[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21597.1

[Show Plain Result]


## Summary of Sequence Search
    1::281
    1::274     6e-68  46%  282 aa  UGL_BURCM RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::274     2e-67  46%  282 aa  UGL_BURA4 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::274     4e-67  46%  282 aa  UGL_BURCJ RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::274     9e-67  45%  282 aa  UGL_BURS3 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::265     3e-63  44%  282 aa  UGL_BURM1 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::274     2e-62  48%  282 aa  UGL_BURCH RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::274     2e-62  48%  282 aa  UGL_BURCC RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
    1::274     2e-62  48%  282 aa  UGL_BURCA RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
  107::319     7e-50  44%  319 aa  FAHD2_XENLA RecName: Full=Fumarylacetoacetate hydrolase
  102::313     7e-50  42%  313 aa  FAHD2_RAT RecName: Full=Fumarylacetoacetate hydrolase
  102::314     4e-48  41%  314 aa  FAH2A_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
  102::314     2e-46  40%  314 aa  FAHD2_BOVIN RecName: Full=Fumarylacetoacetate hydrolase
  102::314     4e-46  40%  314 aa  FAHD2_PONAB RecName: Full=Fumarylacetoacetate hydrolase
  102::314     5e-46  40%  314 aa  FAH2B_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
  102::313     2e-43  38%  313 aa  FAHD2_MOUSE RecName: Full=Fumarylacetoacetate hydrolase
   14::185     5e-36  43%  225 aa  Y1397_PYRAB RecName: Full=Uncharacterized protein PYRAB13970;
   36::227     8e-36  42%  237 aa  Y1656_METJA RecName: Full=Uncharacterized protein MJ1656;
   19::225     1e-35  39%  230 aa  Y643_PYRHO RecName: Full=Uncharacterized protein PH0643;
   86::299     9e-35  38%  305 aa  FAHD2_DICDI RecName: Full=Fumarylacetoacetate hydrolase
   43::233     6e-34  39%  250 aa  Y2225_ARCFU RecName: Full=Uncharacterized protein AF_2225;
   87::300     4e-33  38%  301 aa  YISK_BACSU RecName: Full=Uncharacterized protein yisK;
   89::293     2e-32  37%  300 aa  Y973_STAAC RecName: Full=Uncharacterized protein SACOL0973;
   89::293     2e-32  37%  300 aa  Y968_STAAM RecName: Full=Uncharacterized protein SAV0968;
   89::293     2e-32  37%  300 aa  Y906_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_00906;
   89::293     2e-32  37%  300 aa  Y871_STAA3 RecName: Full=Uncharacterized protein SAUSA300_0871;
   89::293     2e-32  37%  300 aa  Y850_STAAW RecName: Full=Uncharacterized protein MW0850;
   89::293     2e-32  37%  300 aa  Y838_STAAS RecName: Full=Uncharacterized protein SAS0838;
   89::293     2e-32  37%  300 aa  Y837_STAAB RecName: Full=Uncharacterized protein SAB0837;
   89::293     2e-32  37%  300 aa  Y829_STAAN RecName: Full=Uncharacterized protein SA0829;
   89::293     3e-32  37%  300 aa  Y930_STAAR RecName: Full=Uncharacterized protein SAR0930;
   89::293     4e-31  36%  301 aa  Y665_STAES RecName: Full=Uncharacterized protein SE_0665;
   89::293     4e-31  36%  301 aa  Y556_STAEQ RecName: Full=Uncharacterized protein SERP0556;
   89::293     4e-31  35%  301 aa  Y1982_STAHJ RecName: Full=Uncharacterized protein SH1982;
   89::293     2e-30  35%  301 aa  Y1806_STAS1 RecName: Full=Uncharacterized protein SSP1806;
  219::426     1e-29  31%  429 aa  HPAG_SALDU RecName: Full=4-hydroxyphenylacetate degradation
  223::390     5e-29  35%  427 aa  HPCE_ECOLX RecName: Full=Homoprotocatechuate catabolism
  223::390     5e-29  35%  429 aa  HPAG_ECOLX RecName: Full=4-hydroxyphenylacetate degradation
   13::179     6e-26  39%  218 aa  FAHD1_DICDI RecName: Full=Fumarylacetoacetate hydrolase
   16::216     6e-26  33%  221 aa  FAHD1_BOVIN RecName: Full=Fumarylacetoacetate hydrolase
   22::222     4e-25  32%  227 aa  FAHD1_MOUSE RecName: Full=Fumarylacetoacetate hydrolase
   19::219     1e-24  32%  224 aa  FAHD1_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
   16::216     3e-24  31%  221 aa  FAHD1_RAT RecName: Full=Fumarylacetoacetate hydrolase
   19::219     3e-24  32%  224 aa  FAHD1_PONAB RecName: Full=Fumarylacetoacetate hydrolase
   17::181     9e-24  36%  214 aa  YO23_CAEEL RecName: Full=Uncharacterized protein ZK688.3;
   22::210     8e-20  31%  219 aa  YCGM_ECOLI RecName: Full=Uncharacterized protein ycgM;
   15::211     1e-14  33%  259 aa  FMP41_YEAST RecName: Full=Uncharacterized mitochondrial hydrolase
    2::178     4e-09  27%  221 aa  YOS9_SCHPO RecName: Full=Uncharacterized hydrolase C21C3.09c;      
  193::251     4e-05  46%  419 aa  FAAA_RAT RecName: Full=Fumarylacetoacetase;         Short=FAA;     
  201::276     3e-04  35%  427 aa  FAAA_DICDI RecName: Full=Fumarylacetoacetase;         Short=FAA;   
  194::251     4e-04  45%  419 aa  FAAA_BOVIN RecName: Full=Fumarylacetoacetase;         Short=FAA;   
    1::281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXXXRIGSCISKP
UGL_BURCM       MKLLRYGPSGQEKPGILDANGRIRDLSAHVPDLAGDALSDAGLTRLRAIDPATLPLVSGEPRIGACVGRV
UGL_BURA4       MKLLRYGPSGQEKPGILDADGRIRDLSAHVPDLAGDVLSDAALARLRAIDPATLPLVSGEPRIGACVGRV
UGL_BURCJ       MKLLRYGPPGQEKPGILDAAGRIRDLSAHVPDLAGEVLSDAGLARLRAIDPATLPLVSGEPRIGACVGHV
UGL_BURS3       MKLLRYGPSGQEKPGILDADGRIRDLSAHVPDLSGDVLSDAGLARLRAIDPATLPLVSGEPRIGACVGHV
UGL_BURM1       MKLLRYGPPGQEKPGILDADGRIRDLSAHVPDLAGDVLSDAGLARLRALDPATLPLVSGEPRIGACVGRV
UGL_BURCH       MKLLRYGPSGQEKPGILDAAGRIRDLSAHVPDLAGDVLSDAGLARLRAIDPATLPLVSGEPRIGACVGHV
UGL_BURCC       MKLLRYGPSGQEKPGILDSAGRIRDLSAHVPDLAGDVLSDAGLARLRAIDPATLPLVSGEPRIGACVGHV
UGL_BURCA       MKLLRYGPSGQEKPGILDAAGRIRDLSAHVPDLAGDVLSDAGLARLRAIDPATLPLVSGEPRIGACVGHV
FAHD2_XENLA     ------------------------------------------------------------------ITNP
FAHD2_RAT       ------------------------------------------------------------------VTRP
FAH2A_HUMAN     ------------------------------------------------------------------VTRP
FAHD2_BOVIN     ------------------------------------------------------------------VTRP
FAHD2_PONAB     ------------------------------------------------------------------VTRP
FAH2B_HUMAN     ------------------------------------------------------------------VTWP
FAHD2_MOUSE     ------------------------------------------------------------------VTRP
Y1397_PYRAB     --------------------------------------------------------------------RP
Y1656_METJA     --------------------------------------------------------------------KP
Y643_PYRHO      --------------------------------------------------------------------RP
FAHD2_DICDI     --------------------------------------------------------------------EP
Y2225_ARCFU     ---------------------------------------------------------------------P
YISK_BACSU      ------------------------------------------------------------------IPKP
Y973_STAAC      ------------------------------------------------------------------VTPP
Y968_STAAM      ------------------------------------------------------------------VTPP
Y906_STAA8      ------------------------------------------------------------------VTPP
Y871_STAA3      ------------------------------------------------------------------VTPP
Y850_STAAW      ------------------------------------------------------------------VTPP
Y838_STAAS      ------------------------------------------------------------------VTPP
Y837_STAAB      ------------------------------------------------------------------VTPP
Y829_STAAN      ------------------------------------------------------------------VTPP
Y930_STAAR      ------------------------------------------------------------------VTPP
Y665_STAES      ------------------------------------------------------------------VTPP
Y556_STAEQ      ------------------------------------------------------------------VTPP
Y1982_STAHJ     ------------------------------------------------------------------VTPP
Y1806_STAS1     ------------------------------------------------------------------VTPT
HPAG_SALDU      ------------------------------------------------------------------LSAT
HPCE_ECOLX      ----------------------------------------------------------------------
HPAG_ECOLX      ----------------------------------------------------------------------
FAHD1_DICDI     ----------------------------------------------------------------------
FAHD1_BOVIN     ----------------------------------------------------------------------
FAHD1_MOUSE     ----------------------------------------------------------------------
FAHD1_HUMAN     ----------------------------------------------------------------------
FAHD1_RAT       ----------------------------------------------------------------------
FAHD1_PONAB     ----------------------------------------------------------------------
YO23_CAEEL      ----------------------------------------------------------------------
YCGM_ECOLI      ----------------------------------------------------------------------
FMP41_YEAST     ----------------------------------------------------------------------
YOS9_SCHPO      ------------------------------------------------------------------LSRA
FAAA_RAT        ----------------------------------------------------------------------
FAAA_DICDI      ----------------------------------------------------------------------
FAAA_BOVIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
UGL_BURCM       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGTTCKDVDE
UGL_BURA4       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGTTCKDVDE
UGL_BURCJ       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVDE
UGL_BURS3       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGATCKDVDE
UGL_BURM1       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAPCKDVDE
UGL_BURCH       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVDE
UGL_BURCC       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVDE
UGL_BURCA       GKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVKTDWEVELGVVIGAKCKDVDE
FAHD2_XENLA     EKIICIGMNYVDHCLEQNVPVPKEPIIFNKFASSIVGPSDPIRIPEESQEVDWEAELAFVIGKKGKNIKE
FAHD2_RAT       DKVICVGLNYADHCQEQNVRVPKNPIIFSKFSSSIVGPYDSIILPPESKEVDWEVEMAVVIGKKGKHIKA
FAH2A_HUMAN     DKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKA
FAHD2_BOVIN     DKVVCVGMNYADHCREQNVPVPKEPIIFSKFASAIVGPYDNIILPPESQEVDWEVELAVVIGKRGKYIKA
FAHD2_PONAB     DKVVCVRMNYVDHCKEQNVPVPKEPFIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKA
FAH2B_HUMAN     DKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKA
FAHD2_MOUSE     EKVICVGLNYADHCQEQNVRVXXXXXXXXXXXXXXVGPYDEIILPPESKEVDWEVEMAVVIGKKGKHIKA
Y1397_PYRAB     TKIIALAKNYAEHAREMGSEPPEEPVIFLKPPSALIGPNSVIVLPRRSKRVDHEVELAVIIGKRAKNVPA
Y1656_METJA     TKIICVGLNYIDHAKELNMEIPEYPIIFLKPTSAIIYNEDYIIRPRISKRVDYEVELAIVIGKKCKNIKK
Y643_PYRHO      TKIVALAKNYAEHAREMGSEPPEEPIIFLKPPSALIGPGSSIILPRRSKRVDHEVELAVIMGKRAKNVPA
FAHD2_DICDI     GKIICIGLNYKEHANEAKMAIPKEPIVFSKFDNAICGPNDSIIKPXXXXXXXXXXXXXXXIGKQAKNVSE
Y2225_ARCFU     SKIIAVGLNYIDHAEELNMPVPEEPILFMKPSTAVIGHDDCIILPQISQRVDYEGELAVVIAEDCRNVPE
YISK_BACSU      SNIICIGKNYRDHAIEMGSEAPEHPMVFTKSPVTVTGHGDIVKSEEVTSQLDYEGELAVVIGKSGTRISK
Y973_STAAC      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y968_STAAM      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y906_STAA8      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y871_STAA3      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y850_STAAW      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y838_STAAS      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y837_STAAB      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y829_STAAN      NNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNITDQLDYEGELGIVIGKSGEKIPK
Y930_STAAR      NNVIAFGRNYKDHANELNHEV-ERLYVFTKAASSLTG--DNAKIPNITDQLDYEGELGIVIGKSGEKIPK
Y665_STAES      NNVIAFGRNYEDHASELNHEV-DSLYVFTKAASSLTG--DEATIPNITEQLDYEGELGIVIGKSGEKIPR
Y556_STAEQ      NNVIAFGRNYEDHASELNHEV-DSLYVFTKAASSLTG--DEATIPNITEQLDYEGELGIVIGKSGEKIPR
Y1982_STAHJ     NNVIAFGRNYQDHASELNHEV-QRLYVFTKAASSLTGDESTIPNHKDTDQLDYEGELGIVIGKSGEKIPK
Y1806_STAS1     NNVIAFGRNYQDHANELNHEV-QRLYVFTKAASSLTGDNSTIPNHKDTDQLDYEGELGIVIGKSGEKIPK
HPAG_SALDU      GTLFALGLNYADHASELAFTPPKEPLVFIKAPNTFTEHHQTSVRPNNVEYMHYEAELVVVIGKTARKVSE
HPCE_ECOLX      GTLFALGLNYADHASELEFKPPEEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVVIGKQARNVSE
HPAG_ECOLX      GTLFALGLNYADHASELEFKPPEEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVVIGKQARNVSE
FAHD1_DICDI     ----AVGRNYAQHAKELGNEIPSEPFFFLKPTSSYLLQGTGPIIPLESSDIHHEVELGIVIGKKGRDIDL
FAHD1_BOVIN     -NIVCVGRNYADHVREMQSAAPSEPVLFLKPSTAYAPEGSPVLVPAYTRNLHHELELAVVMGKRCRAVSE
FAHD1_MOUSE     -NIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGKRGEAIPE
FAHD1_HUMAN     -NIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPE
FAHD1_RAT       -NIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGRRGEAVPE
FAHD1_PONAB     -NIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGRRCRAVPE
YO23_CAEEL      -----VGRNYKDHALELGNAIPKKPMLFVKTVNSFIVEGEPIVAPPGCQNLHQEVELGVVISKKASRISK
YCGM_ECOLI      -----VGSNYAKHIKEMGSAVPEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQATE
FMP41_YEAST     -----IGRNYAAHIKELNNSTPKQPFFFLKPTSSIVTPLSSSLVKTTGVKVHHEIELALIVSKHLSNVTK
YOS9_SCHPO      GKVVCIGRNYAAHIREXXXXXXXXXXXXXXXXSAIVEPGHGNLIIPPDVSAHYEVELGLIMKDRARRPVS
FAAA_RAT        -----------------------------------------------SKRLDMELEMAFFVGRFGEPIPI
FAAA_DICDI      --------------------------------------------------LDFELEMGALIGGESTKLGE
FAAA_BOVIN      ------------------------------------------------KLLDFELEMAFFVGKLGEPIPI


                         +         .         .         .         .         *         .:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQXXXXXXXXXXXXGHRHQT
UGL_BURCM       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEVDGHRYQN
UGL_BURA4       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRVDLWLEIDGHRYQN
UGL_BURCJ       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQN
UGL_BURS3       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQN
UGL_BURM1       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQSLDLWLEVDGHRYQN
UGL_BURCH       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQN
UGL_BURCC       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQN
UGL_BURCA       ARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGPIGPWLVTRDEVPDPQRLDLWLEIDGHRYQN
FAHD2_XENLA     EDAMDHVVGYTVAHDVSARDWQMKKNGQWLLGKTFDTFCPLGPALVTKDVISDPHNLGIRCRVNGDLVQN
FAHD2_RAT       TDVMAYVAGFTVAHDVSARDWQMRNGKQWLLGKTFDTFCPLGPALVTKDTIADPHNLKISCRVNGEIVQS
FAH2A_HUMAN     TDAMAHVAGFTVAHDVSARDWQMRRNGQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQS
FAHD2_BOVIN     TDAMAHVAGFTVAHDVSARDWQMGRNGQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGELMQS
FAHD2_PONAB     TDAMAHVAGFTVAHDVSARDWQMRRNGQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGELVQS
FAH2B_HUMAN     TDAMAHVAGFTVAHDVSARDWTRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQS
FAHD2_MOUSE     TDVMAHVAGFTVAHDVSARDWQMRNGKQWLLGKTFDTFCPLGPALVTKDTIADPHNLKICCRVNGEVVQS
Y1397_PYRAB     EKAFDYILGYTILLDITARDLQAEKGYPWTVSKGFDTFAPIGPRIVDKRELD-PSDLEIGLKVNGKVRQL
Y1656_METJA     DEANDYIMGYTILNDVTARDLQ-QKDGQWTRAKSFDTFCPIGPRIVKDID---PMNLNIECRVNGEIKQK
Y643_PYRHO      SKAFDYILGYTIILDITARDLQAEKGYPWTISKGFDTFAPIGPRVVDSRELD-PSDLEIGLKVNGKIRQL
FAHD2_DICDI     SDALQYVAGYTVGNDVSARDWQRKNNSQWLLGKTFDTFAPIGPSIVINPEVADPNNLSIKCTLNGQVVQN
Y2225_ARCFU     TNAADYILGYTCFNDVTARDLQ-AKDGQWTRAKSFDTFAPLGPYIA---EIDDPSKLGIQTRVNGKVVQK
YISK_BACSU      EDAYDHVFGYTIVNDITARDLQK-RHKQFFIGKSLDTTCPMGPVLVHKSSIQEPERLKVETRVNGELRQS
Y973_STAAC      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y968_STAAM      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y906_STAA8      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y871_STAA3      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y850_STAAW      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y838_STAAS      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y837_STAAB      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y829_STAAN      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y930_STAAR      ALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQD
Y665_STAES      GLALDYIYGYTIINDITDRTAQSSHDQAFLS-KSLTGACPMGPYIVTKDELPAPENVNIVTKVNNEIRQD
Y556_STAEQ      GLALDYIYGYTIINDITDRTAQSSHDQAFLS-KSLTGACPMGPYIVTKDELPAPENVNIVTKVNNEIRQD
Y1982_STAHJ     ALALDYIYGYTIINDITDRKAQNEQDQAFLS-KSLTGGCPMGPYIVTKDELPTPENVNIVTKVNNDIRQD
Y1806_STAS1     GLALDYVYGYTIINDITDRKAQNAQDQAFLS-KSLTGGCPVGPYIVTKDELPTPEDVNIVTKVNNDIRQD
HPAG_SALDU      AEAMEYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPIGPWIVDKEAVSDPHNLTLRTFVNGELRQE
HPCE_ECOLX      ADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLSTIVPKEAIPDPHNLTLRTFVNGELRQQ
HPAG_ECOLX      ADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLSTIVPKEAIPDPHNLTLRTFVNGELRQQ
FAHD1_DICDI     KSAMDYVSGYTLALDMTSRDQQKAKSLPWTVSKGYDTFCPISGF-IPKDKIKDLNNVELWCSVDGQIKQK
FAHD1_BOVIN     AAAMDYVAGYALCLDMTARDVQKKKGLPWTLAKSFTASCPVSAF-VPKEKIPDPHNLKLWLKVNGELRQE
FAHD1_MOUSE     AAAMDYVAGYALCLDMTARDVQKKKGLPWTLAKSFTSSCPVSAF-VPKEKIPDPHALRLWLKVNGELRQE
FAHD1_HUMAN     AAAMDYVGGYALCLDMTARDVQKKKGLPWTLAKSFTASCPVSAF-VPKEKIPDPHKLKLWLKVNGELRQE
FAHD1_RAT       AAAMDYVAGYALCLDMTARDVQKKKGLPWTLAKSFTSSCPVSAF-VPKEKIPDPHALRLWLKVNGELRQE
FAHD1_PONAB     AAAMDYVGGYALCLDMTARDVQKKKGLPWTLAKSFTASCPVSAF-VPKEKIPDPHKLKLWLKVNGELRQE
YO23_CAEEL      SDAMDYIGGYTVALDMTARDFQKKAGAPWFLAKSFDGSCPIGGFLPVSD-IPNPHDVELFCKINGKDQQR
YCGM_ECOLI      EHVRKAIAGYGVALDLTLRDVQKKAGQPWEKAKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQ
FMP41_YEAST     EEVYDSISGVALALDLTARNVQKKKGLPWTISKGFDTFMPISA-IVSREKFNLQDIFRVKCSVNGQLRQD
YOS9_SCHPO      SNSWDSIGAYFVGIDMTARNIQKKKGLPWSFAKGYDTFLPVGP-IIPKHLIPDPHNVILELSLNGKVVQK
FAAA_RAT        SKAQEHIFGMVLMNDWSARDIQ-----QW-------EYVPLGPFL-------------------------
FAAA_DICDI      ESAKDHIFGLVLLNDWSARDWEYVPLGPFLAKNFGST---ISPWVVTMEALQ------------------
FAAA_BOVIN      SKAHEHIFGMVLMNDWSARDIQK-----W-------EYVPLGPFL-------------------------


                         .         .         .         +         .         .         .:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILE
UGL_BURCM       GNTRTMVFTVAQLVAYLSTCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQTVRLGIDGLGEQ-------
UGL_BURA4       GNTRTMVFTVAQLVAYLSTCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQTVRLGIDGLGEQ-------
UGL_BURCJ       GNTRTMVFTVAQLIAYLSTCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQMVRLGIDGLGEQ-------
UGL_BURS3       GNTRTMVFTVAQLIAYLSSCMTLQPGDVITTGTPPGVGMGIKPPVFLKAGQMVRLGVEGLGEQ-------
UGL_BURM1       GNTRTMVFTVAQLIAYLSSCMTLQPGDVITTGTPPGVGMGIKPPVYLKAGQMVR----------------
UGL_BURCH       GNTRTMVFTVAQLVAYLSTCMTLQXXXXXXXXXXXXXXXXXKPPVFLKAGQTVRLGIEGLGEQ-------
UGL_BURCC       GNTRTMVFTVAQLVAYLSTCMTLQXXXXXXXXXXXXXXXXXKPPVFLKAGQTVRLGIEGLGEQ-------
UGL_BURCA       GNTRTMVFTVAQLVAYLSTCMTLQXXXXXXXXXXXXXXXXXKPPVFLKAGQTVRLGIEGLGEQ-------
FAHD2_XENLA     SNTNQMVFKTEALIAWASKFVTLNPGDVFLTGTPPGVGVFRKPPVFLKAGDVVRCEIDELGAISNPVV--
FAHD2_RAT       SNTNQMVFKTEDLIAWVSQFVTLYPGDILLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINKVV--
FAH2A_HUMAN     GNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV--
FAHD2_BOVIN     SNTNQMVFKTEELITWVSQFVTLYPGDIILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV--
FAHD2_PONAB     SNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV--
FAH2B_HUMAN     SNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV--
FAHD2_MOUSE     SNTNQMVFKTEYLIAWVSQFVTLYPGDLLLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINKVV--
Y1397_PYRAB     GRTSEMIFKIPELIEYISSIMTLEPGDI------------------------------------------
Y1656_METJA     SNTKNMIFDVYELVEFVASIMTLYPGDI--------ISTGTPPGVELKAGDVVECEIEGIG---------
Y643_PYRHO      GRTSQMIFKIPELIEYISHIMTLEPGDIIATGTPP----GVGP---LRHGDRIEAWIEGIGKMEFDVLAE
FAHD2_DICDI     STTKEFIFNIQTVVSYLSKLFTLNPGDIIFTGTPSGVGFIRKPPIFLKSGDVIKCEIEELGS--------
Y2225_ARCFU     SNTSNLIFDVFQLVSFVSSVMTLKAGDV--IATGTPAGVGM-----LKDGDVVEVEIEKIG---------
YISK_BACSU      GSASDMIFSIPELIETLSKGMTLEAGDIIATGTPSGVGKGFTPPKFLRSGDKIDITIDPIGTLSNQI---
Y973_STAAC      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y968_STAAM      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y906_STAA8      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y871_STAA3      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y850_STAAW      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y838_STAAS      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y837_STAAB      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y829_STAAN      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y930_STAAR      GNTGEMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGT--------
Y665_STAES      GNTGEMILKIDELIEKISKYVALHPGDIIATGTPAGVGAGLQPPQFLQPGDEVKVTIDNIGT--------
Y556_STAEQ      GNTGEMILKIDELIEKISKYVALHPGDIIATGTPAGVGAGLQPPQFLQPGDEVKVTIDNIGT--------
Y1982_STAHJ     GNTSQMINKIDDLIEEISKYVALHPGDIIATGTPAGVGAGLQPPQFLQPGDEVKVTIDNIGT--------
Y1806_STAS1     GNTGQMILKIDELIEEISKYVALHPGDIIATGTPAGVGAGMNPPQFLQPGDEIKVTIDNIGT--------
HPAG_SALDU      GTTADLIFSIPFLISYLSEFMTLQPGDMIATGTPK----GLSDVV---PGDEVVLEIKGVGRLVNQIVCE
HPCE_ECOLX      GTTADLIFSVPFLIAYLSEFMTLNPGDM------------------------------------------
HPAG_ECOLX      GTTADLIFSVPFLIAYLSEFMTLNPGDM------------------------------------------
FAHD1_DICDI     GNTNQMIFDVPHLIQYISSIMTLESGDL------------------------------------------
FAHD1_BOVIN     GETSSMIFSIPYIISYVSKIMTLEEGDIILTGTPK----GVGP---VKENDEIQAGIHGVLSMKFKV---
FAHD1_MOUSE     GKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPK----GVGP---VKENDEIEAGIDGVVSMRFKV---
FAHD1_HUMAN     GETSSMIFSIPYIISYVSKIITLEEGDIILTGTPK----GVGP---VKENDEIEAGIHGLVSMTFKV---
FAHD1_RAT       GKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGA-------VKENDEIEAGIDGVVSMRFKV---
FAHD1_PONAB     GETSSMIFSIPYIISYVSKIITLEEGDIILTGTPK----GVGP---VKENDEIEAGIHGLVSMRFKV---
YO23_CAEEL      CRTDVMIFDIPTLLEYTTQFFTLEVGDV------------------------------------------
YCGM_ECOLI      GTTADMIHKIVPLIAYMSKFFTLKAGDVVLTGTPD----GVGP---LQSGDELTVTFD------------
FMP41_YEAST     GGTNLMLHPLHKILQHISTMISLEPGDI------------------------------------------
YOS9_SCHPO      DSTSLMLNKIPKIFSSITEAMSLNPGDL------------------------------------------
FAAA_RAT        ----------------------------------------------------------------------
FAAA_DICDI      ----------------------------------------------------------------------
FAAA_BOVIN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           Q
UGL_BURCM       -
UGL_BURA4       -
UGL_BURCJ       -
UGL_BURS3       -
UGL_BURM1       -
UGL_BURCH       -
UGL_BURCC       -
UGL_BURCA       -
FAHD2_XENLA     -
FAHD2_RAT       -
FAH2A_HUMAN     -
FAHD2_BOVIN     -
FAHD2_PONAB     -
FAH2B_HUMAN     -
FAHD2_MOUSE     -
Y1397_PYRAB     -
Y1656_METJA     -
Y643_PYRHO      -
FAHD2_DICDI     -
Y2225_ARCFU     -
YISK_BACSU      -
Y973_STAAC      -
Y968_STAAM      -
Y906_STAA8      -
Y871_STAA3      -
Y850_STAAW      -
Y838_STAAS      -
Y837_STAAB      -
Y829_STAAN      -
Y930_STAAR      -
Y665_STAES      -
Y556_STAEQ      -
Y1982_STAHJ     -
Y1806_STAS1     -
HPAG_SALDU      E
HPCE_ECOLX      -
HPAG_ECOLX      -
FAHD1_DICDI     -
FAHD1_BOVIN     -
FAHD1_MOUSE     -
FAHD1_HUMAN     -
FAHD1_RAT       -
FAHD1_PONAB     -
YO23_CAEEL      -
YCGM_ECOLI      -
FMP41_YEAST     -
YOS9_SCHPO      -
FAAA_RAT        -
FAAA_DICDI      -
FAAA_BOVIN      -