[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21647.1

[Show Plain Result]


## Summary of Sequence Search
    1::406
    7::92      8e-18  25%  416 aa  YBFB_BACSU RecName: Full=Uncharacterized MFS-type transporter ybfB;
   21::426     2e-08  22%  486 aa  MOT12_MOUSE RecName: Full=Monocarboxylate transporter 12;       
  255::428     3e-07  23%  473 aa  MOT12_XENTR RecName: Full=Monocarboxylate transporter 12;       
  246::419     5e-07  22%  460 aa  MOT12_XENLA RecName: Full=Monocarboxylate transporter 12;       
   37::156     9e-06  30%  198 aa  Y1420_CLOTH RecName: Full=UPF0059 membrane protein Cthe_1420;
  214::349     9e-06  25%  389 aa  NART_STAAW RecName: Full=Probable nitrate transporter narT;
  214::349     9e-06  25%  389 aa  NART_STAAT RecName: Full=Probable nitrate transporter narT;
  214::349     9e-06  25%  389 aa  NART_STAAS RecName: Full=Probable nitrate transporter narT;
  214::349     9e-06  25%  389 aa  NART_STAAE RecName: Full=Probable nitrate transporter narT;
  214::349     9e-06  25%  389 aa  NART_STAAC RecName: Full=Probable nitrate transporter narT;
  214::349     9e-06  25%  389 aa  NART_STAA8 RecName: Full=Probable nitrate transporter narT;
  214::349     9e-06  25%  389 aa  NART_STAA3 RecName: Full=Probable nitrate transporter narT;
  226::409     9e-06  20%  477 aa  MT12B_DANRE RecName: Full=Monocarboxylate transporter 12-B;        
   39::156     1e-05  35%  188 aa  Y1211_DESHY RecName: Full=UPF0059 membrane protein DSY1211;
  214::349     1e-05  24%  385 aa  NART_STAHJ RecName: Full=Probable nitrate transporter narT;
  214::349     2e-05  27%  389 aa  NART_STAAR RecName: Full=Probable nitrate transporter narT;
  214::349     2e-05  27%  389 aa  NART_STAAN RecName: Full=Probable nitrate transporter narT;
  214::349     2e-05  27%  389 aa  NART_STAAM RecName: Full=Probable nitrate transporter narT;
  214::349     2e-05  27%  389 aa  NART_STAA9 RecName: Full=Probable nitrate transporter narT;
  214::349     2e-05  27%  389 aa  NART_STAA2 RecName: Full=Probable nitrate transporter narT;
  214::349     2e-05  27%  389 aa  NART_STAA1 RecName: Full=Probable nitrate transporter narT;
  214::349     3e-05  27%  389 aa  NART_STAAB RecName: Full=Probable nitrate transporter narT;
  214::349     4e-05  26%  387 aa  NART_STAES RecName: Full=Probable nitrate transporter narT;
  214::349     5e-05  31%  387 aa  NART_STAEQ RecName: Full=Probable nitrate transporter narT;
   13::292     1e-04  20%  505 aa  MOT6_HUMAN RecName: Full=Monocarboxylate transporter 6;       
   53::211     2e-04  25%  526 aa  SPNS1_XENLA RecName: Full=Protein spinster homolog 1;
   42::291     2e-04  23%  506 aa  SPNS1_DANRE RecName: Full=Protein spinster homolog 1;AltName:
  116::177     2e-04  32%  605 aa  SPIN_DROME RecName: Full=Protein spinster;AltName: Full=Protein
   31::90      5e-04  32%  388 aa  PBUE_BACSU RecName: Full=Purine efflux pump pbuE;
  223::392     5e-04  23%  428 aa  MOT13_RAT RecName: Full=Monocarboxylate transporter 13;       
   53::137     9e-04  25%  526 aa  SPNS1_XENTR RecName: Full=Protein spinster homolog 1;
   27::299     9e-04  20%  489 aa  MOT2_RAT RecName: Full=Monocarboxylate transporter 2;       
  229::377     9e-04  22%  428 aa  MOT13_MOUSE RecName: Full=Monocarboxylate transporter 13;       
   62::153     9e-04  31%  798 aa  MFSD6_PIG RecName: Full=Major facilitator superfamily
   62::153     9e-04  32%  775 aa  MFSD6_MOUSE RecName: Full=Major facilitator superfamily
    1::406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIQNKTALITLIAACIVVLISLGVRQTFGLFFMDFKNDLDISITQSGLAIGIQMLMWGLTGPIFG
YBFB_BACSU      -----------AWIIVSVTFLILLAVQGVRLSFGAFVEPWERQFSIDRSTISLISTVSFIVYGISQPVIG
MOT12_MOUSE     ---------------IVAGCFLVTITRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGS
MOT12_XENTR     ----------------------------------------------------------------------
MOT12_XENLA     ----------------------------------------------------------------------
Y1420_CLOTH     ----------------------------------------------------------------------
NART_STAAW      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAT      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAS      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAE      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAC      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAA8      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAA3      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
MT12B_DANRE     ----------------------------------------------------------------------
Y1211_DESHY     ----------------------------------------------------------------------
NART_STAHJ      ------------------------ITFGAFVAFGLFLPNYLNNFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAR      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAN      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAM      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAA9      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAA2      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAA1      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAAB      ------------------------ITFGAFVAFGIFLPNYLNHFGIDKVDAGIRSGVFIALATFLRPIGG
NART_STAES      ------------------------ITFGAFVAFGIFLPNFLVDFSIDKVDAGIRSGIFIALATFLRPVGG
NART_STAEQ      ------------------------ITFGAFVAFGIFLPNFLVDFSIDKVDAGIRSGIFIALATFLRPVGG
MOT6_HUMAN      -----------AWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCS
SPNS1_XENLA     ------ISYKRSVIIVIILFYINLLNYMDRFTVAGVLPDIKKAFNISDSNSGLVQTVFICSYMFLAPVFG
SPNS1_DANRE     ------VTDRRAIMTVIVLCYINLLNYMDRFTVAGVLPDIEHFFGIGDGTSGLLQTVFICSYMFLAPLFG
SPIN_DROME      --------------TVTVLCFVNLINYMDRFTIAGVLTDVRNDFDIGNDSAGLLQTVFVISYMVCAPIFG
PBUE_BACSU      -----------------------------------------NDLDISIVSAGQLISVFALGYAVSGPLLL
MOT13_RAT       ----------------------------------------------------------------------
SPNS1_XENTR     ------ISYRHSVTIVIILFYINLLNYMDRFTVAGVLSDIKEDYHISDSNSGLVQTVFICSYMFLAPVFG
MOT2_RAT        -------------VVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISS
MOT13_MOUSE     ----------------------------------------------------------------------
MFSD6_PIG       -------------------CVKINNDLLISKVFYFFFYSYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWG
MFSD6_MOUSE     -------------------CVKVNNDLLISKVFYFFFYSYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWG


                         .         .         *         .         .         .         .:140
query           AIADKYGGHKAICLAFVFYILGIYFLYAGPNTGIFFQIDXXXXXXXXXXXTAISIPMSIVGKHFPLSNRT
YBFB_BACSU      RLVDKWGARAVLAWSALLTGVSIFLTY-------------------------------------------
MOT12_MOUSE     VVSNQLSCQAGIMLASTGFILGSFYLSLGVLTGLGFAL-------------CYSPAIAMVGKYFS-RRKA
MOT12_XENTR     ----------------------------------------------------------------------
MOT12_XENLA     ----------------------------------------------------------------------
Y1420_CLOTH     ----------------------------------------------------------------------
NART_STAAW      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
NART_STAAT      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
NART_STAAS      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
NART_STAAE      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
NART_STAAC      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
NART_STAA8      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
NART_STAA3      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF---TVGCLTISICAGIGNGLIFKLVPSYF-LNEAG
MT12B_DANRE     ----------------------------------------------------------------------
Y1211_DESHY     ----------------------------------------------------------------------
NART_STAHJ      ILGDKFNAVKVLMIDFIIMIVGAVILGISSHIALF---TIGCLTISICAGLGNGLIFKLVPSYFAKESGA
NART_STAAR      ILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAAN      ILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAAM      ILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAA9      ILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAA2      ILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAA1      ILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAAB      ILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALF-------TVGCLTISICAGIGNGLIFKLVPFSNEA
NART_STAES      VIGDKFNAVQALIIDFVIMIIGALILSLSSHI-VLFTIGCLAISICAGIGNGLI--FKLVPSYFS-KEAG
NART_STAEQ      VIGDKFNAVQALIIDFVIMIIGALILSLSSHIVLF-----------TIGCLAISICAGINGLIFKLAEAG
MOT6_HUMAN      ILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSI--TVLGFYF-VRRRV
SPNS1_XENLA     YLGDRYNRKLIMCVGISFWSL-VTLLSSFVSNQYFWLFLITRGLVGVGEASYSTIAPTIIADLFLADQRT
SPNS1_DANRE     YLGDRYNRKLIMCVGIFFWVVTLASSFIGKDH--FWALLLTRGLVGVGEASYSTIAPTIIADLFVKEKRT
SPIN_DROME      YLGDRY----------------------------------------------------------------
PBUE_BACSU      ALTAKIERKRLYLIALFVFFLSNLVAYFSPN---------------------------------------
MOT13_RAT       ----------------------------------------------------------------------
SPNS1_XENTR     YLGDRYNRKLIMCIGISFWSL-------------------------------------------------
MOT2_RAT        VLVNNYGSRPVLIVGGLLCCTGM--ILASFSSSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFPLANGF
MOT13_MOUSE     ----------------------------------------------------------------------
MFSD6_PIG       VVADRFKKGKVVLLCWVLFNLGIGFV--------------------------------------------
MFSD6_MOUSE     VVADRFRKGKIVLLCWVLFNLGIGFV--------------------------------------------


                         +         .         .         .         .         *         .:210
query           IAMSIVTAVGSLGYFISPLYTSYSLIKNGWVDTXXXXXXXXXXXXXXXXXVRSPSAAQSIEKPNNQSAIE
YBFB_BACSU      ----------------------------------------------------------------------
MOT12_MOUSE     LAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPNRESQRE
MOT12_XENTR     ----------------------------------------------------------------------
MOT12_XENLA     ----------------------------------------------------------------------
Y1420_CLOTH     ----------------------------------------------------------------------
NART_STAAW      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAT      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAS      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAE      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAC      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAA8      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAA3      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
MT12B_DANRE     --------------------------------------------------------------PTRSAASD
Y1211_DESHY     ----------------------------------------------------------------------
NART_STAHJ      -ANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAR      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAN      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAM      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAA9      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAA2      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAA1      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAAB      SANGIVSMMGGLGGFFPPLVITY-----------------------------------------------
NART_STAES      SANGIVSMMGGLGGFFPPLVITF-----------------------------------------------
NART_STAEQ      SANGIVSMMGGLGGFFPPLVITF-----------------------------------------------
MOT6_HUMAN      LANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAXXXXXXXXXXX
SPNS1_XENLA     RMLSFATPVGGLGYIVGSEMTS------------------------------------------------
SPNS1_DANRE     NMLSIF-------YFAIPVGSGMGYIVGSKVDTVAKDWHWALRVTPGXXXXXXXXXXXXXQEP-KRGAIE
SPIN_DROME      ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MOT13_RAT       ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
MOT2_RAT        AMAGSPVFLSTLAPFNQFLFNSY-----GWKGSFLILGAIFLHSCVAGCLMRSPRAAKSLSKVSTAEKIN
MOT13_MOUSE     ----------------------------------------------------------------------
MFSD6_PIG       ----------------------------------------------------------------------
MFSD6_MOUSE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AFKEAFKNKSYILLVSGFFVCGFHITLVGTHVPKYVIDRGLESWTAAAILSLIGLFNIFGSLLSGYXXXX
YBFB_BACSU      -----FRMRQFWFLIFPFLICGFTVGLMDTHLIPFSHDHGFSTTVTSAAVSLLAGFNIAGILLSGIVADR
MOT12_MOUSE     DCKQALQQEYGFLLMSDFVVLAVSVLFMAVYLVPYALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDR
MOT12_XENTR     ----------FMVLAVSFLFLAYGCSPPFVYLVPYALNVGVSNQEAAFLMSILGIIDIVGNITFGWVTDT
MOT12_XENLA     ----------FIILAVSFLFLAYGCSPPFVYLVPYSLSVGVSHQEAAFLMSILGIVDIVGNITFGWVTDR
Y1420_CLOTH     -------------VLTGCFFGGFQALLLGTQFKDYITS--IDHWIAFGLLSLIGINMIKES-------KN
NART_STAAW      ----------------------------------------------------------------------
NART_STAAT      ----------------------------------------------------------------------
NART_STAAS      ----------------------------------------------------------------------
NART_STAAE      ----------------------------------------------------------------------
NART_STAAC      ----------------------------------------------------------------------
NART_STAA8      ----------------------------------------------------------------------
NART_STAA3      ----------------------------------------------------------------------
MT12B_DANRE     AKQRCFQSMQFLVLAGSFLLLASGCSLPFVYLVPYALDVGVGHQHAAFLMSILGVIDIVGNITFGWLTDR
Y1211_DESHY     -------------LITGLFFGGFQALLLGTRFESYIT--AIDHWIAFILLSLIGLNMIKES---------
NART_STAHJ      ----------------------------------------------------------------------
NART_STAAR      ----------------------------------------------------------------------
NART_STAAN      ----------------------------------------------------------------------
NART_STAAM      ----------------------------------------------------------------------
NART_STAA9      ----------------------------------------------------------------------
NART_STAA2      ----------------------------------------------------------------------
NART_STAA1      ----------------------------------------------------------------------
NART_STAAB      ----------------------------------------------------------------------
NART_STAES      ----------------------------------------------------------------------
NART_STAEQ      ----------------------------------------------------------------------
MOT6_HUMAN      AFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAG-----
SPNS1_XENLA     ----------------------------------------------------------------------
SPNS1_DANRE     AMKALCRNPSFILSTFGFTAVAFVTGSLALWAPAFLFRAGV-----------------------------
SPIN_DROME      ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MOT13_RAT       ------------------------LTLINTHLVAHLQDLGWDPLPAAFLLSVAAISDLVGRVASGWLGDA
SPNS1_XENTR     ----------------------------------------------------------------------
MOT2_RAT        RFLDLFTHRGFLIYLSGNVVLFLGMFAPIIFLAPYAKDKGVDDYNSAFLLSVMAFTDMF-----------
MOT13_MOUSE     ---------------------GFFIPYV--HLVAHLQDLGWDPLPAAFLLSVAAVSDLVGRVASGWLGDA
MFSD6_PIG       ----------------------------------------------------------------------
MFSD6_MOUSE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXYALRGISIILFIFLPASNINAFIFGASFGFLWLSTVPATSGIVAHIFGTKYLGILYGIVF
YBFB_BACSU      WSSRKILCILYAVRALSIVILIYSHEPYL-LLAFAILFGLVDFATVAPTQMLATQYFQNYSIGLMIGWLS
MOT12_MOUSE     RCLKNYRYVCYLFAALDGLCYLCLPMLQTFPLLFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVY
MOT12_XENTR     RFLKKHRYCCYLIAGLDGLCCLFLPILTRFQLLFSVMFGYFYVALIPVVTGDVV---GTSSLSSALGVVF
MOT12_XENLA     RFLKKHRYCCYLIAGLDGLCCLFLPILTCFQLLFSVMFGYFDGAYVALIPVITGDVVGTSNLSSALGVVF
Y1420_CLOTH     TCEITDEDDTFSLKSLTVMAF----ATSIDALAIGVTFAFLQVNIIPAVTMIGITTFTFSFLGVKIGNLF
NART_STAAW      ----------------------------------------------------------------------
NART_STAAT      ----------------------------------------------------------------------
NART_STAAS      ----------------------------------------------------------------------
NART_STAAE      ----------------------------------------------------------------------
NART_STAAC      ----------------------------------------------------------------------
NART_STAA8      ----------------------------------------------------------------------
NART_STAA3      ----------------------------------------------------------------------
MT12B_DANRE     RCLKKYRNICYMFAGMEGLCCLFIPLLRTFVWLFSVLYGYFDGAYVALIPVVTSDVVGRQYLSSALGVVY
Y1211_DESHY     RGPCEIIEDRFNLKDMIILSL----ATSIDALAVGITFAFLHVDIVPAVSMIGVTTFLFSFLGVKIGNVF
NART_STAHJ      ----------------------------------------------------------------------
NART_STAAR      ----------------------------------------------------------------------
NART_STAAN      ----------------------------------------------------------------------
NART_STAAM      ----------------------------------------------------------------------
NART_STAA9      ----------------------------------------------------------------------
NART_STAA2      ----------------------------------------------------------------------
NART_STAA1      ----------------------------------------------------------------------
NART_STAAB      ----------------------------------------------------------------------
NART_STAES      ----------------------------------------------------------------------
NART_STAEQ      ----------------------------------------------------------------------
MOT6_HUMAN      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
PBUE_BACSU      ----------------------------------------------------------------------
MOT13_RAT       VPGPVARLLMLTLTGVSLALFPVAQAST-TLVVLAVAYGFTSGALTPVAFSVIPELVGTGRIYCGLGLVQ
SPNS1_XENTR     ----------------------------------------------------------------------
MOT2_RAT        ----------------------------------------------------------------------
MOT13_MOUSE     VPGPVARLLMLTLTGVSLALFPVAQASS-TLVVLAVAYGFTSGALTPVAFSVLPELVGTGRIYCGMGLVQ
MFSD6_PIG       ----------------------------------------------------------------------
MFSD6_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LSHQVXXXXXXXXXXXXHDLYGSYDYAWYLAIVLSIFAAIIHLPIKEEAVLxxxxx
YBFB_BACSU      LAHQIGSALGAYVPGVIYTVTGEYTLAFYLSIGMLVLASVMNVMLREPAAV-----
MOT12_MOUSE     FLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSIL---------------
MOT12_XENTR     FLHAVPYLVSPPIAGWLVDTTGDYTAAFLLSGFSMIFCAVL---------------
MOT12_XENLA     FLHAVPYLLSPPIAGWLVDTTGDYTAAFLLSGFSMIFCSIL---------------
Y1420_CLOTH     --------------------------------------------------------
NART_STAAW      --------------------------------------------------------
NART_STAAT      --------------------------------------------------------
NART_STAAS      --------------------------------------------------------
NART_STAAE      --------------------------------------------------------
NART_STAAC      --------------------------------------------------------
NART_STAA8      --------------------------------------------------------
NART_STAA3      --------------------------------------------------------
MT12B_DANRE     FLHAVPYLVSPPIGGWLVDTTGTY--------------------------------
Y1211_DESHY     --------------------------------------------------------
NART_STAHJ      --------------------------------------------------------
NART_STAAR      --------------------------------------------------------
NART_STAAN      --------------------------------------------------------
NART_STAAM      --------------------------------------------------------
NART_STAA9      --------------------------------------------------------
NART_STAA2      --------------------------------------------------------
NART_STAA1      --------------------------------------------------------
NART_STAAB      --------------------------------------------------------
NART_STAES      --------------------------------------------------------
NART_STAEQ      --------------------------------------------------------
MOT6_HUMAN      --------------------------------------------------------
SPNS1_XENLA     --------------------------------------------------------
SPNS1_DANRE     --------------------------------------------------------
SPIN_DROME      --------------------------------------------------------
PBUE_BACSU      --------------------------------------------------------
MOT13_RAT       MIESVGGLLGAPLSGYLRDVTGNYTASFVVAFLLAGSGVLITLP------------
SPNS1_XENTR     --------------------------------------------------------
MOT2_RAT        --------------------------------------------------------
MOT13_MOUSE     MIESIGGLLGAPLSGYLRDVTGNYTASFVVA-------------------------
MFSD6_PIG       --------------------------------------------------------
MFSD6_MOUSE     --------------------------------------------------------