAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAASV
AMPA_HAES1      ELNMFSYLAVSQGSANEAKMSVIEYNHPDKNAKPIVLVGKGLTFDAGGISLKPADSMDEMKYDMCGAASV
AMPA_CUPTR      ALNMGAFLAVTKGSAEPPQFIVLRYDGGGARQAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAASV
AMPA_BURVG      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURPP      ALKMGSFLSVTAGSVEPAQFIVLQYQGGAAKAAPVVLVGKGVTFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_WIGBR      NIGMNAYLHVSKGSSKNPYLSIIKYNENKNGKSPIILIGKGLTFDSGGISIKPSNNMDEMKFDMCGAAAV
AMPA_JANMA      ALKMGSFLSVTNGSVEPPKFIVLKHNGGKAKDAPTVLVGKGITFDSGGISLKPGAAMDEMKYDMGGAASV
AMPA_HAEIN      KLGMNAYLAVSKGSENRAYMSVLTFNNAPDNAKPIVLVGKGLTFDAGGISLKPAADMDEMKYDMCGAASV
AMPA_HAEIE      KLGMNAYLAVSKGSENRAYMSVLTFNNAPDNAKPIVLVGKGLTFDAGGISLKPAADMDEMKYDMCGAASV
AMPA_HAEI8      KLGMNAYLAVSKGSENRAYMSVLTFNNAPDNAKPIVLVGKGLTFDAGGISLKPAADMDEMKYDMCGAASV
AMPA_SHELP      KLGMNSYLAVGRGSHNESVMTVMEYKGAVDSTEPIVLVGKGLTFDSGGISLKPGEAMDEMKYDMGGAAGV
AMPA_RALEH      ALNMGAFLAVTKGSEEPPQFIVLRYDGAGAKQAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAASV
AMPA_PARUW      KEQMGLLLAVNRGSNLDPTLIIMEYKGNPKSKDHTVIIGKGVTYDTGGLNIKPTGGIETMKCDMSGGAAC
AMPA_MANSM      KLGMNAYLAVSCGSKNEAKLSVMEYRNHENNAKPIVLAGKGLTFDAGGISLKPAADMDEMKYDMCGAASV
AMPA_CHLP8      ELKMGGLLAVNKGSEQPPTFTIMDYKPEGKAKKTIALVGKGVTFDSGGISLKPAQGMEEMKSDMXXXXXX
AMPA_RHOFD      RLGMGAFMAVAQGSEEPLRFIVLRYDGAQKSAAPTVLLGKGITFDSGGISIKPAADMDEMKFDMSGAASV
AMPA_SHESH      KLGMNSYLAVGRGSDNESIMTVMEYKGAVDNTEPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMGGAAGV
AMPA_HAEIG      KLGMNAYLAVSKGSENRAYMSVLTFNNALDNAKPIVLVGKGLTFDAGGISLKPAADMDEMKYDMCGAASV
AMPA_ACTSZ      ELGMHAYLGVSQGSKNEAQLSVMTYNHPDPHAKPIVLVGKGLTFDAGGISLKPSADMDEMKYDMCGAASI
AMPA_COLP3      ELGMGSYLAVGRGSVNESLMSIIKYDGAGDDSKPLVLVGKGLTFDSGGISLKPGAGMDEMKYDMGGAAGV
AMPA_GEOSL      RQGMEGILSVAKGSHQLPRFIVLEYRGGSADKRPTVLVGKGITFDSGGISLKPREGMERMKDDXXXXXXX
AMPA_IDILO      KLGMNAYLAVGRGSEHESVLTLMHYKGAADDQAPIVLVGKGLTFDSGGISIKPSANMDEMKYDMGGAAGV
AMPA_PERMH      KMGMNAYLAVAKGSANPPRFIHIIYRPEKPKKK-IALIGKGLTFDSGGLNIKPGDYMRWMKADKSGACAV
AMPA_HAEDU      TLGMNAYLAVSQGSHNPAFLSVIEYNHHPDPSKPIVLVGKGLTFDAGGISLKPSDAMDEMKYDMGGAAAV
AMPA_PSYIN      ELKMDSYLAVAKGSANPAYMSLMHYNGGNADQKPIVLVGKGLTFDSGGISLKPGEAMDEMKYDMGGAASV
AMPA_RALPJ      ALKMGAFLAVTKGSVEPPAFIVLRYEGGPAKQAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAASV
AMPA_HAHCH      ELGMGSFLSVSAGSDQPARLIVIEYKGGDDKQKNHVLVGKGITFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_PSEA6      ALGMHSYLAVGRGSVNESIMTIMEHKGGPADQAPIVLVGKGLTFDSGGISIKPGEAMDEMKYDMGGAAGV
AMPA_THICR      KMGMGSFMAVAQGAHTPPKMICLSYQGADASEAPIALVGKGVTFDTGGISLKPGEAMDEMKYDMGGAATV
AMPA_PHOPR      ELGMTSYLAVGQGSKNEAMMSVIEYKGSADDAKPIVLIGKGLTFDSGGISIKPSAQMDEMKYDMCGAASV
AMPA_PELLD      SLRMGGLVAVNQGSLNPPTFTVMDYVPKKKAKATIALVGKGVTFDSGGISIKPSEGMGDMKSDMXXXXXX
AMPA_CHLPN      KEKMGLLLAVSKGSCVDPHFIVVRYQGRPKSKDHTVLIGKGVTFDSGGLDLKPGKSMLTMKEDMAGGATV
AMPA_PROMH      ELNMNAYLAVGQGSQNESLMSIIEYKGNQDESRPIVLVGKGLTFDSGGISIKPADGMDEMKYDMCGAATV
AMPA_CHLTE      ELGMGGLLAVNKGSEQPPTFVILDYKPKGKAKKTIALVGKGVTFDSGGISLKPAQGMDEMKSDMSGXXXX
AMPA_XANCP      ALGMGSLLSVARGSANRPRLIVLKWNGG-GEARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_XANCB      ALGMGSLLSVARGSANRPRLIVLKWNGG-GEARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_XANC8      ALGMGSLLSVARGSANRPRLIVLKWNGG-GEARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_SERP5      ELGMNAYLAVGAGSRNESLMSVMEYKGNPNDAKPIVLVGKGLTFDAGGISIKPAEGMDEMKYDMCGAATV
AMPA_HERAR      ALKMGSFLSVTNGSVEPPKFIVLKHMGGKAKDAPVVLVGKGITFDSGGISLKPGAAMDEMKYDMGGAASV
AMPA_BURCM      ALNMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEAMDEMKYDMCGAGSV
AMPA_BURA4      ALNMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEAMDEMKYDMCGAGSV
AMPA_XANOR      ALGMGSLLSVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGATV
AMPA_XANOP      ALGMGSLLSVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGATV
AMPA_XANOM      ALGMGSLLSVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGATV
AMPA_TOLAT      ELGMNAYLAVAKGSSNEAMMSVMEYKGHPD-AKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMGGAASV
AMPA_RHOBA      AENCRAILAVGRASTSPPRLVMLRHDGGGDEA-PLVVVGKGVTFDSGGLSLKPSDGMVDMKCDMAGAATV
AMPA_BURS3      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_XANC5      ALGMGSLLSVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_RALSO      ALKMGAFLAVTKGSQEPPQFIVLRYEGGPAKQAPVVLVGKGITFDTGGISLKPGEGMDEMKFDMCGAASV
AMPL_ENCCU      RKSMNLLLGVSQGSAQEPKLLVARYRGKSGDAVDIALVGKGVCFDSGGISLKPSARMHRMKGDMLGAASV
AMPA_PASMU      DLGMNAYLAVSQGSVNEAQLSLIEYRNHPNDAKPIVLVGKGLTFDAGGISLKPAEGMDEMKYDMGGAASV
AMPA_EDWI9      ELGMNAYLAVGQGSQNESLMSVIEYKGNPNDARPIVLVGKGLTFDAGGISLKPGEGMDEMKYDMCGAASV
AMPA_BUCAP      NLGMNAYVAVGKGSKNKPYMSVIKYSGINNTEQEIVLIGKGLTFDSGGISIKPSNNMNEMKYDMCGAAAV
AMPA_XANAC      ALGMGSLLSVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_AERHH      ELGMNSYLAVARGSDNEAMMAIIEYKGHPD-AKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMGGAASV
AMPA_LEPIN      KEKMGGILSVCEGSDKKAKMILLEYTPVKPTKKKLAIIGKGLTFDSGGISIKPAQDMHEMKYDMCXXXXX
AMPA_LEPIC      KEKMGGILSVCEGSDKKAKMILLEYTPVKPTKKKLAIIGKGLTFDSGGISIKPAQDMHEMKYDMCXXXXX
AMPA_BUCAT      ELGMNAYIAVGNGSKNKPFMSVIKYSGNNINKKIIAFVGKGLTFDSGGISIKPALHMHEMKYDMCGAAAV
AMPA_AERS4      ELGMNSYLAVARGSENEAMMAIIEYKG-NADAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMGGAASV
AMPA_BURCH      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURCA      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BUCAI      ELGMNAYIAVGNGSKNKPFMSVIKYSGNNINKKIIAFVGKGLTFDSGGISIKPALHMHEMKYDMCGAAAV
AMPA_BUCA5      ELGMNAYIAVGNGSKNKPFMSVIKYSGNNINKKIIAFVGKGLTFDSGGISIKPALHMHEMKYDMCGAAAV
AMPA_ACTP7      ALGMNAYLAVSRGSQNPAYLSVIEYKNHPNDAKPIVLVGKGLTFDSGGISIKPSDSMDEMKYDMGGAASV
AMPA_ERWT9      ELGMNAYLAVGQGSQNESLMSVIEYKGNPDEARPIVLVGKGVTFDTGGISLKPGEAMDEMKYDMCGAASV
AMPA_ACTPJ      ALGMNAYLAVSRGSQNPAYLSVIEYKNHPNDAKPIVLVGKGLTFDSGGISIKPSDSMDEMKYDMGGAASV
AMPA_DESVH      SMGMGAFASVFRGAEEEARLIVIEHAPATEEQQPLVFVGKGVTFDTGGISLKPAAKMHEMKGDMXXXXXX
AMPA_METCA      ELGMGALLSVARGSRQPAKLIVLEYRGAAGKAKPYVLIGKGLTFDAGGISLKPAANMDEMKYDMCXXXXX
AMPA_AZOSB      KLGMGSLLSVAKGSHIPPKFIVMHYKGGKSKAKPVVLVGKGITFDTGGISLKPGAEMDEMKYDMCGAASV
AMPA_BURCJ      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_BURCC      ALKMGSFLSVARASVEPPQFIVLHYQGAAAKAAPVVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSV
AMPA_XYLFM      ALGMGALLAVARGSANRPHLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGAAV
AMPA_XYLFA      ALGMGALLAVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGAAV
AMPA_SYNPW      ERGMGSFLSVCQGSDMDPKFIHLTYRPNDAASKRLVLVGKGLTFDSGGYNLKVGAAQIDMMFDMGGSAAV
AMPA_SODGM      ELGMNAYLAVGQGSANESLMSVIEYKGSPDDARPIVLVGKGLTFDAGGISIKPADSMDEMKYDMCGAATV
AMPA_ERWCT      ELGMNAYLAVGQGSQNESLMSVIEYKGDPNPENPIVLVGKGLTFDSGGISIKPADSMDEMKYDMCGAATV
AMPA_PECCP      ELGMNAYLAVGQGSQNESLMSVIEYKGDPNETRPIVLVGKGLTFDSGGISIKPADSMDEMKYDMCGAATV
AMPA_BORA1      ALGMGSFVSVARGSAEPLRFVVLRYNGKPXXXXPVVLVGKGITFDAGGISIKPAATMDEMKYDMCGAASV
AMPA_VIBHB      KLGMTSYLAVGRGSKNESMMSIIEYKGPESEAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_GEOTN      RLGMGALLAVNQGSKQPPKLIVLKYQGKEQWENVIGLVGKGVTFDTGGYCLKPRDSMIDMKTDMGGAAAV
AMPA_XYLFT      ALGMGALLAVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGAAV
AMPA_XYLF2      ALGMGALLAVARGSANRPRLIVLKWNGG-GDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGAAV
AMPA_NITOC      KLGLGALLAVSRGSRQPPKLITLEYKGAPGKQKPIVLVGKGLTFDAGGISIKPGERMDEMKYDMCGGAGV
AMPA_SULSY      XMGMGAYLAVAKGSDNPPRFIHLTYR-PKNSQGEVAIVGKGLMFDSGGLNIKTGDFMRWMKSDKSGACAV
AMPA_CORDI      KQGFGGILAVGTGSSRKPRLVRLTW-APKKAKKSIALVGKGITFDTGGISLKPGAGMDDMISDMGGSATM
AMPA_BUCBP      KLGMNAYLSVGKGSKNKSLMSIIKYHGISSQCKNIILIGKGVTFDSGGISIKTSRDLDEMKFDMSGAAIV
AMPA_VEREI      RLGMGAFVAVARGSEQPLRFIELRYSAAAKDQAPIVLVGKGITFDSGGISIKPAPEMDEMKFDMCGAASV
AMPA_VARPS      KLGMGSFAAVAQGSAEPLRFIVLRYQGGPKDQAPVVLVGKGITFDTGGVSLKPAAEMDEMKFDMCGAASV
AMPA_BAUCH      ELGMNAYLAVGQGSANESLMSIIEYQGLDSKARPIVLVGKGLTFDSGGISIKPSNKMNEMKYDMCGAATV
AMPA_VIBPA      KLGMTSYLAVGRGSKNESMMSIIEYKGPDSDAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_SALAR      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALTY      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALSV      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALPK      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALPC      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALPB      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALPA      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALNS      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALHS      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALG2      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALEP      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALDC      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALCH      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SALA4      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_VIBVY      KLGMSSYLAVGRGSKNESMMSIIEYKGHPDSAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_VIBVU      KLGMSSYLAVGRGSKNESMMSIIEYKGHPDSAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_GEOSW      KLGMGAFLAVNQGSKNPPKMIVLKYQGKETWENVIGLVGKGVTFDTGGYSLKPRESMVDMKTDMAGAAAV
AMPA_CHLMU      KEKMGLLAAVAKGSAVEPRFIVLDYQGKPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATV
AMPA_ACTP2      ALGMNAYLAVSRGSQNPAYLSVIEYKNHPNDAKPIVLVGKGLTFDSGGISIKPSDSMDEMKYDMGGAASV
AMPA_SALTI      ELGMNAYLAVGHGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_EXIS2      ALGMGALLAVNQGSTIPPKLIVLEYKGAGDDA-PIAVVGKGVTFDTGGYSIKPKDGIVGMKGDMGGAAAV
AMPA_CHLCV      KEKMGLLAAVAKGSAVDPCFIVLTYQGKPKSKDHTVLIGKGVTFDSGGLDLKPGKAMLTMKEDMAGAATV
AMPA_SHISS      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SHIFL      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SHIF8      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SHIBS      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_SHIB3      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ESCF3      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ENT38      ELGMHSYLAVGNGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAAAV
AMPA_ECOUT      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOSM      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOSE      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOLU      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOLI      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOLC      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOL6      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOL5      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOK1      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOHS      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECODH      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECOBW      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO8A      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO81      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO7I      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO5E      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO57      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO55      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO45      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO27      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_ECO24      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_CITK8      ELGMHSYLAVGHGSQNESLMSVIEYKGPSEDARPVVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAAAV
AMPA_SHIDS      ELGMHSYLAVGQGSQNESLMSVIEYKGASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
AMPA_KLEP7      ELGMNAYLAVGNGSQNESLMSVIEYKGPAEDARPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAAAV
AMPA_DESAH      RLGMGGILAVNQGSGEPPKLVVLEYL-PENRSETLLLVGKGVTFDSGGISLKPAPGMEKMKYDMCGGAAV
AMPA_AQUAE      EMGMMALYSVGKGSATPPRFIHLIYKPSGKPKEKIALVGKGLTFDSGGLNIKPGDYMRTMKMDKSGACAV
AMPA_YERPY      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPS      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPP      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPN      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPG      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPE      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPB      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERPA      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_YERP3      ELGMHAYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_KLEP3      ELGMNSYLAVGNGSQNESLMSVIEYKGPSEDARPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAAAV
AMPA_METPP      KLGMGSFLAVAQGSDEPPKFIVLRYDGASRSDAPVVLVGKGITFDTGGISIKPAAEMDEMKYDMGGAASV
AMPA_VIBCM      KLGMASYLAVGRGSRNESMMSVIEYKGNPDEAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_VIBCH      KLGMASYLAVGRGSRNESMMSVIEYKGNPDEAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_VIBC3      KLGMASYLAVGRGSRNESMMSVIEYKGNPDEAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASV
AMPA_HAMD5      KLGMNAYLAVGQGSKNESLMSIIEYKSGKAGTKPIVLVGKGMTFDSGGISIKPSQNMDEMKYDMCGAATV
AMPA_GEOUR      QNSMNALLAVAKGSHEPPKFIILEYRGGGEDDAVTVLVGKGVTFDSGGISLKPREGMEXXXXXXXXXXXX
AMPA_BDEBA      KEKMGGLLGVSNGSDQEPRFIIMEYKGAAASKKPVCFVGKGLTFDCGGISIKPGAGMEEMKYDMCGGANV
AMPA_YERE8      ELGMHSYLAVGHGSQNESLMSVIEYKGNPNDAKPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAATV
AMPA_CHLAB      KEKMGLLAAVAKGSAVDPRFIVLSYQGKPKSKDHTVLIGKGVTFDSGGLDLKPGKAMLTMKEDMAGAATV
AMPA_BACCR      DLGMGALLAVNQGSVEPPKMIALIYKGKEEWKDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_BACC2      DLGMGALLAVNQGSVEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_TRIEI      KLGMGAFLGVAQGSDLPPKFIHVTYKPEVTPRRKLAIVGKGLTFDSGGLNLKVSSGIEMMKIDMGGAGTT
AMPA_BACC4      DLGMGALLAVNQGSVEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_ALISL      KLGMTSYLAVGQGSHNESMMSVMEYKGHPNDAKPIVLIGKGLTFDSGGISLKPSDSMDEMKYDMCGAASV
AMPA_PROMA      KEGMGAYLAVSQGSDLEPQFIHLTYKPNGQIKRRIAMVGKGLTFDSGGYNLKVASQIEMMKYDMGGSAAV
AMPA_HAEPS      ALQMNAYLAVSRGSENDAYLSIIEYKGSPNPAKPIVLVGKGLTFDTGGISIKPSDAMDEMKYDMGGAASV
AMPA_BACSU      ELGMGGILAVNQGSTEPPKMIVLKYQGKKEWEDVVGLVGKGITFDTGGYSIKTKSGIVGMKSDMGGAAAV
AMPA_CHLPD      DLAMGGLLAVNQGSTHPPTFSILDYKPEXXXXXXXXXXXXXXTFDSGGISLKPSEGMGEMKSDMSGXXXX
AMPA_BACP2      ELGMGGILAVNRGSTEPPKLIVLKYQGKEEWTDVIGLVGKGITYDTGGYSLKPRASMIGMKTDMGGSASV
AMPA_PROM4      AKNMGAFLAVSQGSDLSPKFIHLTYRAKGEIKRRIAMVGKGLTFDSGGYNLKVASQIEMMKYDMGGSAAV
AMPA_CYAP8      KLGMGSFLGVAKASDLPPKFIHLTYKPSGTPKKKLAIVGKSLTFDCGGLNLKVAASIEMMKMDMGGGAAT
AMPA_GLOVI      RLGMGAYLGVAQGTDLPPKFIHLTYKPAHSAPRKIAIIGKGITFDSGGLSIKPAKGMELMKVDMXXXXXX
AMPA_BLOFL      TIGMHAYLAVGSGSIYPAVMPIIKYNPKGPNTNPIILIGKGVTFDSGGISIKPSDKMDEMKYDMCGAAAV
AMPA_VIBFM      KLGMTSYLAVGQGSHNESMMSIMEYKGHPDTAKPIVLIGKGLTFDSGGISIKPSEGMDEMKYDMCGAASV
AMPA_CHLFF      KEKMGLLAAVAKGSAVDPCFIVLSYQGKPKSKDHTVLIGKGVTFDSGGLDLKPGKAMLTMKEDMAGAATA
AMPA_CORGL      DQGFGGILAVGNGSSRKPRLLRIDWKPRKAKKS-IALVGKGITFDTGGISIKPGASMENMISDMGGSASV
AMPA_VIBF1      KLGMTSYLAVGQGSHNESMMSIMEYKGHPDPAKPIVLIGKGLTFDSGGISIKPSEGMDEMKYDMCGAASV
AMPA_SYNS3      ARGMGSFLSVCQGSDMDPKFIHLTYRPSGPATKRVVLVGKGLTFDSGGYNLKVGAAQIDMMFDMGGSAAV
AMPA_ACIBL      EKKMGAFWSVSQGSEEPPALIVMKYEPAGAPQSPLGLVGKGITFDTGGISIKPADGMEKMKYDXXXXXXX
AMPA_NITMU      DLGMGALLAVARGSRQPPKLIALEYWXXXXXXXXXXXXXXXXTFDTGGISLKPAGEMDEMKYDMCGAASV
AMPL1_ARATH     ELKMGSYLAVAAASANPPHFIHLVYKPPNGSKTKLALVGKGLTFDSGGYNIKPGCSIELMKFDMGGSAAV
AMPA_PHOLL      ELGMNAYLAVGQGSQNESLMSVMEYKGSSDHAKPIILVGKGLTFDSGGISIKSAGGMDEMKYDMCGAATV
AMPA_SYNPX      ARGMGAFLCVSQGSDLDPKLIHLIYRPDGEVKRRVALVGKGLTFDSGGYNLKVGAAQIDMMFDMGGSAAV
AMPA_PROM9      DLGMGAYLAVAKGSDLDPKFIHLTLKSEGPIKEKIAIVGKGLTFDSGGYNLKVASQIEMMKYDMXXXXXX
AMPA_ANAVT      KLGMGAFLGVALASDLPPKFIHLTYKPESTPKRKLAIVGKGLTFDSGGLNIKGASGIETMKIDMXXXXXX
AMPA_CHLTR      KEXXXXXXXXXXXXXXEPRFIVLDYQGKPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATV
AMPA_POLSJ      KLGMGSFMAVAQGTSEPLRFIVLRYEGAAKSVAPVVLIGKGITFDTGGISIKPAAEMDEMKFDMCGAASV
AMPA_DESDA      KESMGCLLAVGQGSGRPPRLVILEHAPGHEQEKPLILVGKGITFDTGGISLKPAANMHQMKADMXXXXXX
AMPA_CHLTB      KEXXXXXXXXXXXXXXEPRFIVLDYQGKPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATV
AMPA_CHLT2      KEXXXXXXXXXXXXXXEPRFIVLDYQGKPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATV
AMPL_BOVIN      EQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATI
AMPA_TREDE      ALKMEAFLNVARASTKEPKLIVMEYYNNPGSNEKIALVGKGLTYDSGGYAIKPATSMVDMFTDMGGSGTV
AMPA_CHLTA      KEXXXXXXXXXXXXXXEPRFIVLDYQGNPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATV
AMPL3_ARATH     ELKMGSYLAVAAASANPPHFIHLIY---KPSSGPLALVGKGLTFDSGGYNIKPGCLIELMKFDMGGSAAV
AMPA_ACAM1      AQGMGAFLGVSLASELPPKFIHLTYKPSGTPRRKLAIVGKGVTFDSGGLNLKVGSGIETMKMDMAGSGAT
AMPL_HUMAN      EQAMGSFLSVAKGSDEPPVFLEIHYKGSPNNEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATI
AMPA_COREF      TDGFGGILAVGNGSSRKPRLLRLTWKHRKASKH-VALVGKGVTFDTGGISLKPGANMDNMISDMGGSXXX
AMPA_ACIF5      ALGMHLLLGVAHGSRQPPRLIILEYRGGAENQAPIVLVGKGITFDAGGISLKPADKMDEMKYDMCGGXXX
AMPA_ACIF2      ALGMHLLLGVAHGSRQPPRLIILEYRGGAENQAPIVLVGKGITFDAGGISLKPADKMDEMKYDMCGGXXX
AMPA_PROMP      DLGMGAYLAVAKGSDLEPKFIHLTLKSTSPVKEKIALVGKGLTFDSGGYNLKVASQIEMMKYDMXXXXXX
AMPA_PROM0      DLGMGAYLAVAKGSDLNPKFIHLTLKSDGPIKEKIALVGKGLTFDSGGYNLKVASQIEMMKYDMXXXXXX
AMPA_ANASP      KLGMGAFLGVALASDLPPKFIHLTYKPEGTPKRKLAIVGKGLTFDSGGLNIKGASGIETMKIDMXXXXXX
AMPA_THEEB      ALGMGAFLGVAQASDLPPKFIHLTYTSPGTVHRKIALVGKGLTFDSGGLNLKTQGGIETMKMDMGGAAAV
AMPA_SYNR3      ERGMGAYLAVAQGASRFLHLVIRPQGPVKRK---LALVGKGLTFDSGGYNLKVGSQIELMKFDMGGCGAV
AMPA_ROSCS      EQGFGGILAVGQGSVNEPRFIVIDYGAQYADAPTICLAGKGMTFDSGGISIKPAENMDAMKMDMSXXXXX
AMPA_STRM5      ALGMGSLLAVARGSANRPRLVVLKWNNG-GDAKPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_BORPE      ALGMGSFLSVARGSLRFIVLRHXXXXXXXXXXXXVVLVGKGITFDAGGISLKPAATMDEMKYDMCGAASV
AMPA_BORPA      ALGMGSFLSVARGSLRFIVLRHXXXXXXXXXXXXVVLVGKGITFDAGGISLKPAATMDEMKYDMCGAASV
AMPA_BORBR      ALGMGSFLSVARGSLRFIVLRHXXXXXXXXXXXXVVLVGKGITFDAGGISLKPAATMDEMKYDMCGAASV
AMPA_PROMS      DLEMGAYLAVAKGSDLDPKFIHLTLKSEGPIKEKIALVGKGLTFDSGGYNLKVASQIEMMKYDMXXXXXX
AMPL_RAT        EQEMGSFLSVAKGSEEPPVFLEIHYTGSPNATEPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATI
AMPA_STRMK      ALGMGSLLAVARGSANRPRLVVLKWTGG-GDAKPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGANV
AMPA_SYNJB      ALGMGAFLGVAKASDLPPQFIHLTYKPAQGDPTKLALVGKGLTFDSGGLNIKTSRSIAMMKTDMXXXXXX
AMPA_BACA2      ELGMGGLLAVNKGSSEPPKMIVLKYQGKDQWEDVIGLVGKGITFDTGGYSIKPKTGIVGMKSDMGGAASV
AMPA_BORPD      ALGMGSFLSVARGSLRFIVLRHXXXXXXXXXXXXVVLVGKGITFDAGGISLKPAATMDEMKYDMCGAASV
AMPL_MOUSE      EQEMGSFLSVAKGSEEPPVFLEIHYMGSPNATEPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATI
AMPA_STRGG      KXXXXXXXXXXXXASRGPRLVKLAYTHPKAEKT-LALVGKGITYDSGGISLKPAGHNETMKCDMXXXXXX
AMPL2_ARATH     ELKMGSYLAVAAASANPPHFIHLIY---KPSSGPLALVGKGLTFDSGGYNIKPELIIELMKIDVGGSAAV
AMPA_WOLSU      KEQMGAFLAVSRASIHRPRLIHLTHQSPKPKLK-VALVGKGLTYDSGGLSLKPADFMVTMKADKGGGCAV
AMPA_CYAP4      ALGMGAFLGVALASDLPPQFIHLTYRPSGTPRRKLAIIGKGLTFDSGGLNLKTGSGIETMKMDMAGSAAT
AMPL2_ORYSJ     ELKMGSYLGVAAASANPPHFIHLCYKPPGGNAKKLAIVGKGLTFDSGGYNIKPGCSIELMKFDMGGSAAV
AMPA_MICAN      SLGMGAFLGVAKASDIPPKFLHLIYKPQGTPKRKLAIVGKSLTFDSGGLNIKGASGIETMKMDMXXXXXX
AMPA_POLNA      KLGMGAFLAVAQGTAEPLRFIVLRYEGAAKAEAPVVLIGKGITFDTGGISIKPAAEMDEMKFDMCGAASV
AMPA_ACIC5      ELKMGSFWSVTQGSDEPPALIVMEYTPEGAAEGPLGLVGKGITFDSGGLSLKPADSMEKMKYDXXXXXXX
AMPA_SYNSC      AKGMGAFLAVSQGSDLPPKFIHLIYRPEGEVKRRVALVGKGLTFDSGGYNLKVGAAQIDMMFDMGGSAAV
AMPA_SYNS9      ARGMGAFLAVSQGSDLPPKFIHLIYRPEGAVKRRLALVGKGLTFDSGGYNLKVGGAQIDMMFDMGGSASV
AMPA_SYNP2      AAGMGSFLGVAAASDLPPKFIHLVYKPLGTPRKKVAIVGKGLTFDSGGYNIKPSPSIXXXXXXXXXXXXX
AMPA_CYAP7      KLGMGAYLGVAKASDLPPKFIHLTYKPEGTPKRKLAIVGKSLTFDSGGLNIKVSSGIETMKMDMXXXXXX
AMPA_CYAA5      KRKMGAFLGVAKASDLPPKFIHLTYKPSGTPKRKLAIVGKSLTFDSGGLNLKVSSGIETMKMDMXXXXXX
AMPA_BACC7      XXXXXXXXXVNQGSVEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_DESDG      AAGMGAFESVFKGAVEDARLLAIEYPRGMEKEQPLVFVGKGVTFDTGGISLKPSANMGDMKSDMGGAGAI
AMPA_BACCZ      XXXXXXXXXVNQGSVEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_BACCQ      XXXXXXXXXVNQGSVEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_BACC1      XXXXXXXXXVNQGSVEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAV
AMPA_PROMM      EREMGAYLAVSQGSDLEPKFIHLTYRPQGPVQRRLALVGKGLTFDSGGYNLKVGAAQIDMKFDMGGSAAV
AMPA_BACHK      XXXXXXXXXVNQGSIEPPKMIALIYKGKEEWTDVIGFVGKGITYDTGGYSLKPREGM