[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21667.1

[Show Plain Result]


## Summary of Sequence Search
    1::204
    3::200     5e-32  35%  200 aa  ESTE_VIBMI RecName: Full=Arylesterase;         EC=3.1.1.2;AltName:
    9::200     2e-29  33%  208 aa  TESA_ECOLI RecName: Full=Acyl-CoA thioesterase I;       
    9::200     2e-29  33%  208 aa  TESA_ECOL6 RecName: Full=Acyl-CoA thioesterase I;       
  540::723     1e-05  28%  879 aa  Y407_MYCPN RecName: Full=Uncharacterized protein MPN_407;
   28::68      8e-04  39%  390 aa  DEOB_ALKMQ RecName: Full=Phosphopentomutase;       
    1::204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRFIIKIIAVCLVSINVNALENVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGST
ESTE_VIBMI      ---RLLSLVLFFCLSAAS-QASEKLLVLGDSLSAGYQMPIEKSWPSLLPDALLEHGQDVTVINGSISGDT
TESA_ECOLI      ---RWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK---TSVVNASISGDT
TESA_ECOL6      ---RWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK---TSVVNASISGDT
Y407_MYCPN      -----------------------NWLFIGDSMTHGVGTDGYSSAPQLLEQSLNDFGYRDVVINSAINGSN
DEOB_ALKMQ      -------------------------------------------------------------------GSN


                         .         .         *         .         .         .         .:140
query           SAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGIS
ESTE_VIBMI      TGNGLARLPQLLDQHTPDLVLIELGANDGLRGFPPKVITSNLSKMISLIKDSGANVVMMQIRVPPNYGKR
TESA_ECOLI      SQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRR
TESA_ECOL6      SQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRR
Y407_MYCPN      TSLELYMQNHRFKQKNIDVYVLNLGTNDLAQGVYTVEQYKNLTQILDLLHTQSAHVVLANIAPSSLLRSS
DEOB_ALKMQ      TLGNISKVEQGIALPN--LTALGLGNIEDIQGVNPVESPK------------------------------


                         +         .         .         .         .         *         .:210
query           YKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSIINFIxx
ESTE_VIBMI      YSDMFYDIYPKLAEHQQVQLMPFFLEHVITKPEWMMDDGLHPKPEAQPWIAEFVAQELVKHL--
TESA_ECOLI      YNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQL------
TESA_ECOL6      YNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQL------
Y407_MYCPN      EKKTFNDFLEGIPKDSNYSSFVHLLDQKSLFLQLAKVSGIDINE-NKLFNTDFLKKS-------
DEOB_ALKMQ      ----------------------------------------------------------------