[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21725.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
    1::388       0.0 100%  388 aa  DXR_PELUB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::374     4e-63  37%  375 aa  DXR_SULSY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::371     5e-63  36%  385 aa  DXR_CLOK5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::371     5e-63  36%  385 aa  DXR_CLOK1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::370     2e-62  35%  385 aa  DXR_CLONN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::373     2e-61  37%  385 aa  DXR_CLOBB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-61  36%  385 aa  DXR_CLOAB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::345     7e-61  36%  384 aa  DXR_CLOD6 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::381     1e-59  34%  387 aa  DXR_CLOB8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::361     5e-59  33%  384 aa  DXR_CLOPE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::347     5e-59  35%  382 aa  DXR_BACV8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::361     2e-58  33%  384 aa  DXR_CLOP1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::373     2e-58  36%  385 aa  DXR_CLOBA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::361     3e-58  33%  384 aa  DXR_CLOPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::341     6e-58  37%  387 aa  DXR_WOLWR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     2e-57  32%  385 aa  DXR_CLOB6 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::338     2e-57  36%  387 aa  DXR_WOLPM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::375     5e-57  33%  384 aa  DXR_CLOTE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::363     5e-57  33%  385 aa  DXR_ANAPZ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::383     7e-57  34%  387 aa  DXR_EHRCJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
   10::276     1e-56  39%  390 aa  DXR_BACTN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::377     2e-56  34%  382 aa  DXR_THEPX RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     2e-56  31%  385 aa  DXR_CLOBM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::273     2e-56  40%  388 aa  DXR_BACFN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     3e-56  36%  389 aa  DXR_WOLTR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     4e-56  34%  382 aa  DXR_PELPB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     4e-56  31%  385 aa  DXR_CLOBL RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     4e-56  31%  385 aa  DXR_CLOBK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     4e-56  31%  385 aa  DXR_CLOBJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::273     4e-56  40%  388 aa  DXR_BACFR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::377     2e-55  34%  382 aa  DXR_THEP3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::369     2e-55  34%  388 aa  DXR_CLOPH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     4e-55  36%  387 aa  DXR_FUSNN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     6e-55  31%  385 aa  DXR_CLOBH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     6e-55  31%  385 aa  DXR_CLOB1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::353     2e-54  32%  382 aa  DXR_BREBN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::345     3e-54  36%  373 aa  DXR_PERMH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::350     4e-54  34%  381 aa  DXR_CLOTH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::377     2e-53  33%  380 aa  DXR_EUBR3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::362     1e-52  33%  381 aa  DXR_THEYD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::340     1e-52  37%  382 aa  DXR_THETN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::269     1e-52  38%  387 aa  DXR_PELTS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::344     2e-52  32%  384 aa  DXR_HALOH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     2e-52  33%  387 aa  DXR_EHRRG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     2e-52  33%  386 aa  DXR_EHRCR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::357     3e-52  33%  376 aa  DXR_THEP1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-52  33%  387 aa  DXR_EHRRW RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::349     3e-52  32%  381 aa  DXR_ALKOO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::357     5e-52  33%  376 aa  DXR_THEMA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::268     5e-52  40%  387 aa  DXR_CHLT3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::374     1e-51  33%  391 aa  DXR_WOLPP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::375     1e-51  33%  383 aa  DXR_VESOH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     1e-51  31%  380 aa  DXR_EUBE2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     1e-51  35%  380 aa  DXR_LISMF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     1e-51  35%  380 aa  DXR_LISMC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::357     2e-51  35%  375 aa  DXR_THENN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::355     3e-51  33%  385 aa  DXR_PORGI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::355     3e-51  33%  385 aa  DXR_PORG3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-51  33%  382 aa  DXR_BACHD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     7e-51  35%  380 aa  DXR_LISMO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     9e-51  35%  380 aa  DXR_LISMH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::268     9e-51  37%  383 aa  DXR_BACSU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     2e-50  31%  398 aa  DXR_SHIFL RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     2e-50  34%  385 aa  DXR_FRATH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     2e-50  34%  385 aa  DXR_FRATF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     2e-50  31%  398 aa  DXR_ECOLI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     2e-50  31%  398 aa  DXR_ECO57 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::365     3e-50  33%  380 aa  DXR_LISIN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     3e-50  33%  385 aa  DXR_FRATN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::347     3e-50  32%  379 aa  DXR_CHLMU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     3e-50  34%  385 aa  DXR_FRATW RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     3e-50  34%  385 aa  DXR_FRATT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     3e-50  34%  385 aa  DXR_FRATM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::369     3e-50  34%  385 aa  DXR_FRAT1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::351     5e-50  31%  381 aa  DXR_DESHD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::383     8e-50  32%  398 aa  DXR_PHOLL RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::268     8e-50  36%  383 aa  DXR_BACA2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::327     1e-49  40%  356 aa  DXR_CAMJJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::327     2e-49  40%  356 aa  DXR_CAMJE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::327     2e-49  40%  356 aa  DXR_CAMJ8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     2e-49  31%  398 aa  DXR_CYAP7 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::352     3e-49  33%  388 aa  DXR_ZYMMO RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::388     3e-49  32%  397 aa  DXR_PROMH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::383     3e-49  30%  390 aa  DXR_MICAN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::351     3e-49  30%  381 aa  DXR_DESHY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::327     3e-49  40%  356 aa  DXR_CAMJR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::370     4e-49  34%  386 aa  DXR_FRATO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     5e-49  33%  380 aa  DXR_LISW6 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::393     7e-49  30%  409 aa  DXR_PROM5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::358     9e-49  31%  381 aa  DXR_TREDE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::376     9e-49  34%  399 aa  DXR_PSYIN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     1e-48  31%  398 aa  DXR_TOLAT RecName: Full=1-deoxy-D-xylulose 5-phosphate
   12::376     1e-48  34%  411 aa  DXR_MANSM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::352     1e-48  33%  384 aa  DXR_CARHZ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::357     1e-48  37%  366 aa  DXR_NAUPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     1e-48  33%  384 aa  DXR_GEOSF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::343     1e-48  39%  356 aa  DXR_CAMJD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::361     2e-48  33%  370 aa  DXR_FERNB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::381     2e-48  30%  383 aa  DXR_BACP2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     3e-48  33%  395 aa  DXR_SHEWM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     3e-48  30%  398 aa  DXR_SALTY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     3e-48  30%  398 aa  DXR_SALTI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     3e-48  30%  398 aa  DXR_SALPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-48  30%  398 aa  DXR_SALCH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::343     4e-48  38%  359 aa  DXR_CAMLR RecName: Full=1-deoxy-D-xylulose 5-phosphate
   21::357     4e-48  32%  380 aa  DXR_AQUAE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::264     6e-48  39%  376 aa  DXR_MACCJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::370     9e-48  32%  381 aa  DXR_GEOSW RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::385     9e-48  30%  401 aa  DXR_ACAM1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     1e-47  30%  398 aa  DXR_ANAVT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::368     1e-47  33%  400 aa  DXR_ALISL RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::358     1e-47  34%  396 aa  DXR_ACTP2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::375     2e-47  30%  383 aa  DXR_RUTMC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     2e-47  31%  379 aa  DXR_CHLTR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     2e-47  31%  379 aa  DXR_CHLTA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     2e-47  36%  380 aa  DXR2_BACHK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::344     2e-47  32%  385 aa  DXR_EXISA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::268     2e-47  36%  383 aa  DXR_BACLD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::356     2e-47  30%  399 aa  DXR_ANASP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     3e-47  31%  379 aa  DXR_CHLTB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::343     3e-47  31%  379 aa  DXR_CHLT2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-47  32%  379 aa  DXR_CHLCV RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERPY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERPP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERPN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERPG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERPE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-47  30%  398 aa  DXR_YERP3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::368     4e-47  33%  400 aa  DXR_VIBFM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::348     4e-47  34%  386 aa  DXR_PELPD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     4e-47  33%  398 aa  DXR_CYAP8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::358     4e-47  33%  396 aa  DXR_ACTPJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     5e-47  30%  398 aa  DXR_YERPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     5e-47  30%  398 aa  DXR_YERPB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     5e-47  30%  398 aa  DXR_CYAA5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     5e-47  36%  380 aa  DXR2_BACCR RecName: Full=1-deoxy-D-xylulose 5-phosphate
   75::430     6e-47  33%  470 aa  DXR_MENPI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     6e-47  36%  380 aa  DXR_BACC7 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     6e-47  36%  380 aa  DXR_BACC3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     6e-47  36%  380 aa  DXR_BACC1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     6e-47  36%  380 aa  DXR2_BACCZ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     6e-47  36%  380 aa  DXR2_BACAN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::375     1e-46  30%  396 aa  DXR_SHEFN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     1e-46  31%  398 aa  DXR_NOSP7 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::368     1e-46  33%  400 aa  DXR_VIBF1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   12::340     1e-46  37%  377 aa  DXR_MYCPE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     1e-46  33%  396 aa  DXR_HAEPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::266     1e-46  36%  380 aa  DXR_BACCQ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::384     2e-46  31%  404 aa  DXR_PROMP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::389     2e-46  31%  408 aa  DXR_PROM9 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::360     2e-46  32%  387 aa  DXR_DESRM RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::266     3e-46  35%  407 aa  DXR_NITWN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::384     3e-46  32%  397 aa  DXR_HAEI8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-46  31%  386 aa  DXR_GEOUR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::350     4e-46  29%  385 aa  DXR_MOOTA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::344     4e-46  32%  389 aa  DXR_LEPIN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::350     4e-46  31%  389 aa  DXR_LEPIC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-46  31%  398 aa  DXR_ERWCT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::277     4e-46  34%  396 aa  DXR_ANAMM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::277     4e-46  34%  396 aa  DXR_ANAMF RecName: Full=1-deoxy-D-xylulose 5-phosphate
   77::433     5e-46  31%  473 aa  DXR_ORYSJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::361     5e-46  30%  391 aa  DXR_HELMI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::384     5e-46  32%  397 aa  DXR_HAEIE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     7e-46  32%  395 aa  DXR_SHESH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::396     7e-46  31%  397 aa  DXR_BLOPB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::276     9e-46  37%  397 aa  DXR_AGRVS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::370     1e-45  32%  402 aa  DXR_VIBCM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::370     1e-45  32%  402 aa  DXR_VIBCH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::370     1e-45  32%  402 aa  DXR_VIBC3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::384     2e-45  32%  397 aa  DXR_HAEIN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     2e-45  33%  396 aa  DXR_HAEDU RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::359     2e-45  29%  407 aa  DXR_NITHX RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     2e-45  31%  381 aa  DXR_LYSSC RecName: Full=1-deoxy-D-xylulose 5-phosphate
   28::267     2e-45  39%  381 aa  DXR_CLOCE RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::356     2e-45  31%  382 aa  DXR_CHLCH RecName: Full=1-deoxy-D-xylulose 5-phosphate
   81::437     2e-45  32%  477 aa  DXR_ARATH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::384     3e-45  32%  397 aa  DXR_HAEIG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-45  32%  379 aa  DXR_CHLFF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::378     4e-45  30%  398 aa  DXR_YERE8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::288     4e-45  35%  407 aa  DXR_RHOPT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     4e-45  30%  392 aa  DXR_GLOVI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::370     4e-45  31%  399 aa  DXR_ACIBS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::355     6e-45  34%  369 aa  DXR_HELHP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::368     6e-45  31%  379 aa  DXR_CHLAB RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::282     6e-45  34%  407 aa  DXR_BRAJA RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::366     8e-45  31%  384 aa  DXR_PROVI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::369     8e-45  30%  398 aa  DXR_ACIBC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::369     1e-44  30%  398 aa  DXR_ACIBT RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::350     1e-44  30%  385 aa  DXR1_BACCZ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     1e-44  28%  385 aa  DXR_GEOBB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::365     1e-44  29%  398 aa  DXR_ACIAD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::351     2e-44  34%  358 aa  DXR_WOLSU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::272     2e-44  34%  384 aa  DXR_PARUW RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::369     2e-44  30%  398 aa  DXR_ACIBY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::369     2e-44  30%  398 aa  DXR_ACIB5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::369     2e-44  30%  398 aa  DXR_ACIB3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::288     2e-44  34%  407 aa  DXR_RHOPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::364     2e-44  29%  395 aa  DXR_NITMU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::345     2e-44  29%  385 aa  DXR_DESPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::282     2e-44  34%  407 aa  DXR_BRASO RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::282     3e-44  35%  407 aa  DXR_RHOPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::282     3e-44  35%  407 aa  DXR_RHOP2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::350     3e-44  35%  385 aa  DXR1_BACAN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     4e-44  28%  385 aa  DXR_GEOSM RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::350     4e-44  35%  385 aa  DXR1_BACHK RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::385     5e-44  32%  402 aa  DXR_LAWIP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::349     5e-44  36%  359 aa  DXR_CAMHC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::349     6e-44  29%  396 aa  DXR_RHIEC RecName: Full=1-deoxy-D-xylulose 5-phosphate
   11::356     8e-44  29%  408 aa  DXR_GLUOX RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::386     8e-44  29%  411 aa  DXR_COLP3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::365     1e-43  30%  382 aa  DXR_PROA2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::366     1e-43  31%  394 aa  DXR_NEIMA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     1e-43  30%  384 aa  DXR_GEOMG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::376     1e-43  30%  404 aa  DXR_ERWT9 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::343     1e-43  28%  384 aa  DXR_DESAP RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::350     1e-43  31%  385 aa  DXR1_BACCR RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::373     1e-43  29%  413 aa  DXR_THEEB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::381     1e-43  31%  396 aa  DXR_SHEPW RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     1e-43  31%  396 aa  DXR_SHEPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::283     1e-43  40%  412 aa  DXR_PROMA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::357     2e-43  31%  394 aa  DXR_NEIG1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     2e-43  29%  386 aa  DXR_GEOSL RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::357     3e-43  31%  398 aa  DXR_PECCP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::282     4e-43  33%  413 aa  DXR_NITEC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::357     4e-43  31%  394 aa  DXR_NEIMB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::286     5e-43  37%  415 aa  DXR_SYNSC RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::356     5e-43  29%  384 aa  DXR_CHLPD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::327     7e-43  34%  359 aa  DXR_THELT RecName: Full=1-deoxy-D-xylulose 5-phosphate
   87::382     7e-43  31%  384 aa  DXR_EXIS2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::396     7e-43  33%  398 aa  DXR_BUCAI RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::282     7e-43  34%  407 aa  DXR_BRASB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::284     9e-43  34%  413 aa  DXR_NITEU RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::344     9e-43  30%  382 aa  DXR_CHLPB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::353     1e-42  35%  360 aa  DXR_CAMFF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::348     1e-42  31%  379 aa  DXR_BACSK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::349     2e-42  28%  396 aa  DXR_RHIE6 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::280     2e-42  35%  402 aa  DXR_VIBVY RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::383     2e-42  28%  407 aa  DXR_OLICO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::267     2e-42  33%  382 aa  DXR_GEOKA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::396     2e-42  33%  398 aa  DXR_BUCAT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::396     2e-42  33%  398 aa  DXR_BUCA5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::382     3e-42  29%  401 aa  DXR_VIBHB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::361     3e-42  28%  391 aa  DXR_SINMW RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::280     3e-42  35%  402 aa  DXR_VIBVU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     3e-42  30%  395 aa  DXR_SHELP RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::356     3e-42  30%  382 aa  DXR_CHLTE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::340     5e-42  29%  385 aa  DXR_THERP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::365     5e-42  28%  402 aa  DXR_SYNP6 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::365     5e-42  28%  402 aa  DXR_SYNE7 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::354     5e-42  31%  395 aa  DXR_ELUMP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::357     6e-42  29%  401 aa  DXR_VIBPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::360     6e-42  32%  402 aa  DXR_PSYA2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::344     6e-42  30%  389 aa  DXR_LEPBL RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::344     6e-42  30%  389 aa  DXR_LEPBJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
   22::378     6e-42  32%  398 aa  DXR_BAUCH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::254     8e-42  33%  394 aa  DXR_RHOS5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::383     8e-42  30%  402 aa  DXR_PSYCK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::372     8e-42  33%  412 aa  DXR_PROM1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   20::268     8e-42  36%  382 aa  DXR_PELLD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::366     8e-42  35%  368 aa  DXR_HELPH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::353     8e-42  29%  397 aa  DXR_AGRT5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::359     1e-41  29%  391 aa  DXR_RHIME RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::358     1e-41  29%  399 aa  DXR_EDWI9 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::268     1e-41  34%  390 aa  DXR_GEOLS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::347     2e-41  29%  379 aa  DXR_CHLPN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::346     2e-41  34%  365 aa  DXR_CAMC5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::286     3e-41  34%  398 aa  DXR_SERP5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     3e-41  28%  394 aa  DXR_RHOS4 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     4e-41  28%  394 aa  DXR_RHOSK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     4e-41  28%  394 aa  DXR_RHOS1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::354     4e-41  30%  397 aa  DXR_AGRRK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     5e-41  30%  396 aa  DXR_SHESA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::363     5e-41  28%  396 aa  DXR_PSEU5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::352     5e-41  29%  393 aa  DXR_NITOC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     9e-41  30%  396 aa  DXR_SHEHH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::274     9e-41  35%  392 aa  DXR_SACD2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::282     9e-41  32%  407 aa  DXR_RHOPB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::349     1e-40  27%  396 aa  DXR_RHIL3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     1e-40  30%  396 aa  DXR_SHEON RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::363     1e-40  28%  396 aa  DXR_PSE14 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::265     1e-40  35%  397 aa  DXR_PHOPR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::379     2e-40  32%  397 aa  DXR_WIGBR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     2e-40  30%  396 aa  DXR_SHESR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     2e-40  30%  396 aa  DXR_SHEB2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   99::356     2e-40  33%  382 aa  DXR_CHLL2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::350     3e-40  28%  397 aa  DXR_SOLUE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     3e-40  30%  396 aa  DXR_SHESM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     3e-40  30%  396 aa  DXR_SHEB5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::364     3e-40  30%  385 aa  DXR_UNCTG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     3e-40  30%  396 aa  DXR_SHEB9 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::261     3e-40  35%  391 aa  DXR_RHISN RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::410     3e-40  31%  412 aa  DXR_PROMT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::283     3e-40  32%  397 aa  DXR_IDILO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::273     4e-40  33%  393 aa  DXR_RALSO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::356     4e-40  27%  394 aa  DXR_ARTS2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::273     1e-39  33%  393 aa  DXR_RALEH RecName: Full=1-deoxy-D-xylulose 5-phosphate
  101::363     1e-39  35%  405 aa  DXR_PASMU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::378     1e-39  27%  398 aa  DXR_CELJU RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::361     1e-39  28%  396 aa  DXR_PSEF5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::366     3e-39  32%  368 aa  DXR_HELPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::288     5e-39  36%  417 aa  DXR_SYNS9 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::354     5e-39  28%  392 aa  DXR_SYNJB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::351     5e-39  30%  394 aa  DXR_STRAW RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::367     5e-39  27%  407 aa  DXR_RHOP5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::273     5e-39  32%  395 aa  DXR_RALEJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::356     5e-39  29%  398 aa  DXR_DECAR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::361     6e-39  28%  396 aa  DXR_PSEU2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::334     6e-39  29%  361 aa  DXR_LEIXX RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::288     8e-39  35%  416 aa  DXR_SYNS3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::264     8e-39  38%  412 aa  DXR_PROMM RecName: Full=1-deoxy-D-xylulose 5-phosphate
   28::384     8e-39  28%  386 aa  DXR_LEPBP RecName: Full=1-deoxy-D-xylulose 5-phosphate
   28::384     8e-39  28%  386 aa  DXR_LEPBA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::366     8e-39  32%  368 aa  DXR_HELPY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::280     1e-38  35%  409 aa  DXR_SYNPX RecName: Full=1-deoxy-D-xylulose 5-phosphate
   24::377     1e-38  28%  418 aa  DXR_STRCO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::363     1e-38  27%  394 aa  DXR_PSEMY RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::366     1e-38  34%  368 aa  DXR_HELPJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     1e-38  32%  398 aa  DXR_BURCM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     1e-38  32%  398 aa  DXR_BURA4 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::344     1e-38  31%  390 aa  DXR_ANAD2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::251     2e-38  35%  392 aa  DXR_SYNJA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::358     2e-38  28%  396 aa  DXR_PSEFS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::352     2e-38  28%  383 aa  DXR_DESOH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     2e-38  33%  398 aa  DXR_BURVG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::252     2e-38  33%  390 aa  DXR_ANASK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::357     3e-38  28%  394 aa  DXR_SYNY3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::273     3e-38  32%  396 aa  DXR_RALPJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::394     3e-38  27%  396 aa  DXR_BIFLO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::373     4e-38  27%  396 aa  DXR_PSEAB RecName: Full=1-deoxy-D-xylulose 5-phosphate
   16::362     5e-38  26%  402 aa  DXR_RHOCS RecName: Full=1-deoxy-D-xylulose 5-phosphate
   22::357     5e-38  32%  398 aa  DXR_BUCAP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::373     7e-38  27%  396 aa  DXR_PSEA7 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     7e-38  32%  401 aa  DXR_BURP8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::373     9e-38  27%  396 aa  DXR_PSEAE RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::373     9e-38  27%  396 aa  DXR_PSEA8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::355     9e-38  29%  387 aa  DXR_CYAP4 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::394     9e-38  27%  396 aa  DXR_BIFLD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::243     1e-37  37%  368 aa  DXR_TROW8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::338     1e-37  27%  367 aa  DXR_THET2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::394     1e-37  27%  396 aa  DXR_BIFLI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::276     1e-37  32%  391 aa  DXR_ACIF5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::278     1e-37  32%  393 aa  DXR_ACIF2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::338     2e-37  27%  367 aa  DXR_THET8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::363     2e-37  28%  396 aa  DXR_PSESM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::352     2e-37  27%  394 aa  DXR_METFK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::273     2e-37  32%  393 aa  DXR_CUPTR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::347     3e-37  29%  387 aa  DXR_SYMTH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::366     3e-37  33%  368 aa  DXR_HELP2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     3e-37  28%  395 aa  DXR_SHEAM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::357     6e-37  27%  398 aa  DXR_SODGM RecName: Full=1-deoxy-D-xylulose 5-phosphate
  103::356     6e-37  31%  394 aa  DXR_ARTCA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::243     8e-37  37%  368 aa  DXR_TROWT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     8e-37  31%  401 aa  DXR_BURPP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::358     1e-36  32%  366 aa  DXR_HELPG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::359     1e-36  28%  398 aa  DXR_BURCJ RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::359     1e-36  28%  398 aa  DXR_BURCH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::359     1e-36  28%  398 aa  DXR_BURCC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::359     1e-36  28%  398 aa  DXR_BURCA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::286     2e-36  30%  397 aa  DXR_AERS4 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::389     2e-36  27%  408 aa  DXR_DESVV RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::389     2e-36  27%  408 aa  DXR_DESVH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::359     2e-36  28%  398 aa  DXR_BURS3 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     2e-36  31%  398 aa  DXR_BURPS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     2e-36  31%  398 aa  DXR_BURP6 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     2e-36  31%  398 aa  DXR_BURP1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     2e-36  31%  398 aa  DXR_BURP0 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::286     2e-36  30%  397 aa  DXR_AERHH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::276     3e-36  30%  394 aa  DXR_XYLFM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     3e-36  31%  398 aa  DXR_BURMS RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     3e-36  31%  398 aa  DXR_BURMA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     3e-36  31%  398 aa  DXR_BURM9 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     3e-36  31%  398 aa  DXR_BURM7 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::276     5e-36  30%  394 aa  DXR_XYLFT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::276     5e-36  30%  394 aa  DXR_XYLF2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    8::376     5e-36  26%  393 aa  DXR_JANSC RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     5e-36  32%  398 aa  DXR_BURTA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     5e-36  32%  398 aa  DXR_BURM1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::362     6e-36  27%  407 aa  DXR_DESDG RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::276     8e-36  30%  396 aa  DXR_XYLFA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::279     8e-36  30%  401 aa  DXR_BURXL RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::277     1e-35  29%  388 aa  DXR_LARHH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::350     2e-35  26%  395 aa  DXR_SILST RecName: Full=1-deoxy-D-xylulose 5-phosphate
  104::363     2e-35  30%  396 aa  DXR_PSEPF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::357     3e-35  26%  411 aa  DXR_PSYWF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::358     4e-35  27%  390 aa  DXR_JANMA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::361     5e-35  27%  391 aa  DXR_HERAR RecName: Full=1-deoxy-D-xylulose 5-phosphate
   21::416     1e-34  29%  455 aa  DXR_RHOBA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    2::352     1e-34  29%  368 aa  DXR_MYCGA RecName: Full=1-deoxy-D-xylulose 5-phosphate
   94::254     2e-34  40%  390 aa  DXR_PARDP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::334     6e-34  27%  376 aa  DXR_TREPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::357     6e-34  26%  394 aa  DXR_COREF RecName: Full=1-deoxy-D-xylulose 5-phosphate
    3::343     6e-34  27%  387 aa  DXR_CORDI RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::365     8e-34  25%  400 aa  DXR_PSEPK RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::356     8e-34  25%  394 aa  DXR_METCA RecName: Full=1-deoxy-D-xylulose 5-phosphate
  121::375     2e-33  27%  395 aa  DXR_SILPO RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::271     3e-33  30%  413 aa  DXR_MYCTU RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::271     3e-33  30%  413 aa  DXR_MYCTA RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::271     3e-33  30%  413 aa  DXR_MYCBT RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::271     3e-33  30%  413 aa  DXR_MYCBP RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::271     3e-33  30%  413 aa  DXR_MYCBO RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::278     9e-33  29%  394 aa  DXR_CHRVO RecName: Full=1-deoxy-D-xylulose 5-phosphate
   21::362     1e-32  25%  398 aa  DXR_RHOSR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::360     1e-32  25%  392 aa  DXR_RALME RecName: Full=1-deoxy-D-xylulose 5-phosphate
  101::351     3e-32  29%  386 aa  DXR_KITGR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::282     1e-31  29%  396 aa  DXR_PSEPW RecName: Full=1-deoxy-D-xylulose 5-phosphate
   97::271     2e-31  37%  394 aa  DXR_BEUC1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::278     5e-31  28%  396 aa  DXR_XANOR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::278     5e-31  28%  396 aa  DXR_XANOM RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::278     6e-31  29%  396 aa  DXR_XANC5 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    5::264     6e-31  30%  396 aa  DXR_DEIRA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    7::278     8e-31  28%  396 aa  DXR_XANAC RecName: Full=1-deoxy-D-xylulose 5-phosphate
   15::376     1e-30  26%  407 aa  DXR_MYCPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
   15::376     1e-30  26%  407 aa  DXR_MYCA1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::286     2e-30  28%  400 aa  DXR_PSEP1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::349     2e-30  28%  396 aa  DXR_XANCP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::349     2e-30  28%  396 aa  DXR_XANC8 RecName: Full=1-deoxy-D-xylulose 5-phosphate
  106::282     2e-30  35%  396 aa  DXR_PSEPG RecName: Full=1-deoxy-D-xylulose 5-phosphate
   21::359     2e-30  25%  394 aa  DXR_NOCFA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::280     3e-30  28%  403 aa  DXR_HAHCH RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::353     3e-30  24%  392 aa  DXR_CORGL RecName: Full=1-deoxy-D-xylulose 5-phosphate
   13::351     4e-30  24%  398 aa  DXR_MYCS2 RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::278     9e-30  28%  396 aa  DXR_XANOP RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::349     1e-29  28%  396 aa  DXR_XANCB RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::354     2e-29  24%  406 aa  DXR_MYCLE RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::354     2e-29  24%  406 aa  DXR_MYCLB RecName: Full=1-deoxy-D-xylulose 5-phosphate
    6::353     2e-29  24%  392 aa  DXR_CORGB RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::371     3e-29  23%  402 aa  DXR_MYCMM RecName: Full=1-deoxy-D-xylulose 5-phosphate
   14::371     4e-29  23%  402 aa  DXR_MYCUA RecName: Full=1-deoxy-D-xylulose 5-phosphate
    4::276     6e-29  30%  394 aa  DXR_ARTAT RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::358     1e-28  24%  407 aa  DXR_PROAC RecName: Full=1-deoxy-D-xylulose 5-phosphate
   12::373     1e-28  29%  391 aa  DXR_BLOFL RecName: Full=1-deoxy-D-xylulose 5-phosphate
  123::273     1e-28  38%  399 aa  DXR_CAUCR RecName: Full=1-deoxy-D-xylulose 5-phosphate
  123::273     1e-28  38%  399 aa  DXR_CAUCN RecName: Full=1-deoxy-D-xylulose 5-phosphate
  121::287     2e-28  36%  399 aa  DXR_BORA1 RecName: Full=1-deoxy-D-xylulose 5-phosphate
   19::287     5e-28  27%  408 aa  DXR_CORJK RecName: Full=1-deoxy-D-xylulose 5-phosphate
  121::361     6e-28  28%  399 aa  DXR_BORPD RecName: Full=1-deoxy-D-xylulose 5-phosphate
    9::289     6e-28  26%  403 aa  DXR_AZOSE RecName: Full=1-deoxy-D-xylulose 5-phosphate
  121::287     3e-26  34%  399 aa  DXR_BORPE RecName: Full=1-deoxy-D-xylulose 5-phosphate
  121::287     3e-26  34%  399 aa  DXR_BORPA RecName: Full=1-deoxy-D-xylulose 5-phosphate
  121::287     3e-26  34%  399 aa  DXR_BORBR RecName: Full=1-deoxy-D-xylulose 5-phosphate
    1::237     1e-06  28%  258 aa  DAPB_PELUB RecName: Full=Dihydrodipicolinate reductase;       
    2::117     1e-04  32%  163 aa  COAD_BORAP RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::117     1e-04  33%  163 aa  COAD_BORGA RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::117     3e-04  31%  163 aa  COAD_BORBZ RecName: Full=Phosphopantetheine adenylyltransferase;   
    2::117     3e-04  31%  163 aa  COAD_BORBU RecName: Full=Phosphopantetheine adenylyltransferase;   
  299::502     4e-04  31% 1759 aa  YCF1_PHAVU RecName: Full=Putative membrane protein ycf1;
  155::246     5e-04  28%  278 aa  RSGA_MYCGE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  126::304     6e-04  27%  414 aa  Y2628_BORBU RecName: Full=Putative ankyrin repeat protein BB_B28;
    1::177     6e-04  30%  471 aa  SCPA_MYCGE RecName: Full=Segregation and condensation protein A;
    6::135     6e-04  37%  343 aa  RSMC_BUCCC RecName: Full=Ribosomal RNA small subunit
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYNSFLITTKLLK
DXR_PELUB       MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYNSFLITTKLLK
DXR_SULSY       MLKVGILGSTGSVGSQALDVIRKYKDQIKVELLGASKLSENLINQIKEFKPSYVYVENAEEKSIDD----
DXR_CLOK5       MKKISILGVTGSIGTQALDILRKDEENFKLVAVSSHSSVNKLLDIVDEFNPSYAVLTERNAYLKFKDHCK
DXR_CLOK1       MKKISILGVTGSIGTQALDILRKDEENFKLVAVSSHSSVNKLLDIVDEFNPSYAVLTERNAYLKFKDHCK
DXR_CLONN       MKNICILGATGSIGTQTLDVIEKESNKFKLVAFSANKSYEKIITIIEKFNPVYGAINDKETFLKVKDHIN
DXR_CLOBB       MKKLSILGVTGSIGTQALDVIKKSNGELKLIGATANSSVNKMIEIIEEFNPKYVGMMDKNSADKLEKYCK
DXR_CLOAB       MKNISILGATGSIGTQTLDVIRNDSEAFKLLAVSAHSNFKKMIEIIDEFKPELVVMVDYNKVLDYC-CEK
DXR_CLOD6       MKKISILGSTGSIGKQTLDVVRDNRDKFEIVAISANSNIELLLEQIVEFKPKYVTVFEENKALKLKEMLK
DXR_CLOB8       MKNISILGATGSIGSQTLDVIRKSNGELKLIGVTANTSVKKVIEIIEEFKPSYVGMMDAVSTHEIKKYCE
DXR_CLOPE       MKRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTLDIIKEFSPKYVAINHEESYKKLVDLVK
DXR_BACV8       -KQIAILGSTGSIGTQALQVIEEHPDLYEVYALTANNRVDLLVEQARKFMPEAVVIANEEKYLQLKEALS
DXR_CLOP1       MKRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTMDIIKEFSPKYVAINHEESYKKLVDLVK
DXR_CLOBA       MKKLSILGVTGSIGTQALDVIKNSNGELKLIGVTANSSVEKMIKIIEEFDPKYVGMMDKTAGEIKEYCDK
DXR_CLOPS       MKRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTMDIIKEFSPKYVAINHEESYKKLVDLVK
DXR_WOLWR       MKKVSVLGSTGSVGKKTVDLLSKRKEEYQVEALSAHSNFALLAHQAKLLNAKYVAISDERLYKDLKESLL
DXR_CLOB6       MKNITILGATGSIGTQTLDVIRKEKEELKLVAISANKSYKKVIEIIKEFKPKYAVLMEENAFKIVEDFCV
DXR_WOLPM       MKKVSVLGSTGSVGKKTVDLLSKRKEEYQVEALSAHSNFALLAHQAKLLNAKYVAISDERLYKDLKESLL
DXR_CLOTE       MKNICILGATGSIGTQTLEVIREEKENLKLYXXXXXXXXXXXXXXXXXXXXXYVSMTDKEAFLKVKEFMK
DXR_ANAPZ       MKKVSVFGSTGFIGKTTVGILSGNTEDFKVIALVAGSNVSLLAQQAKLLNAEMAVIADDAQYEELKRSLH
DXR_EHRCJ       MKTVSVFGSTGAIGQMIIDIIFSELDKYQVKVLVAKSNIQLLAFQAKLVNAERVVITDVNLYRELKDLLL
DXR_BACTN       -KQIAILGSTGSIGTQALQVIEEHPDLYEAYALTANNRVELLIAQARKFQPEVVVIANEEKYAQLKEALS
DXR_THEPX       MKKVIILGSTGSIGTQTLDVIKNFRENFEIVGLTAYNNVELLSKQIREFNPKVVAVKDEDK---ANQLRE
DXR_CLOBM       MKNITILGATGSIGTQTLDVIRKGNEELKLVAISANKSYKKVIEIIKEFKPKYAVLMEENAFKIVEDFCV
DXR_BACFN       -KQIAILGSTGSIGTQALQVIEEHPELYEVYALTANNKVDLLIAQARKFMPEAVVIANEEKYAQLKEALS
DXR_WOLTR       MKKISVLGSTGSIGKKTVDLLLKRKEEYQVEALSTCSNFALLACQAKLLNARYVAISNKRFYKDLKESLL
DXR_PELPB       MRSLAILGSTGSIGLSTLDVVRQHPEKFKIAGLAEGHDVALLAEQIKEFLPAAVSVRDADSVKKLQTLLG
DXR_CLOBL       MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSYKKVIEIIKEFKPKYTVLMEENAFKIVEDFCI
DXR_CLOBK       MKNITILGATGSIGTQTLDVIRKEKEELKLVAISANKSYKKVIEIIKEFKPKYAVLMEENAFKIVEDFCI
DXR_CLOBJ       MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSYKKVIEIIKEFKPKYAVLMEENAFKIVEDFCI
DXR_BACFR       -KQIAILGSTGSIGTQALQVIEEHPELYEVYALTANNKVDLLIAQARKFMPEAVVIANEEKYAQLKEALS
DXR_THEP3       MKKVIILGSTGSIGTQTLDVIKNFRENFEIVGLTAYNNVELLSKQIREFNPKVVAVKDEDK---ANQLRE
DXR_CLOPH       MKIISVLGSTGSIGTQTLEVVRNN-KDLKVSALAASSNITLLEEQIREFHPKLVCVYDREKALELKKRVS
DXR_FUSNN       MKKILILGSTGSIGTNALELIRNNREQYQVVGISGNKNIDLLKKQIEEFKPISIYVGSEQDAIYLKKEYS
DXR_CLOBH       MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSDKKVIEIIKEFKPKYAVLMEENAFKIVEDFCI
DXR_CLOB1       MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSDKKVIEIIKEFKPKYAVLMEENAFKIVEDFCI
DXR_BREBN       MKKIALLGSTGSVGTSTLEVVGQHPEDFSVVAMAAGTNIDLLTLQVETFKPELVSVGNEKAAVLRDRLAG
DXR_PERMH       MKRLAVLGSTGSIGTQTLDIVRKYRDRLEVSLLAASRVSEKLLDQIDEFKPEYVYIAEGE---------K
DXR_CLOTH       VNRISILGSTGSIGVQTLDVARN--LNIKVDGLAANKNIDLLEKQAREFQPKIVAVKDEERARILRDRLS
DXR_EUBR3       MKKISILGSTGSIGTQTLDVIRE-HGDMQVVALSCGRNLSLIEKQAREFKPQFVSVSDENDAKKLRTSLA
DXR_THEYD       MKKVVILGSTGSIGKNALEVIRKFPDKFKVLGLAAKSSVNILEEQIKEFNPQYVAVFDKKACDELRKKVK
DXR_THETN       MKKLIILGSTGSIGRQTLDVVRSLKEEFEIVGLTGYNNVSLLSKQIKEFRPKVVAVKDEEK---ARKLRE
DXR_PELTS       MKNIVLIGSTGSIGRQTLEVIGSLPDRFKVVGLGSGKNWRLMAEQIRVFRPSAVAMAGEREIMNLKELLA
DXR_HALOH       -KKLVVLGSTGSIGTQTLEVLSHLEDQWEILALSANKSTGLIEKQARKFKPRYLVMMNERAALELKHRLS
DXR_EHRRG       MKTVSIFGSTGAIGQMIIDVILASSDSYQVKALVAKSNVQLLAFQAKVVNAEMVVIADVGLYKELKDLLF
DXR_EHRCR       MKTVSIFGSTGAIGQMIIDIIFADLDKYQVKVLVAKSNVQLLAFQAKLINAERVVIANVDLYQELKDLLV
DXR_THEP1       -RTLVILGATGSIGTQTLDVLKK-VKGIRLIGISFHSNLELAFKIVKEFNVKNVAVTGDVEF-------E
DXR_EHRRW       MKTVSIFGSTGAIGQMIIDVILASSDSYQVKALVAKSNVQLLAFQAKIVNAEMVVIADVGLYKELKDLLF
DXR_ALKOO       MKNISILGSTGSIGTQTLDVVRNHPEKFKIVALSASGNIDAIENQIHEFHPEIVAVFHREKAEILSARI-
DXR_THEMA       -RTLVILGATGSIGTQTLDVLKK-VKGIRLIGISFHSNLELAFKIVKEFNVKNVAITGDVEF-------E
DXR_CHLT3       MKRITILGSTGSIGTNSLEVISRFPEQFCATYLSAGSNVKLLAEQAKRFRPKGVVIMNESLEGELRSLLA
DXR_WOLPP       MKKVSVLGSTGSIGKKTVDLLLKRKEEYQVEXXXXXXXXXXXXXXXXXXXXXXXXISDERFYKDLKEDLL
DXR_VESOH       MKNITLLGATGSIGKSTLSVVDLHPDKFNIFALSANTNWKQMIKLCNKYQPSYAIMVDEQS----AEKLS
DXR_EUBE2       MKNVSILGSTGSIGTQTLDVIRRNA-DINVVALAAGTRVSDLAEQVREFKPQLVCIGKEELVPELKTLIG
DXR_LISMF       MKKIILLGATGSIGTQTLAIIRENPEKFQIVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVILEAEFP
DXR_LISMC       MKKIILLGATGSIGTQTLAIIRENPEKFQIVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVILEAEFP
DXR_THENN       -RTLVILGVTGSIGTQTLDVLRKIE-GIRLVGISFHTNVELAKKIVKEFQVENVVVTGDVSFECSAKVWK
DXR_PORGI       -KNIAILGSTGSIGTQTLDIIHLNPDLFDVYLLTANNNVDLLIRQAREYRPEIVVIANDQKYHLIQEALA
DXR_PORG3       -KNIAILGSTGSIGTQTLDIIHLNPDLFDVYLLTANNNVDLLIRQAREYRPEIVVIANDQKYHLIQEALA
DXR_BACHD       MKGISVLGATGSIGTQTLDVLANHRDKFRLVAMSVGKNLTLAEEQIHQFKPPLVVMTDEDRKTLASKVPE
DXR_LISMO       MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVTLEAEFP
DXR_LISMH       MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVTLEAEFP
DXR_BACSU       MKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLDTYHKLKQMSF
DXR_SHIFL       MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQ
DXR_FRATH       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_FRATF       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_ECOLI       MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQ
DXR_ECO57       MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQ
DXR_LISIN       MKKIILLGATGSIGTQTLTIIRENPEKFQLVAFSFGRNIERGRAIIQEFKPKMVAV--WHTRDRVTLESE
DXR_FRATN       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_CHLMU       MKRLALIGSTGSIGKQVLQVIREIPDAFVIETLAAGRNRESLISQIREFSPRVVAVRDETTYKELRKLFP
DXR_FRATW       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_FRATT       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_FRATM       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_FRAT1       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_DESHD       MKRLTILGSTGSIGTQTLDIVRQNPEQLEVFALAAGKNVQEIELQAREFKPQIIGLMEEKAARELKQRVA
DXR_PHOLL       MKRLTILGSTGSVGKSTLTVVRNNPDKFKVTALAAGKNIQVMAEQCLEFRPQYAAMADEVSAKELRQLLQ
DXR_BACA2       MKNICLLGATGSIGEQTLDVLRMHQDQFRLVSMTFGKNAEKAIPLIRTFQPKYIAVGDMDTYQKVKEASF
DXR_CAMJJ       -----LFGSTGSIGVNALKLAA--LKNIRISALACGDNIALLNEQIARFKPKFVAIKDSKN----KHLVK
DXR_CAMJE       -----LFGSTGSIGVNALKLAA--LKNIPISALACGDNIALLNEQIARFKPKFVSIKDSKN----KHLVK
DXR_CAMJ8       -----LFGSTGSIGVNALKLAA--LKNIPISALACGDNIALLNEQIARFKPKFVAIKDSKN----KHLVK
DXR_CYAP7       MKKISVLGSTGSIGTQTLDIVAQYPDQFQVVGLAAGNNVELLSAQVHQFRPEIVAICNLDHLEVLKESLS
DXR_ZYMMO       -RTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADYND-------LK
DXR_PROMH       -------------------VIENNPDEFQVLALVAGKNATKMAQQCRAFQPKYAVMSDEKSAGELKQLLA
DXR_MICAN       MKKISILGSTGSIGTQTLDIVTDHPDKFQVVGLATGNNIQLLSEQIRQFRPQIVAINNESQLEDLKSLIS
DXR_DESHY       MKRLTILGSTGSIGTQTLDIVRQNPEQLEVFALAAGKNVQEIELQAREFKPRIIGLMEEKAARELKQRVA
DXR_CAMJR       -----LFGSTGSIGVNALKLAA--LKNIPISALACGDNIALLNEQIARFKPKFVAIKDSKN----KHLVK
DXR_FRATO       --KITILGATGSIGDSTLAVIRETN-DFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVT
DXR_LISW6       MKKIILLGATGSIGTQTLAIIRENPEKFQLVALSFGRNMERGRAIIQEFKPKMVAVWHTRDRITLESEFP
DXR_PROM5       MKYITVLGSTGSIGTQTLEIVRELPNKFKVVALSAGRNIDLLTEQVSQHKPEVIAIDDENLLTDLKNNIN
DXR_TREDE       -KRVVVLGAGGSIGKNSLEIIRRFPDRFELAGFSVHSNS----------GFAKTLLAEFTDAQFVSTKKK
DXR_PSYIN       MKKLAILGATGSIGDSTLSVCRSNPELYQITLLAASSSVDKMLALCREFTPLYVSMSSEISXXXXXXXXX
DXR_TOLAT       MQYLTILGSTGSIGRSTLDIVRRHPDRFAVTALTANQGVAQMMSDCLEFHPSYAVMADEASAIALKEALA
DXR_MANSM       MKKLVILGSTGSIGKSTLSVIEHNPEKYHAFALVGGRNVDLMVEQCVKFQPEFAALDDENAAKQLAEKLK
DXR_CARHZ       MKKLVILGSTGSIGRQSLEVIEFFPDKFSVVXXXXXXXXXXXXEQCLRFKVKHAFLADEESYKTYYQEFK
DXR_NAUPA       ---MVVLGSTGSIGVNTLEIAR--RYDIEIEGLVAGNNYEVLNAQIKEFKPKYVVVKD----LKTAEKID
DXR_GEOSF       MKNLTILGSTGSIGVSTLEIVAAHPEKFKIIALTAGENIDLLKEQIDAFAPQLVAVKNEELALKLEGMLS
DXR_CAMJD       -----LFGSTGSIGVNALKLAA--LKNIPISALACGDNIALLNEQIARFKPQFVAIKDSKN----KHLVK
DXR_FERNB       -KTVVILGATGSIGTQSVDVISK-LKNYKLVGISFGKNRNLAEEIVQRFDVKV-----YHG---------
DXR_BACP2       MRYISLLGATGSIGEQTLDVIRQHPDKFKLKAMTFGRNVDKAIPIIEQFQPEFVGCLSEEAYHTLKGHSF
DXR_SHEWM       MQSMVILGATGSIGASTLSVIASNPETYSVYALVANTNVDKMMALCEQYRPKVAHMVDEQAAKLQERLSP
DXR_SALTY       MKQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQ
DXR_SALTI       MKQLTILGSTGSIGCSTLDVVHHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQ
DXR_SALPA       MKQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQ
DXR_SALCH       MKQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQ
DXR_CAMLR       -----VLGSTGSIGVNTLFIAKE--KNISIEALSCGKNIKLLNEQIALFKPKFVCIQDEKD-----KHLV
DXR_AQUAE       -------------------------ENFRDEIILANRASEKLLQQAKKYKPKYVVSYQEPAKEWLESLPE
DXR_MACCJ       MKNIGILGASGSVGTQGLDIIRQYPDTYKLVSFSVGKNLELANKIIEEFRPDICCVQDKEDI----DKIQ
DXR_GEOSW       MKYISILGASGSIGTQTLDIIRSHPDEFQLTAISIGKNVDMARAIIEEFAPRLVAVAEADAY---EKLRS
DXR_ACAM1       MKAITLLGSTGSIGTQTLDIVAQYPDQFRIVGMAAGRNIELLSQQIRQFRPEIVAIADPNQL----SDLK
DXR_ANAVT       MKSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAEKLPALQAAIK
DXR_ALISL       MRKLTVLGATGSIGSSTLSVAKQNSHQFEIVALGAGSNVQKMFELCCEWQPKYAAMADPISALALQRQLK
DXR_ACTP2       MKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMAAQCLLFQPKFAALDDENAAKALEEQLR
DXR_RUTMC       MKNITLLGATGSIGKSTLSVVDLHSDKFNIFTLSANTNWQLMLELCNKYQPNYAIMVDESSAEKLSTII-
DXR_CHLTR       MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAGRNQEALISQIREFNPRVVAVREETTYKELRKLFP
DXR_CHLTA       MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAGRNQEALISQIREFNPRVVAVREETTYKELRKLFP
DXR2_BACHK      MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR_EXISA       MKRISLIGGTGSIGVQTCDVIEQHPDLFELEAYAFGTNVEVATEWINRLRPKYVSATSIE-VLEQLKPRL
DXR_BACLD       MKNICLLGATGSIGEQTLDVIKAHDDKFRLTAMTFGKNAEKAAEIIETFKPKYVGVGDEHTYETLKQHSF
DXR_ANASP       VKSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAEKLPALQAAIK
DXR_CHLTB       MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAGRNQEALISQIREFNPRVVAVREETTYKELRKLFP
DXR_CHLT2       MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAGRNQEALISQIREFNPRVVAVREETTYKELRKLFP
DXR_CHLCV       MKHLAILGSTGSIGQQTLKIIRSLPHLFKVVALASYGNNKDVFEQIREFSPSIVSVYDEQSYFEISKEFP
DXR_YERPY       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERPP       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERPN       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERPG       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERPE       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERPA       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERP3       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_VIBFM       MRKLTILGATGSIGSSTLSVAQQNSDQFEIVALGAGTNVDKMLELCLEWKPKYVAMATQPAADALKELLS
DXR_PELPD       MKQLSILGSTGSIGVSTLEIVAAHPDRFRVSALTAGKNLELLARQIRQFSPRIAAVAAKEDVPRLAQLCD
DXR_CYAP8       MKKITILGSTGSIGTQTLDIVQQYPDQFQVVGLATRNNGELLAQQIKQFRIKDAIASDYSPILLTGEA--
DXR_ACTPJ       MKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMAAQCLLFQPKFAALDDENAAKALEEQLR
DXR_YERPS       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_YERPB       MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLQ
DXR_CYAA5       MKKISLLGSTGSIGTQTLDIVNQYPDQFQVVGLATRSNVELLATQVQQFRPEIVAICDESKLGSLKDAIA
DXR2_BACCR      MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQSVSG
DXR_MENPI       -KPISVIGSTGSIGTQTLDIVAENPDKFRIVALAAGSNVTLLADQVKAFKPKLVSVKDES-------LIS
DXR_BACC7       MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR_BACC3       MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR_BACC1       MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR2_BACCZ      MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR2_BACAN      MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR_SHEFN       MQNMVILGATGSIGASTLSVMVNNPADFHVYGLVANASVQKMLALCITHQPEYAHMVDENAAMELKSLLP
DXR_NOSP7       MKAITLVGSTGSIGTQTLDIVTQYPDQFRIVGLAAGNNVEMLAAQIRQFRPKIAAICSEDKL----PALK
DXR_VIBF1       MRKLTILGATGSIGSSTLSVAKQNSDQFEVVALGAGTNVDKMLELCLEWKPKYVAMATQPAADELKELLS
DXR_MYCPE       -KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRF---------------PNALVF
DXR_HAEPS       MQKLVILGSTGSIGKSTLSVVDNNPEQYQVFALVGGKNVELITEQCQQYQPRFVALDDEQA---AAKLKE
DXR_BACCQ       MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSAGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSG
DXR_PROMP       -----MLGSTGSIGTQTLEIVSELPDKFKVVALSAGRNIDLLTEQVSQHKPEVIAIEDENLLTDLKNNIN
DXR_PROM9       MKYITVLGSTGSIGTQTLEIASEQPDKFKAVALSAGRNITLLTEQVKTHKPEVVAIEDXXXXXXXXXXXX
DXR_DESRM       MKQISILGSTGSIGRQTLEVVNSFPEELNVVALAAGRNRELFLEQCKAYKPLLVLQLEEDALWLKEHLIK
DXR_NITWN       VRTVTVLGATGSIGDSTMDLLRGARGRYRVEALTANSNVEGLVKLAREFDARFVALADTSYFDELKNALA
DXR_HAEI8       -QNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGGKNVEAMFEQCIKFRPHFAALDDVNAAKILREKLH
DXR_GEOUR       MKKLAILGSTGSIGVSTLDIVAAHPDKFQVVALTAGGNLDLLKKQIEEFSPQLVAVLNEELAQKLQQMLS
DXR_MOOTA       -KEITVLGSTGSIGRQTLEVVAAHPGRFRVAALVAARNDELLAAQVRRFRPRLAVLLDEERARVLAEMVS
DXR_LEPIN       ---VCLLGASGSVGESTLKVLRAHPEKFRLHSFSVHSNLEKAKEIQKEFSPDFICVS---SDFADVGVLG
DXR_LEPIC       ---VCLLGASGSVGESTLKVLRAYPEKFRLHSFSVHSNLEKAKEIQKEFSPDFICVS---SDFADVGVLG
DXR_ERWCT       MKQLTILGSTGSIGVSSLAVIKANPDKFTVRALSAGYNVKLMLEQCLTFQPTYASMADEASATALRQQLA
DXR_ANAMM       -KRVSVFGSTGCIGQKAVQILRDNPDDFEVVALVAKQDAHLLASQARLLSANMAVVAEDAAYETLRELLR
DXR_ANAMF       -KRVSVFGSTGCIGQKAVQILRDNPDDFEVVALVAKQDAHLLASQARLLSANMAVVAEDAAYETLRELLR
DXR_ORYSJ       -KPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPKLVAVRNESLVDELKEALA
DXR_HELMI       IKRIAILGSTGSIGRQTLEVVDRSEGRLTVQALAAGSNWKELLAQIEIYRXXXXXXXXXXXXXXXXXXXX
DXR_HAEIE       -QNIVILGSTGSIGKSTLSVIENNPEKYHAFALVGGKNVETMFEQCIKFRPHFAALDDVNAAKILREKLH
DXR_SHESH       MQRMVILGATGSIGSSTLSVIESNPDAYSVYALVANTSVEKMLALCETHRPQIAHMVDGQAAKLKQRLPT
DXR_BLOPB       MQSLTILGSTGSIGKATLSVIQQHTDKFFVHALVAKNNVAIMTEQCIAMSPKYACMISEDAARILKKNLI
DXR_AGRVS       -RRLTILGSTGSIGTNTLDVIRQGRDRFDIMALTGHGNVALLAEQALVTGARLAVTSDENQYIALKDLLS
DXR_VIBCM       MRKLTILGATGSIGASTLKVIAQNPQQFSIVALVAGVNVAKMYQLCQQWRPKYAVMATASAASELQGLLK
DXR_VIBCH       MRKLTILGATGSIGASTLKVIAQNPQQFSIVALVAGVNVAKMYQLCQQWRPKYAVMATASAASELQGLLK
DXR_VIBC3       MRKLTILGATGSIGASTLKVIAQNPQQFSIVALVAGVNVAKMYQLCQQWRPKYAVMATASAASELQGLLK
DXR_HAEIN       -QNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGGKNVEAMFEQCIKFRPHFAALDDVNAAKILREKLH
DXR_HAEDU       MKNIVILGATGSIGQSTLSVIEHNPDQYQVFALVGGKNVELMATQCSQFKPKFAALVDXXXXXXXXXXXX
DXR_NITHX       VRTVTVLGATGSIGDSTMDLLRGAPGRYRVEALTANSNVEALVKLXXXXXXXXXXXXDPARFGELKDALA
DXR_LYSSC       MKKISLLGATGSIGWQTYDILKEQREAFQLVAFSSGKNMEKTREMIDNLKPELVSVQLEEDALLLAK---
DXR_CLOCE       ----------------------------KVAALSANSNIDLLEKQVHEFKPDVVSVGNSELAKEMSNRLQ
DXR_CHLCH       -------------------VVRQHRDRFTIVGLAEGHDVAALAAQIEEFKPLAVSVRDAESAKKLQELLG
DXR_ARATH       -KPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVRRF--KPALVAVRNESLINE--LK
DXR_HAEIG       -QNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGGKNVETMFEQCIKFRPHFAALDDVNAAKILREKLH
DXR_CHLFF       MKHLSIFGSTGSIGQQTLKIVRSLPHLFNVVALASYGNNKDLIEQIREFSPSIVSVYDEQLYFEIRK--E
DXR_YERE8       MKQLTILGSTGSIGNSTLGVVRANPELFKITALVAGRNVHQMAQQCLEFAPRYAAMSDETSAKALRLILN
DXR_RHOPT       VRTVSVLGATGSIGDSTMDLIRAEPERYRVEALTGNANVAGLAKLAKEFNARFVAVADPXXXXXXXXXXX
DXR_GLOVI       MKHIALLGSTGSIGTQTLDIVAEYPERFAVTGMTAHSNMELLAEQIRRFRPQVVAVG--------SEXXX
DXR_ACIBS       -QSVCILGVTGSIGQSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIAELKTLFAQ
DXR_HELHP       -----LLGSTGSIGTNALEVAS--HFDIPIESLCAGKNITLLNQQIAHYAPKNVCIADKND----AHKLI
DXR_CHLAB       MKHLAIFGSTGSVGQQALAIIRSLPHLFNVVALASYGNKRDLFEQIREFSPSIVSVYDEQLYFEIRK--E
DXR_BRAJA       VRSVTVLGATGSIGDSTMDLLRASPERYRVEALTANGNVEALAKLAKEFSARFVAIADTSKFAELKAALA
DXR_PROVI       -------------------VVRRHKESFSVVGLAEGHDVHALAEQIKEFRPTIVSVRDENAADELKTLLG
DXR_ACIBC       -QSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIVELKTLFAQ
DXR_ACIBT       -QSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIAELKTLFAQ
DXR1_BACCZ      -----------------LDVVSAHPEHFKIVGLTANYNIELLEQQIKMFQPRIVSVAT-KDLADTLRMHI
DXR_GEOBB       MKNLTILGSTGSIGVSTLDVVKAYPDMFRVVALTAGNNLELLKTQIETFSPDLVSVLTAEKAQALSRSLT
DXR_ACIAD       -QSVCILGVTGSIGQSTLKVLAQHPDKYSIYAITAHSRIQELVEICKQFKPKRVVVPDIDXXXXXXXXAG
DXR_WOLSU       -----LLGSTGSIGQNALSLARDFR--LPVEVLVAGHNLSLLNAQIAEFQPKIIVIAD-SSRASELSLPK
DXR_PARUW       MKHIAILGSTGSIGKNTLQVARHLKERIKVVAIAARENIDLLEAQSKEFCPDIIAVFNNAKAYELQKRLP
DXR_ACIBY       -QSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIAELKTLFAQ
DXR_ACIB5       -QSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIAELKTLFAQ
DXR_ACIB3       -QSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIAELKTLFAQ
DXR_RHOPA       VRTVSVLGATGSIGDSTMDLIRAEPERYQVEALTGNANVAGLAKLAKEFSARFVAVADPXXXXXXXXXXX
DXR_NITMU       VRHLTILGSTGSIGVSTLDVVARHPDRFRVVALTANKSVQKILEQCRRFEPRYAVLLDEASAELLQVEIR
DXR_DESPS       MKKISLLGATGSIGTSVLEVVRKFSDQYRIVAMAAGRNIDLFARQIEEFSPDLVSVLDEEYAHCLQERLG
DXR_BRASO       VRSITVLGATGSIGDSTMDLLRGAPERYRVEALTGNSNIEGLAKLAREFNSRFVAVADPARLGELREAL-
DXR_RHOPS       VRTISVLGATGSIGDSTMDLLRAAPEKYRVESLTGNANVAGLAKLAKEFSAKFVAVADPARLGELRAALA
DXR_RHOP2       VRSISVLGATGSIGDSTMDLLRAAPEKYRVEALTGNANVAGLAKLAKEFNARFVAVADPXXXXXXXXXXX
DXR1_BACAN      -----------------LDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVA--------TKELA
DXR_GEOSM       MKNLTILGSTGSIGVSTLDVVAAYPDMFRVVALTAGNNLELLKTQIETFRPELVSVLTAEKAQALSRSLT
DXR1_BACHK      -----------------LDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVA--------TKELA
DXR_LAWIP       -RTISILGSTGSIGTNALDVIKSHKELFHIVALGGGKNVQLLAKQAIQWKPDYLAVQDETSKEALIPLLP
DXR_CAMHC       ---MVVLGSTGSIGTNSLEIAR--KFNIEVEALACAENVKKLNAQIAEFHPKFVYIKDEK---LKSKVAH
DXR_RHIEC       -RRLSIFGSTGSIGRNTLNVIEHGRENFEISVLTGNGNVELLARQARSSGARLAVTASDRHYESLKRELS
DXR_GLUOX       -RRITVLGSTGSIGTSTVDLLARIPDEIEVRALVGGCNAALLAEQARRLNAEVAVIHDESRHEELKTCLA
DXR_COLP3       -RQLCILGSTGSIGCSTLDVVRLHPERFQVISLAAYTSVDVIFEQCIEFKPQQVVLVSSEHAALLTQKLN
DXR_PROA2       -------------------VVRQHPDRFTITGLAEGHDVTLLAEQIREFKPSIVSVRDEASANQLRELIG
DXR_NEIMA       ---LTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFHPEYAVVADAEHAARLEALLK
DXR_GEOMG       MKKLTILGSTGSIGTSTLEIVAAHPDRFQVIALTAGSNLELLKQQVEVFRPRLVSVLTADLARQLDRMLS
DXR_ERWT9       MKQLTILGSTGSIGTSTLAVVRANPQLFAVKALVAGRNVELMTGQCLEFRPAYAAMSDKRAAEELRLRLK
DXR_DESAP       -KRIAVLGSTGSIGRQALDVVRSHPEKFKVVGLAAGRNWELLAEQAAEF-APGVVSVWSGDDAEXXXXXX
DXR1_BACCR      -----------------LDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVVATKDLADKLRTRI--
DXR_THEEB       VKALNLLGSTGSIGTQTLDIVAQYPDRFRVVGLAAGRNLERLIPQIRQFQPEIVSIXXXXXXXXXXXXXX
DXR_SHEPW       MQSLVILGATGSIGASTLNVVKCNHEQYRVFALVANTNVAKMLERPLVAHMVNAQAATELKRLLPSELA-
DXR_SHEPA       MQNMVILGATGSIGASTLNVVACNPEQYKVFALVANTNVAKMLEICIAHQPKIAHMVDXXXXXXXXXXXS
DXR_PROMA       -----MLGSTGSIGTQTLEIAKECPEQFKVVALTAGRNLDLLIKQIQEHQPEVVILPELQERLLTGKERP
DXR_NEIG1       ---LTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFRPEYAVVADAEHAARLEALLK
DXR_GEOSL       MKNITILGSTGSIGVSTLEVVSAHPDRFRVVALTAGNNLEMLRQQIETFRPQMVSVLSEKLAVELDRSLP
DXR_PECCP       MKQLTILGSTGSIGVSSLAVIKANPDKFAVRALSAGYNVKLMLEQCLTFQPAYASMADEVSATALRQQLA
DXR_NITEC       IRHLTILGSTGSIGESTLDVVARHPDRFQAVALTADKNVEKMFEQCKRFYPSYAVMLNAQSAEQLEAKLR
DXR_NEIMB       ---LTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFHPEYAVVADAEHAARLEALLK
DXR_SYNSC       MKAISVLGSTGSIGTQTLQIAEEFPEQFRVVALTAGRNLKLLVEQVQRHRPEVVALADSDLLPELQERLK
DXR_CHLPD       -------------------VVRQHPEQFTITGLAEGHDVGMLVKQIREFNPRLVSVRNADAAAELASLLG
DXR_THELT       -RTIVILGITGSIGIQTVEVIQS-LGNFHILGGTYHKNKDLADAISQKHNLSNLISTSRGYDLA------
DXR_EXIS2       ----------------------------------------------------------------------
DXR_BUCAI       MKKXXXXXXXXXXXXNALSIIQKNPDLFKVIALVANKNFSIMLRQCELFSPDWVAMRDEKSAHILRKKLK
DXR_BRASB       VRSITVLGATGSIGESTMDLLRGAPERYRVEALTGNSNVQGLAKLAREFKPGFVAVADPARLNELRDAL-
DXR_NITEU       -RHLTILGSTGSIGESTLDVVARHPGRYQVVALTADRNVEKMFEQCIQFHPPYAVMLDAQSAEQLEDRLH
DXR_CHLPB       -------------------VVRQHPEKFNVTGLAEGHDINLLAEQIKEFRPDIVSVRDKASAGLLREQLG
DXR_CAMFF       -----LLGSSGSIGKNVAFLAM--KYGIKLDALACKTDYKELNSQISKFNPKFVYIEDNK--------LK
DXR_BACSK       MKQISLLGSTGSIGTQTLDVIRDYPDQFTLSALACGTNLELCRNQIKEFQPK----------LVSVQRPE
DXR_RHIE6       -RRLSIFGSTGSIGRNTLNVVEHGRDNFEISVLTGNGNVELLARQAKASGARLAVTASDRHYDSLKSALS
DXR_VIBVY       MQKLTILGATGSIGASTLKVIEQNPDKFSVVALAADSNVEKMQQLCQRWQPEFAVMANKEAALRLKMALA
DXR_OLICO       ---VTILGATGSIGQSTADLVRRGRGRYRVEALTAHSNVAELAKLARELGARFAAVAKEECYAELKAALA
DXR_GEOKA       MKYISILGASGSIGTQTLDVIRAHPDEFRLAAASVGKNIEAARRLIAEFSPSLVAVADRDAYKVLYREYR
DXR_BUCAT       MKKXXXXXXXXXXXXNALSIIQKNPDLFKVIALVANKNFSIMLRQCELFSPDWVAMRDEKSAHILRKKLK
DXR_BUCA5       MKKXXXXXXXXXXXXNALSIIQKNPDLFKVIALVANKNFSIMLRQCELFSPDWVAMRDEKSAHILRKKLK
DXR_VIBHB       MQKLTILGATGSIGASTLKVVEQNPELFSIVALAASTNVEKMVALCRKWQPKXXXXXXXXXXXXXXXXXX
DXR_SINMW       -RRLTILGSTGSIGTSTLDVIEGGRDRFEVAALTGNGNIPLLAAQARRMGAELAVTADGDRYGELKDALS
DXR_VIBVU       MQKLTILGATGSIGASTLKVIEQNPDKFSVVALAADSNVEKMQQLCQRWQPEYAVMANKEAALRLKMALA
DXR_SHELP       MQKMVILGATGSIGASTLSVIEQNPEAYKAFALVAHKSVDKMLDLCIKYNPSIAHMVDPQAAALQRRLPA
DXR_CHLTE       -------------------VVRRHPERFSIAALAEGHDVEMLLKQIDEFRPSLVSVRDEASRERLKGMLG
DXR_THERP       ---VSLLGSTGSIGRQTLEVVAAHPDRFRVVALAARSQIDALQEQVRIFRPELVAIAQESLGI------S
DXR_SYNP6       MKAVTLLGSTGSIGTQTLDILEQYPDRFRLVGLAAGRNVALLSEQIRRHRPEIVAIQDLSELQAAIADLD
DXR_SYNE7       MKAVTLLGSTGSIGTQTLDILEQYPDRFRLVGLAAGRNVALLSEQIRRHRPEIVAIQDLSELQAAIADLD
DXR_ELUMP       MKNIVVLGSTGSIGVSSLDVIDKLGAGYGVLALSANTNADLLIKQMLKFKPRFVAVLNEDSYQKVKPYVP
DXR_VIBPA       MQKLTILGATGSIGASTLKVVEQNPELFSVVALAAGTNVEKMVALCRQWQPKFXXXXXXXXXXXLQSEIH
DXR_PSYA2       -QRIAVLGATGSIGDSTLAILAAQPQYYDVYALSGYHRLDKLLALCQQFAPKRVAVDDFAKRLSAAGL--
DXR_LEPBL       -----------------LRVLRAYPQEFRLHSFSVHSNLEKAREIQKEFSPEFLCVSDSTADR-TVLGNK
DXR_LEPBJ       -----------------LRVLRAYPQEFRLHSFSVHSNLEKAREIQKEFSPEFLCVSDSTADR-TVLGNK
DXR_BAUCH       ---------------------KQNPDKFTVRALVAKNNFTLMTKQCLDFRPSWVGMVDKRA---ARELKA
DXR_RHOS5       MRSLSIFGATGSIGESTFDLVKGGPEAFRTVALTGGRNVARLAEMARALKAELAVTAHEECLPALREALA
DXR_PSYCK       -QRIAVLGATGSIGDSTLAILAAQPQHYDVYALSGYHRLDKLLALCQQFAPKRVGVPTAAVDEFAKRLSE
DXR_PROM1       MKAISVLGSTGSIGTQTLQIAEEFPDQFKIVALTAGKNLDLVTKQIETHQPEVVSLADINSLNEDSKILK
DXR_PELLD       -------------------VVRQHPDRFKIVGLAEGHDVNMLAEQIREFNPSIVSVRDAGSAELLKTLLG
DXR_HELPH       ---MVVLGSTGSIGKNALKIAK--KFGVEIEALSCGKNIALINEQIKVFKPKKVAILDPSDL----NNLE
DXR_AGRT5       -RKLTILGSTGSIGTNTLDVVRQGRDGFEIMALTGAGNIALLAEQAREFGAQLAVTADDDKYEALKSALA
DXR_RHIME       -RRLTILGSTGSIGTSTLDVIEGGRDRFEIAALTGNGNIPLLAEQARRIGAELAVTADEDRYGELKDALS
DXR_EDWI9       MKTLTILGSTGSIGTSTLAVVRANPGAFRVVALVAGKNVDVMLQQCREFSPRYVCMANEGAAAALRQRLF
DXR_GEOLS       MKQIAILGSTGSIGVSTLEIVAAHPDKFRVLSLSGAKNLDLLARQIRQFRPRLAAVAD-PADIPRLKXXX
DXR_CHLPN       MKHLAVLGSTGSIGRQTLEIVRRYPSEFKISMASYGNNLRLFFQQLEEFAPLAAAV--YNEEVYNEACQR
DXR_CAMC5       ---MVILGSTGSIGTNTLEICS--RHGVSVEALSCAKNIALLNEQIARFRPKFVCVAD-ESLASEVKILK
DXR_SERP5       MKQLTILGSTGSVGTSTLAVVRENPDRFAIKALVAGRNVAVMAQQCIEFRPAYAAMADEGAARELRILLA
DXR_RHOS4       MRSLSIFGATGSIGESTFDLVKGGPEAFRTVALTGGRNIRRLAEMARALKAELAVTAHEDCLPALREALA
DXR_RHOSK       MRSLSIFGATGSIGESTFDLVKGGPEAFRTVALTGGRNIRRLAEMARALKAELAVTAHEDCLPALREALA
DXR_RHOS1       MRSLSIFGATGSIGESTFDLVKGGPEAFRTVALTGGRNIRRLAEMARALKAELAVTAHEDCLPALREALA
DXR_AGRRK       -RRLTILGSTGSIGQNTLDVIAQGRDAFEIAAITGHDNIDLLASQAKACGAALAVTANEDRY----QALK
DXR_SHESA       MQNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCVTHRPQVAHMVDXXXXXXXXKLPP
DXR_PSEU5       --QITILGATGSIGLSTLDVVARHPDRYDVFALTGFSRLAELRALCLKHRPRYAVVSDQAQARILQDQLH
DXR_NITOC       ---VSILGSTGSIGMSTLDVLARYPERYRVQALSANRSVAQIYQQCLQFRPSQVVMVDPDAAEQLRQRLH
DXR_SHEHH       MQNMVILGATGSIGASTLSVVACNPEQYKVYALVANTNVAKMLEICIAHQPKIAHMVDAQAAQLKQQLPS
DXR_SACD2       MQQICVLGSTGSIGISTLDVLASHPDKFSVYALTANSSIDLLVEQCLKFSPQYAVIRDEALYLPLKQRIE
DXR_RHOPB       VRSVSVLGATGSIGDSTMDLLRASPERYQVEALTANTNVAGLAKLAREFNARFVAVADPARLSELRAALA
DXR_RHIL3       -RRLSIFGSTGSIGQNTLNVVDHGRENFEISVLTGSGNVELLARQAKSSGARLAVTANDRHYESLKSELS
DXR_SHEON       MQNMVILGATGSIGASTLSVISANPTAYRVYALVANASVDKMLTLCLAHRPQVAHMVDHKXXXXXXXXXX
DXR_PSE14       ---ITILGATGSIGLSTLDVVARHPSRYQVFALTGFSRLDELLALCVRHTPQYAVVPDQ---FVARKLQD
DXR_PHOPR       MRKLTILGATGSIGSSTLAVAAQNPQLFEVVALAAGTNSQKMLELCRIWKPKYAAMASLQAAKELSVLLE
DXR_WIGBR       MKKITILGSTGSIGKNTLKIISNNLDKFSVSLVAYGNNINVLISQCIKYKPNYVCIMNXXXXXXXXXXXX
DXR_SHESR       MQNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCVTHRPQVAHMVDXXXXXXXXKLPP
DXR_SHEB2       MQNMVILGATGSIGASTLSVISANPLAYSVYGLVANASVDKMLALCVAHKPKVAMVDEAAAKQLRAVLPA
DXR_CHLL2       ----------------------------------------------------------------------
DXR_SOLUE       MKTIAVLGSTGSIGTNTLDVVRRNRHLYEVYSLVAGQNIELLTGQILEFRPKXXXXXXXXXXXXXXXXXQ
DXR_SHESM       MQNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCITHRPQVAHMVDXXXXXXXXKLPP
DXR_SHEB5       MQNMVILGATGSIGASTLSVISANPFAYSVYGLVANASVDKMLALCVAHKPKVAMVDEAAAKQLRAVLPA
DXR_UNCTG       MKRITILGSSGSIGKQTLNIISKMKENVCIEGLAVGSNIKILKSQIKKFKPASVSVNSPAEAQNLKKISN
DXR_SHEB9       MQNMVILGATGSIGASTLSVISANPFAYSVYGLVANASVDKMLALCVAHKPKVAMVDEAAAKQLRAVLPA
DXR_RHISN       -RRLTILGSTGSIGTNTLDVVEGGRNRFEIAALTGNGNIPLLADQARRMGAELAVTADEHRYGELKDALG
DXR_PROMT       MKAISVLGSTGSIGTQTLQIAEEFPEQFKIVALTAGKNLDLVIKQIETHQPEVVXXXXXXXXXXNKKIVK
DXR_IDILO       MRRITVLGATGSIGQNTLNVVSRHPDDFQVFALTAHSQISAMAELCVKHNPQYAVMGSYNAAAELKALLQ
DXR_RALSO       MMRITVLGATGSIGDSTLDVVRRHPDRYRVFALTANTQVDKLAALCRVFRPAMAVVGSATAAEVLRDQLG
DXR_ARTS2       -RRIVLLGSTGSIGTQAIDVVDGAPHLFEVVALSAGGGNLELLARQAVHTKAKAVGTASGDATALQRLID
DXR_RALEH       MHRITILGATGSIGESTLDVVRRHADRYVVHALTAHRQVRKLADQCVEFRPARAVVGXXXXXXXXXXXXR
DXR_PASMU       ----------------------------------------------------------------------
DXR_CELJU       -ESITVLGATGSIGVSTLDVISRHPERYQVYALTAERRWQLLATQCLEHQPRYAVIRDADSALLEQELRK
DXR_PSEF5       VQQITVLGATGSIGLSTLDVIARHPDRYQVFALTGFTRLAELLALCVKHEPRFAVVPEAAAASRLQQDLR
DXR_HELPS       ---MVVLGSTGSIGKNALKIAK----KFKIEALSCGKNIALINEQIKVFKPKKVAILDSNDL----NGLE
DXR_SYNS9       MKAISVLGSTGSIGTQTLQIVDDFPDQFRVVALTAGRNLALLVEQIQRHQPELVALAD-EALLPELKQRL
DXR_SYNJB       MQAITLLGSTGSIGTQTLDLVAQYPERFQVVGLTSYSNVALLAEQVRRFRPQMVAIGXXXXXXXXXXXXT
DXR_STRAW       -----ILGSTGSIGTQAIDLVLRNPDRFRVTLSAAGGRVGLLAEQAHRLRVSTVAVARED----VVPVLR
DXR_RHOP5       VRQVTVLGATGSIGDSTMDLLRATPERYQVEALTANSNVAGLAKLAIEFNARFAAVADAS--LLGDLRAA
DXR_RALEJ       MHRITILGATGSIGESTLDVVRRHADRYAVHALTAHRQVQKLAASCIEFRPARAVVGTSXXXXXXXXXXR
DXR_DECAR       LQNITVLGATGSIGVSTLDVIRRHPDRYRAFALCAHSQVDKLFEQCVEFRPRFAVLRDASLAATLSERCR
DXR_PSEU2       -QQISILGATGSIGLSTLDVVARHPALYQVFALTGFSRLDELLALCIRHTPQYAVVPDQ---VVARKLQD
DXR_LEIXX       VRRVVILGSTGSIGMQALEVVAANPDRFQVVGLTAGSSAGQLAEQAERFGVRETALGAGDS----ERLVR
DXR_SYNS3       MKAISVLGSTGSIGTQTLAIVEDFPDQFRVVALSAGRNLSLLVSQIQRHRPDVVXXXXXXXXXXXKDRLM
DXR_PROMM       -----MLGSTGSIGTQTLEIAEEFPERFRVVALTAGTNVSLVVEQIQRHHPEVVALADA-SLLPELKQQL
DXR_LEPBP       ---------------------------FDLRSFSVHSNWNVAKALVEEFSPEVICITDFGDSYLSTKILY
DXR_LEPBA       ---------------------------FDLRSFSVHSNWNVAKALVEEFSPEVICITDFGDSYLSTKILY
DXR_HELPY       ---MVVLGSTGSIGKNALKIAK--KFGIEIEALSCGKNIALINEQIQVFKPKKVAILDPSDL----NDLE
DXR_SYNPX       -----MLGSTGSIGTQTLQIAEEFPEQFRVVALTAGQNLDLLVQQIQRHQPELVALANADLLPELQQRLD
DXR_STRCO       -KDVVVLGSTGSIGTQAIDLVLRNPDRFRVTALSANGGRVALLEQAYRLKARTVAVARED----VVPALR
DXR_PSEMY       VQQITVLGATGSIGLSTLDVIARHPERYAVFALSGFSRLAELETLCVQHRPRYVVVPDAAAAHALQGSLR
DXR_HELPJ       ---MVVLGSTGSIGKNALKIAK--KFGVKIEALSCGKNIALINEQIKVFKPKKVAIXXXXXXXXXXXX--
DXR_BURCM       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDANTAAHVEAKLR
DXR_BURA4       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDANTAAHVEAKLR
DXR_ANAD2       MKRVAILGSTGSIGVQALDVVGRFPDRFEVVGLAAGRNAPRLLEQIRRFRPRVVSVCDXXXXXXXXXXXP
DXR_SYNJA       MQAITLLGSTGSIGTQTLDLVAQYPERFRVVGLTSYSNVTLLAEQVWRFRPQIVAIGXXXXXXXXXXXXT
DXR_PSEFS       LQQVTVLGATGSVGLSSLDVIARHPDRYQVFALTGFTRMSELLALCVRHAPRFAVVPEAAAARTLQDDLR
DXR_DESOH       MKRLTLLGSTGSIGVNTLKVVSRFCDRFSVEALCARGSVDTLAEQVQRFSPSLAVVIDATAQALKERLPA
DXR_BURVG       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVEAKLR
DXR_ANASK       MKRVAILGSTGSIGVQALDVVGRFPDRFEVVGLAAGRNAPRLLEQIRRFRPRVVSVCDXXXXXXXXXXXP
DXR_SYNY3       VKRISILGSTGSIGTQTLDIVTHHPDAFXXXXXXXXXXXXXXXXXVAEFRPEIVAIRQAEKL----EDLK
DXR_RALPJ       MMRLTVLGATGSIGDSTLDVVRRHPDKYSVFALTANAQADKLAVLCREFRPKMAVLGSXXXXXXLRDQLE
DXR_BIFLO       ---VIILGSTGSIGTQGLDVISRHPERFTVTGLAAGGAHIELLQQAAQFHVSEVAVFDETKVXXXXXXXX
DXR_PSEAB       -QRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVPEXXXXXXXXXXXX
DXR_RHOCS       IRSVTVLGSTGSVGSNTVELIEAYPERYRTXXXXXXXXXXXXXGQARRLRPEVAVVADEAHYADLKDXXX
DXR_BUCAP       ---------------------KNNPSLFKVIVLVANKNSSMMLEQCEYFSPDWAIMKNKKSXXXXXXXXX
DXR_PSEA7       -QRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVPEXXXXXXXXXXXX
DXR_BURP8       -KRLTLLGSTGSIGDSTLDVVARHPDRFFVYALTAHRNGDKLVEQCLRFQPEXXXXXXXXXXXXXXXXXX
DXR_PSEAE       -QRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVPEXXXXXXXXXXXX
DXR_PSEA8       -QRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVPEXXXXXXXXXXXX
DXR_CYAP4       MKAITLLGSTGSIGTQTLDIVAQYPDQFRIVGLAAGRSLDKLIPQIRQFRPQIVALADEQQXILVAGPAG
DXR_BIFLD       ---VIILGSTGSIGTQGLDVISRHPERFTVTGLAAGGAHIELLQQAAQFHVSEAAVFDETKVXXXXXXXX
DXR_TROW8       MQRVIIVGSTGSIGTQAIDFILKNRDSFLVVGLAASTQTSLLREQAQVFGTKNTAQGASEA----AELIE
DXR_THET2       MKRVVVLGSTGSIGQQALEVCR--LRGYEVVGLAAGKNLEALSRQIALWKPRLVAAEE--------SLHK
DXR_BIFLI       ---VIILGSTGSIGTQGLDVIARHPERFTVTGLAAGGAHIELLQQAAQFHVSEVAVFDETKIXXXXXXXX
DXR_ACIF5       ---ICILGATGSIGKSTLDVVSRHPDQFRIVALTGNHRVAEMQLLCQQHHPELVVMAAPEAAQQLRVGLG
DXR_ACIF2       ---ICILGATGSIGKSTLDVVSRHPDQFRIVALTGNHRVAEMQLLCQQHHPELVVMAAPEAAQQLRVGLG
DXR_THET8       MKRVVVLGSTGSIGQQALEVCR--LRGYEVVGLAAGKNLEALSRQIALWKPRLVAAEE--------SLHK
DXR_PSESM       ---ITILGATGSIGLSTLDVVARHPTLYQVFALTGFSRLDELLALCIKHTPQYAVVPEQVAARKLQDDLA
DXR_METFK       LQNVTILGATGTIGLNTLDVISRHPGRYRVFALTANSRVDELAELCLQHRPRYAVMLDSGAAEKLQQKLK
DXR_CUPTR       MHRITILGATGSIGESTLDVIRRHPGRYAAHALSAHRQVRKLADQCIEFRPARAVVGTAEAARELETLLR
DXR_SYMTH       -KGIAILGSTGSIGTQALDVIDHHPGRFRVVALAAGRQVERLAEQALRFRPXXXXXXXXXXXXXXXXXXX
DXR_HELP2       ---MVVLGSTGSIGKNALKIAK--KFGVEIEALSCGKNIALINEQIKVFKPKKVAIXXXXXXXXXXXX--
DXR_SHEAM       MQNLVILGATGSIGKSTLDVIKRNPERYRAFALVAATSVERMRDLCIEHRPRYAHMVDESAAKLADALPT
DXR_SODGM       MRHLTILGSTGSIGNSTLAVVKHNPDQYTVRALVAGNNVALMTEQCLAFRPAYACMADDXXXXXXXXXXX
DXR_ARTCA       ----------------------------------------------------------------------
DXR_TROWT       MQRVIIVGSTGSIGTQAIDFILKNRDSFLVVGLAASTQTSLLREQAQVLGTKNTAQGASEA----AELIE
DXR_BURPP       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFQPEVAVVGDADTAASVAAKLR
DXR_HELPG       ---MVVLGSTGSIGKNALKIAK--KFGVEIEALSCGKNIALINEQIQVFKPKKVAVXXXXXXXXXXXX--
DXR_BURCJ       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLR
DXR_BURCH       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLR
DXR_BURCC       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLR
DXR_BURCA       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLR
DXR_AERS4       MHNLVILGASGSIGQSTLKVLRRNPGRWQVLALTAARSVDAMVRDCLEFSPRFAVMVDEAAATALAGQLK
DXR_DESVV       -RTLALLGSTGSIGTSALRVVEAHPHRFRVVALAGARNVEKLAAQAARWRPEHLGVLDAAGAAKLRDLLP
DXR_DESVH       -RTLALLGSTGSIGTSALRVVEAHPHRFKVVALAGARNVEKLAAQAARWRPEHLGVLDATGAAKLRDLLP
DXR_BURS3       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLR
DXR_BURPS       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURP6       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURP1       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURP0       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_AERHH       MHNLVILGASGSIGQSTLKVLRHNPGRWQVLALTAARSVEAMLRDCLEFSPRFAVMVDEAAASELAAQLK
DXR_XYLFM       IRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCHTYRPDHAVIGDATLYTTLRDGLN
DXR_BURMS       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURMA       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURM9       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURM7       -KRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_XYLFT       IRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCRTYRPDHAVIGDATLYTTLRDGLN
DXR_XYLF2       IRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCRTYRPDHAVIGDATLYTTLRDGLN
DXR_JANSC       -RRVSIFGATGSIGQNTIDLIARAPEAYDVVALTGARNIAQLAADARRLSASIAVTAEEE--LLPDLRXX
DXR_BURTA       -KRLTLLGSTGSIGDSTLDVVTRHPERFAVHALTAHRNGDKLVAQCLRFAPDVAVVGDAETAARVEAQLR
DXR_BURM1       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVEARLR
DXR_DESDG       -RSLVLLGSTGSIGTSALRVVERQPELFRITALAGARNVRLLARQAAAYRPPHLAVINGNAADELASLLP
DXR_XYLFA       IRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCHTYRPDHAVIGDATLYTTLRDGLN
DXR_BURXL       -KRLTLLGSTGSIGDSTLDVVARHPERFSVYALSAHRNGDKLVEQCLRFEPEVAVVGDADTAARVAAKLR
DXR_LARHH       MQRITVLGATGTIGVNTLDVIARHPERFSVFALTGHRQVDRLAGQCRQFRPQXXXXXXXXXXGELARQLS
DXR_SILST       MKKISIFGATGSIGQSTIDLIRRAPDAYDVVALSGGHNVAQLARDAIELQA-DIAITAHDARLEELRXXX
DXR_PSEPF       ----------------------------------------------------------------------
DXR_PSYWF       -QRIAVLGATGSIGDSTLSILAAHPEHYQVYALSGHGRLDKLFELCQQFRPSRVAVPENKVDDFATRLAA
DXR_JANMA       MQQITILGSTGSVGVSTLDVIARHPDRYSVYALTAQSKVEELAQQCARFKPQVAVVGSAEAAKKLQVLLQ
DXR_HERAR       MQHITILGSTGSIGVSTLDVVARHPDRYRVHALTAQNKVEELAAQCAQFHPDVAVVGSAEAAQKLQVLLN
DXR_RHOBA       VSRVAVLGATGSIGVAALDVIEDPDFAWEVSSMSGHSQIDPLIELAGGCHTKCVVVSDAEMEAQAAKALR
DXR_MYCGA       --KILVLGATGSIGKQAIDVIC--QLKYQLVGFSYYQNHNEANNILKQLNPNYVLCHS------DPKYNK
DXR_PARDP       ----------------------------------------------------------------------
DXR_TREPA       VRRVVVLGITGSIGAAALKLLRRFPDRFLLVGASGHRQTEYARALAREFSLSDITMTEQEGRARIKRLLS
DXR_COREF       --KILILGSTGSIGTQALEVIADNPDLFTVGIAAGGSNPGLVIEQARAFNLRQVAVAGKQAAGEVGEALG
DXR_CORDI       -KKILILGSTGSIGTQALEVIASRQDQFEVVGIAAGRDPQLIIQQAQMLGLAHVAVANEKS---ATQVSR
DXR_PSEPK       -QRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRHRPAFAVVTEXXXXXXXXXXXX
DXR_METCA       MKGICILGSTGSIGVSTLDVLARHPDRYRVVALSANGNVDRLFEQCRAHRPRYXXXXXXXXXXXXXXXXX
DXR_SILPO       ----------------------------------------------------------------------
DXR_MYCTU       --RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDI--
DXR_MYCTA       --RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDI--
DXR_MYCBT       --RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDI--
DXR_MYCBP       --RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDI--
DXR_MYCBO       --RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDI--
DXR_CHRVO       ---IAVLGATGSVGCNTLDVVARHPERYRVVALTAHRQLDKLFEQARRFDYXXXXXXXXXXXXXXXXXXX
DXR_RHOSR       --RVLLLGSTGSIGTQALEVVAANPDKFTVVGLAAGANVELLDRQIRETGXXXXXXXXXXXXXXXXR---
DXR_RALME       MQRITILGATGSIGESTLDVVRRHPDRYSVHALSAHRQVDKLAAACVEFRPARAVVGSXXXXXXXXXXXX
DXR_KITGR       ----------------------------------------------------------------------
DXR_PSEPW       VQRITVLGATGSIGLSTLDVIARHPERYQVYALSGYTRIDQLLALCVLHCPAYAVVPNGEAAVRLREGLA
DXR_BEUC1       ----------------------------------------------------------------------
DXR_XANOR       LRQVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVEDLLALCAAHQPAHALIADAALYPXXXXXXX
DXR_XANOM       LRQVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVEDLLALCAAHQPAHALIADAALYPXXXXXXX
DXR_XANC5       LRQVAVFGATGSIGASALDVIARHPERLRASLLSAGSKVDELLALCATHRPAHAVIADAALYPXXXXXXX
DXR_DEIRA       --RLTVLGSTGSIGTQTLDVAR--QRGYTVGTLAAGRNLDLLAEQVREFRPALVSVDG--------SILA
DXR_XANAC       -RQVAVFGATGSIGTSALDVIARHPERLRASVLSAGSKVDELLALCATHRPAHALIADATLYALRDGLRA
DXR_MYCPA       --RVLVLGSTGSIGTQALQVIAANPDRFEVVGLAAGANLDTLLRQRAETGVTNVAVADEHA-------AR
DXR_MYCA1       --RVLVLGSTGSIGTQALQVIAANPDRFEVVGLAAGANLDTLLRQRAETGVTNVAVADEHA-------AR
DXR_PSEP1       -QRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRHRPAFAVVTEXXXXXXXXXXXX
DXR_XANCP       LRRVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVDALLALCVLHRPAHAVIADAALYPALRDGLR
DXR_XANC8       LRRVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVDALLALCVLHRPAHAVIADAALYPALRDGLR
DXR_PSEPG       ----------------------------------------------------------------------
DXR_NOCFA       --RVLLLGSTGSIGTQALEVIAANPDKFEVVGLAARGNPALLAEQMAATGTRNVXXXXXXXXXXLD----
DXR_HAHCH       MRRVTVLGATGSIGRSTLDVMARHPDRYELYAATAHSNLNELFSICIKHRPRYAILATDAGLAGFKKRLR
DXR_CORGL       -KKILILGSTGSIGTQALDVIADNSDKFEVVGIAAGGSQPDLVQQLGLXXXXXXXXXXXXXXXISKAL--
DXR_MYCS2       -QRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNPELLAAQRAQTXXXXXXXXXXXXXXXXXXXR
DXR_XANOP       LRQVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVEDLLALCAAHRPAHAVIADAALYPXXXXXXX
DXR_XANCB       LRRVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVDALLALCVQHRPAHAVIADAALYPTLRDGLH
DXR_MYCLE       --RVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGAQLDTLLRQRAATGVTNIAIADDRAAQLAGDI--
DXR_MYCLB       --RVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGAQLDTLLRQRAATGVTNIAIADDRAAQLAGDI--
DXR_CORGB       -KKILILGSTGSIGTQALDVIADNSDKFEVVGIAAGGSQPDLVQQLGLXXXXXXXXXXXXXXXXXXXL--
DXR_MYCMM       --RVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGSNLDTLLRQRAETGVTEIAIADERAAQLAGDI--
DXR_MYCUA       --RVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGSNLDTLRRQRAETGVTEIAIADERAAQLAGDI--
DXR_ARTAT       -RKIVILGSTGSIGTQAIDVVDAAPHRFEVVALSAGGGNLALIAQQAVHTRAQAVGIAQGDQGALRQLIR
DXR_PROAC       MKKVIILGSTGSIGTQTLEVISSRRDQFEVAGISAGSDVGSLAQQIIDFSIPXXXXXXXXXXXXLQRALS
DXR_BLOFL       ---------------------------FAVRALVAHNDVAVMIEQCFLVSPQYVC-------MICEEVAR
DXR_CAUCR       ----------------------------------------------------------------------
DXR_CAUCN       ----------------------------------------------------------------------
DXR_BORA1       ----------------------------------------------------------------------
DXR_CORJK       --RVVVLGSTGSIGTQALEVMADNPERF--ELVGISAHGSKLAQQVRDFGLRVAVASEHTAEWLDGEFGA
DXR_BORPD       ----------------------------------------------------------------------
DXR_AZOSE       LQRVTVLGATGSIGMSTLDVLARHPDRFEAFALTAQIQVERLFELCLRFSPRFAVLVDSAAASDLRQRLK
DXR_BORPE       ----------------------------------------------------------------------
DXR_BORPA       ----------------------------------------------------------------------
DXR_BORBR       ----------------------------------------------------------------------
DAPB_PELUB      MKKIAISGCLGRMGQQLIKSSKNN-KNFKLTALTENKAISKKIAGIKL--DVNTEQTFKKTDVIIDFTVP
COAD_BORAP      --KVAVFGSFDPITWGHIDLIKRSLAIFDVVLVAKNKSKKYLLSDIERFNFLNVFVDSYSGFIVDYALIN
COAD_BORGA      --KVAVFGSFDPITWGHIDLIKRSLAIFDVVLVAKNKSKKYLLSDVERFNFLNVFVDRYSGFIVDYALIN
COAD_BORBZ      --RVAVFGSFDPITWGHIDLIKRSLAIFDIVLVAKNKSKKYFLSDIERFNFSNVLVDRYSGFIVDYALIN
COAD_BORBU      --RVAVFGSFDPITWGHIDLIKRSLAIFDIVLVAKNKSKKYFLSDIERFNFSNVLVDRYSGFIVDYALIN
YCF1_PHAVU      ----------------------DEQKNLQKPLLNILFNYKRWFRYIKNNQFENIIKNEISEFFFHT-YPR
RSGA_MYCGE      -KKLSVFTGQSGVGKSSLINRLDPSLKQKIQALSVNKFGKNXXXXXXLFSFRGGFICDTPGFNVIS--IK
Y2628_BORBU     -----------NIGKSSYEI----QTNYKNYIRTTNSEIKEKLEQIK-----ENITPIYNKYKLPILNGE
SCPA_MYCGE      ----------------MISLIFDKSNSFNPQLCVELLNHFKVVMLTK------TIVVDYPSFQLQTELTP
RSMC_BUCCC      -----------------------------IKTFQISKEYKILKKNFQLFKNKTTIISGINYFNLYLKILK


                         .         .         *         .         .         .         .:140
query           NAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIICGWNLIKKDLKK
DXR_PELUB       NAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIICGWNLIKKDLKK
DXR_SULSY       ---IKVLVGEDGLRRAVNLD--LDLFINAIAGIKGILPTYLLLKYNKTLATANKEAIICLGELLKDKYKK
DXR_CLOK5       NLDTKILFGIDGLNTIVALPD-IDMVLTSVVGMVGLVPTIKAIESGKDIALANKETLVVGGELVTKLAKK
DXR_CLOK1       NLDTKILFGIDGLNTIVALPD-IDMVLTSVVGMVGLVPTIKAIESGKDIALANKETLVVGGELVTKLAKK
DXR_CLONN       NIKINLLYGMDGLIKI-STLEEVELVVTSIVGMIGLVPTLEAINAGKDIALANKETLVTGGELVMKAAKQ
DXR_CLOBB       NKQTIVLSQMEGLNKIASLE-EIDIVLTSLVGMIGLEPTLEAIKAKKDIALANKETLVVAGELVMSEAKK
DXR_CLOAB       KLKTSVKVGYEAFNEVASYKDS-NIVVTSIVGMIGLIPTLEAIKAGKDIALANKETLVVAGELVTKEAKK
DXR_CLOD6       NIEIEVLAGMEGL-KIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIALANKETLVTAGELVMKEAEK
DXR_CLOB8       NKKIKVLEGIEGLDKIASLD-EIDMVVTSVVGMIGLEPTMKAIEAKKDIALANKETLVVAGEIVMKAAKE
DXR_CLOPE       SEKCEVIYGMEGLVKVA-TLDEIDIVVTSVVGMIGLKPTVEAIRKGKDIALANKETLVVAGELVMREAKE
DXR_BACV8       DLPVKVYAGADALSQIVESQ-PIDIVLASMVGYAGLRPTINAIKAGKAIALANKETLVVAGELINALANQ
DXR_CLOP1       SQKCEVIYGMEGLVKVA-TLDEIDIVVTSVVGMIGLKPTVEAIRKGKDIALANKETLVVAGELVMREAKE
DXR_CLOBA       NNKSTVLSEMKGLNKIASLE-EIDIVLTSLVGMIGLEPTLEAIKAKKDIALANKETLVVAGELVMSEAKK
DXR_CLOPS       SEKCEVIYGMEGLVKVA-TLDEIDIVVTSVVGMIGLKPTVEAIRKGKNIALANKETLVVAGELVMREAKE
DXR_WOLWR       GTDVKIAIGATNVAAI-----PVDLSVVAIVGIAGLGPVMEVIESTKVIALANKESIVCGGXXXXXXXXX
DXR_CLOB6       NSKIKVLKGMEGMIYI-STLEEINTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_WOLPM       GTDVKIAIGATNIATI-----PVDLSVVAIVGIAGLGPVMEVIESTKVIALANKESIVCGGXXXXXXXXX
DXR_CLOTE       NNKTEVLYGIEGMNTIASLD-KVDIVLTSVVGMIGLEPTLKAIRNKKDIALANKETLVVAGEIIKKEAHE
DXR_ANAPZ       GSGIRXXXXXXXXXXXXXXS--VDTAVMAITGIVALSAVMRLIESVGTIALASKESVVCGGVLLRDAACK
DXR_EHRCJ       DTNIKVSAGDDGM--IMATSLDVDYAMMAIVGIAALVPMTYLINSNKVIALANKESIVCGGALLLSLAKE
DXR_BACTN       DLPIKVYAGIDAVCQIVEAG-PVDMVLTAMVGYAGLKPTINAIRAKKAIALANKETLVVAGELINQLAQQ
DXR_THEPX       NLKVEILTGSKGLQEIVKYD--ADLVVVAVEGIAGLIPTVTAIQMGKDIALANKEVLVTAGQIVMDLVKK
DXR_CLOBM       DSKIKVLKGMEGMIYI-STLEEINTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_BACFN       DLPVKVYAGAAALCQIVESG-PIDVVLTAMVGYAGLKPTMNAIRAGKAIALANKETLVVAGELINQLARQ
DXR_WOLTR       GTGIKVEVGTEGLMNVASL--PVDLSVVAVVGIAGLEPVMHVIESTKVIALANKESIVCGGXXXXXXTEE
DXR_PELPB       SHKPEIFHGLEGAAAIASAEG-VDMVVSAIVGAAGLLPTVSAIKAGKHIALANKETLVVAGKLVSDLVKK
DXR_CLOBL       DNKIKVLKGMEGMIYI-STLEEVNTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_CLOBK       DNKIKVLKGMEGMIYI-STLEEVNTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_CLOBJ       DNKIKVLKGMEGMIYI-STLEEVNTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_BACFR       DLPVKVYAGAAALCQIVESG-PIDVVLTAMVGYAGLKPTMNAIRAGKAIALANKETLVVAGELINQLARQ
DXR_THEP3       NLKVEILTGSKGLQEIVKYD--ADLVVVAVEGIAGLIPTVTAIQRGKDIALANKEVLVTAGQIVMDLVKK
DXR_CLOPH       DLEVTVEAGMDGLIACA-TEESADIVVSAVVGMIGIKPVMEAILRGKDIAFANKETLVTAGHLIMPLVKK
DXR_FUSNN       FIKEVYFNGLAELSK----NSDYDIILTAVSGAIGIDATVEAIKRGKRIALANKETMVSAGVYINKLLKE
DXR_CLOBH       DNKIKVLKGMEGMIYI-STLEEVNTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_CLOB1       DNKIKVLKGMEGMIYI-STLEEVNTVVTSVVGMIGLVPTIKAIESGKDIALANKETLVVAGELVISKAKE
DXR_BREBN       KSQPEIVYGAEGLELVAR-HEAANFVMTAVVGSVGVAPTLAAIEAGKTIGLANKETLVSAGPVVMKRAKE
DXR_PERMH       IKGVKTLIGEDGLYKLAQLD--IDLFINGISGINGILPTYLLLENNKKLATANKEAIICLGEIYGD---K
DXR_CLOTH       DTDCKVVGGVEGL-KMVAXXXXXXXXXXXXXGIAGLIPTMEAIKHKKNIALANKETLVTAGHIVMSEAAR
DXR_EUBR3       DTDIEVGYGMDGLIRCA-TIEPCDIVVTAIVGMLGIRPXXXXXXXXXXXXLANKETLVTAGHIIIPLAKE
DXR_THEYD       NLEILKGN--EGICKLAKLK-EADIILSAIVGAAGLIPTFEAVKEGKTIGVANKESFVMAGELIKKQGKI
DXR_THETN       NLDIEVLTGKEGLKEI--VKYEADMVVVAVEGIAGLIPTVEAIKLGKNIALANKEVLVTAGEIVMGLVKE
DXR_PELTS       GSYCPELGWGRTGMESLASMPEADLVVVAVTGFAGIYPTIAAIQAGKDVALANKETLVAAGHLVMKMAER
DXR_HALOH       DMSSEVLSGMEGLITI-SSLEEADLVINALVGAVGLKPTVAALQSGNTLGLANKESLVIGGEIIKSYLNE
DXR_EHRRG       GTNVKISVGDVGMQMAASLN--VDYVMMAIVGIAALVPMVYLISAVKVIALANKESVVCGGTLLFNLARE
DXR_EHRCR       GTNIKVSAGDSGM--VMATSLDVDYAMMAIVGMAALIPMTYLINSIKVIALANKESIVCGGTLLLSLAKE
DXR_THEP1       DSSINVWKGPHSIEEMLEAL-KPDITMVAVSGFSGLRAVLSSLEHSKRVCLANKESLVCGGFLVKKKLKE
DXR_EHRRW       GTNVKISVGDVGMQMAASLN--VDYVMMAIVGIAALVPMVYLISAVKVIALANKESVVCGGTLLFNLARE
DXR_ALKOO       GKKVKVVSGIEGLIEVA-TLDSADIVVTSVVGSIGLIPTVEAIRCGKTIALANKETLVVAGELIKKEAEK
DXR_THEMA       DSSINVWKGSHSIEEMLEAL-KPDITMVAVSGFSGLRAVLASLEHSKRVCLANKESLVCGGFLVKKKLKE
DXR_CHLT3       XXXXXXXXXXXXLCEI-SRRSDTDFVIGSVVGFAGLKPTVEALKAGKDVGLANKETLVVGGEIITSLVEE
DXR_WOLPP       GTNVKVEVGAPGLANVASL--PVDLSVIAIVGIAGLEPVIKVIESTKVIALANKESIVCGGKLLLKKAKE
DXR_VESOH       NADIQVLSSVQALDKIV-THQDTDYVMAAIVGAIGMSSALCGAKAGKRIMLANKESLVLAGDIFMKTVKE
DXR_EUBE2       DMDVKIVSGDEGLIEAA-TIESAEIVVTAVVGMMGITPTVEAIKAHKDIALANKETLVCAGHIIMSLAKE
DXR_LISMF       N--VKFFNGLEGLREVA-TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKE
DXR_LISMC       N--VKFFNGLEGLREVA-TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKE
DXR_THENN       GPHALE----DMMEAL-----KPDITMVAVSGFSGLRAVLAALEHSRRVCLANKESLVCGGFLVKRKLKE
DXR_PORGI       DLPIKVWCGAEAIADAV-TAPDIDMVVTAMVGYSGLLPTIKAIEARKMIALANKETLVVAGELIMRLAQD
DXR_PORG3       DLPIKVWCGAEAIADAV-TAPDIDMVVTAMVGYSGLLPTIKAIEARKMIALANKETLVVAGELIMRLAQD
DXR_BACHD       GTRVVCGE--EGLIEVA-TAEKAEILVNAVIGSVGLAPTLAAIEAKKTIALANKETLVTAGHLVTEKARE
DXR_LISMO       N--VKFFNGLEGLREVA-TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKE
DXR_LISMH       N--VKFFNGLEGLREVA-TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKE
DXR_BACSU       SFECQIGLGEEGLIEAA-VMEEVDIVVNALLGSVGLIPTLKAIEQKKTIALANKETLVTAGHIVKEHAKK
DXR_SHIFL       QSRTEVLSGQQAACDMAALE-EVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQ
DXR_FRATH       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_FRATF       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_ECOLI       QSRTEVLSGQQAACDMAALED-VDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQ
DXR_ECO57       QSRTEVLSGQQAACDMAALED-VDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQ
DXR_LISIN       FPDVKFFNGLDGLREVA-TYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMQAAKE
DXR_FRATN       DVEVLVGES--GLEKV-SSLAEVDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_CHLMU       H--IEILSGEEGLIAVA-TAASVDMTIVASSGIDALPAVMASIQERKTIALANKESLVAAGELVTTLAKK
DXR_FRATW       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_FRATT       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_FRATM       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_FRAT1       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_DESHD       DLDIEVVSGMEGLLRXXXXXXXXXXXX-AISGRIGLEPTMEALKAGKDIALANKETLVAGGDLVMGTAQR
DXR_PHOLL       GCKTEVFFGEQAACDLAALND-VDQVMSGIVGVAGLLPTLAAIRAGKQILLANKESLITSGRFFMDAVAK
DXR_BACA2       SHECQIGIGEEGLIEAA-VMDEVDIVVNALLGSVGLIPTLKAIEQKKTIALANKETLVTAGHIVKGHAKR
DXR_CAMJJ       HNRV--FIGQEGLEQIL-TECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLKG----
DXR_CAMJE       HDRV--FIGQEGLEQIL-TECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLKG----
DXR_CAMJ8       HDRV--FIGQEGLEQILTEQDKLLFN--AIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLKG----
DXR_CYAP7       SLDYSILGGEQGIVEVAGYGDAQSV-VTGIVGCAGLLPTIAAIKAGKDIALANKETLIAGGPVVLPLIEK
DXR_ZYMMO       EXXXXXXXXXXXXXXXXXXXXMMDWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVRE
DXR_PROMH       NTKTEILSGSDAVNEIAALD-EADQVMSAITGVAGLKPTLAAIEKGKRILLANKESLITSGRLFFDAVAK
DXR_MICAN       DLDYTILAGKEGVIEVARYGDS-ESVVTGIVGCAGLLPTIAAITAGKDIALANKETLIAGGPVVLPLVEK
DXR_DESHY       DLDIEVVSGMEGLLRXXXXXXXXXXXX-AISGRIGLEPTMEALKVGKDIALANKETLVAGGDLVMGTAQR
DXR_CAMJR       HDRV--FIGQEGLEQIL-TECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLKG----
DXR_FRATO       DVEVLVGES--GLEKV-SSLAEIDIVMSAIVGIAGLKPTFXXXXXXXXXXXXXXESLVTAGHLLIDEVVK
DXR_LISW6       N--VKFFNGLEGLREVA-TYLDGDVLLNAVMGSVGLLPTLDAIEAGKSIAIANKETLVTAGHIVMRAARE
DXR_PROM5       NLGISVLGGREAINSVAAWDSA-DTVITGIVGCAGLIPTMSAIKASKNIALANKETLIAAGSVVIPALKE
DXR_TREDE       NSNLKHEIDEEAVRRLIE-KSKADIVINGIAGSAGLKASVEVIKSGLDLALANKETIVEAGELIFQDAEK
DXR_PSYIN       XXSCHVLDDEQRLLELLASDH-VDSVMAAIVGAAGLKTTLAAVDAGKEVFLANKEALVMSGALFIDAVKK
DXR_TOLAT       GHKLKVLTGTDALCQVA-AHSSVDIVMAAIVGAAGLLPAMAAIKKGKTVLLANKEALVMSGRLFMDAAHH
DXR_MANSM       SAKTKVLAGQKAICELA-AHPEADQVMAAIVGAAGLLPTLSAVQASKTVLLANKETLVTCGQIFIDEVKR
DXR_CARHZ       NHGILLTTGSKELLNLALLPG-VDGIITAIPGTICLLPTIEALKAGKIIYLANKETMVAAGEIITP-LMK
DXR_NAUPA       FPNVKYGEELDMIEK-----SKSDLIVNALVGDAGLRPTLKAQECGKKIALANKESLVNAGKFI--DTSK
DXR_GEOSF       CRKTAVMYGVEGMIAAA-TASDTNMXXXXXXXXXXLLPTSAAIEAGKDIALANKETLVTAGRLIMDMVKT
DXR_CAMJD       HDRV--FIGQEGLEQIL-TECQDRLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLKG----
DXR_FERNB       GVELSVGRRVDSIGALLELT-KPDITICAIPGFEGVKATIEALKYTRRIALATKESMVCAGKFVKELAKK
DXR_BACP2       EYDVKMAAG-DEANIEAAIYDAVDVVVNALVGSVGLVPTLKAIEQKKTIALANKETLVTAGHIVKEYAKT
DXR_SHEWM       SLKIEVTTGESQLESIV-TSSCVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKESLVMSGRLFIEEMKK
DXR_SALTY       QSRTEVLSGQQAACEMAALD-EVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKR
DXR_SALTI       QSRTEVLSGQQAACEMAALD-EVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKR
DXR_SALPA       QSRTEVLSGQQAACEMAALD-EVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKR
DXR_SALCH       QSRTEVLSGQQAACEMAALD-EVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKR
DXR_CAMLR       DHK-NIFCAQDGLKKMIS-ECKSKFVVNAIVGFAGLNSSLIAQKLGKTLALANKESLVVAGKFF--DTSK
DXR_AQUAE       G--VKYLKGDEGLKAIIEESERL---MNAISGIYGIKPAYEVIKAGKTLLASNKESILCLGEIIRKNRER
DXR_MACCJ       SSSIKVVYGNDGLMEIA-AYVKNDMLLNSIMGSIGLKPTVHAIKHGIDIALANKETLVVAGEIIMQLARE
DXR_GEOSW       EGKVKIVFGEEGLIEAA-AFPETDIXXXXXXXXXXXXPTLRAIEAGKTIALANKETLVTAGHIVTAAAKK
DXR_ACAM1       DAIADVDPQPQLLXXXXXXXXXXXXXVTGIVGCAGLLPTIAAIKAGKDIALANKETLIAGGPVVLPLVEK
DXR_ANAVT       DLDPQPILLGGEAGVIEVARGDAETVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEK
DXR_ALISL       SNSIRVFSGEEGLCHIAQLD-EVDTVMAAIVGAAGLLPTMSAVKAGKRILLANKEALVMSGQLFIDAVEK
DXR_ACTP2       NVKTEVLSGQKAICEL-SAHPEVDMVMAAIVGAAGLLPTLSAVKAGKKVLLANKESLVTCGQIFIDEARK
DXR_RUTMC       TTDTQILSGTQALDKVV-AHQDTDFVMAAIVGTAGMSSALCAVKAGKRIMLANKESLILAGDIFMKAVEE
DXR_CHLTR       H--IEILLGEEGLVSVA-TEPSVTMTIVASSGIDALPAVIAAIRQKKTIALANKESLVAAGELVTTLARE
DXR_CHLTA       H--IEILLGEEGLVSVA-TEPSVTMTIVASSGIDALPAVIAAIRQKKTIALANKESLVAAGELVTTLARE
DXR2_BACHK      NTKI-VYGNEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR_EXISA       TYEPLYFIGPEGLKECA-TAERADIVVTAVVGAVGLEPTLAAIQAGKDIALANKETLVTAGHLVKAAVKE
DXR_BACLD       SYTFKTGIGEEALIEAA-VIPEADIVVNALVGSVGLLPTLKAMEHKKTIALANKETLVTAGHIVKEHAQK
DXR_ANASP       DLDPQPILLGGEAGVIEVARGDAETVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEK
DXR_CHLTB       H--IEILLGEEGLVSVA-TEPSVTITIVASSGIDALPAVIAAIRQKKTIALANKESLVAAGELVTTLARE
DXR_CHLT2       H--IEILLGEEGLVSVA-TEPSVTITIVASSGIDALPAVIAAIRQKKTIALANKESLVAAGELVTTLARE
DXR_CHLCV       N--IEVFXXXXXXXXXXXXXX-VDTIVAASSGVVALPAIIEAMKLGKTLALANKEVLVSAGEIIKEIAKQ
DXR_YERPY       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERPP       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERPN       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERPG       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERPE       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERPA       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERP3       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_VIBFM       AHAIEVFSGEDGLCHIAQLD-EVDTVMAAIVGAAGLLPTMSAVKASKRILLANKEALVMSGQLFIDAVEK
DXR_PELPD       GLEVKIVGGVEGLIEAA-TADETDMXXXXXXXXXXXXPTAAAIRAGKDIALANKETLVTAGHLFMEMVSS
DXR_CYAP8       -GVVEVARYGDSESVV-----------TGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEK
DXR_ACTPJ       NVKTEVLSGQKAICEL-SAHPEVDMVMAAIVGAAGLLPTLSAVKAGKKVLLANKESLVTCGQIFIDEARK
DXR_YERPS       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_YERPB       GSDTEVYSGETAACELAALDD-VDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKR
DXR_CYAA5       SMDYSILAGEQGVAEVAR-HGDAESVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLIEK
DXR2_BACCR      NTKI-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR_MENPI       ELKEALAGFEDMPEIIPGEQGMIEVAVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKK
DXR_BACC7       NTKI-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR_BACC3       NTKI-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR_BACC1       NTKI-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR2_BACCZ      NTKI-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR2_BACAN      NTKI-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR_SHEFN       NHCVQVTTGAEALNALV-TDSRTDTVMAAIVGAAGLVPTFDAVKAGKRVLLANKEALVMSGELFMHTARA
DXR_NOSP7       EAIIDLDPQPILLAGEAGVIEVARYGVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGAPVVLPLVEK
DXR_VIBF1       AHAIEVFSGEDGLCHIAQLD-EVDTVMAAIVGAAGLLPTMSAVKAGKRILLANKEALVMSGQLFIDAVEK
DXR_MYCPE       SPSVKTKNTVNSFEELLEKTNP-DIILNALVGFSGLHITLLALKNNVDLALANKESVVAGWLI--EDLKR
DXR_HAEPS       NLKIEVLAGQKAIYELAS-HPEVDMVMAAIVGAAGLLPTLSAVQAGKKVLLANKESLVTCGQIFIDEARK
DXR_BACCQ       NTKV-VYGSEGLLEVALHPDAEIVVN--AVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARK
DXR_PROMP       NLGISVLGGREAINSVAAWDSA-DTVITGIVGCAGLIPTMSAIKAGKNIALANKETLIAAGSVVIPALKE
DXR_PROM9       XSAPLVLGGKEGINAVAAWD-KADTVITGIVGCAGLIPTMSAINAGKNIALANKETLIAAGPIVIPALKK
DXR_DESRM       EKRPEIRYGLDGLVAVATCHEAV-VVVTALSGAIGLVPTCXXXXXXXXXXXXXXETLVAAGQYVTKLAEE
DXR_NITWN       GTGIEYGVGESAI--IEAASRPADWLMAAVSGAAGLKPALAAVDRGATIALANKECLVCAGDFFMQRAAR
DXR_HAEI8       HIPTKVLAGRRAICELA-AHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKN
DXR_GEOUR       GKGPAILHGVEXXXXXXXXXXXXXXXXXXXXXXX-LVPTAAAIKAGKDIALANKETLVTAGRLIMDMVKA
DXR_MOOTA       DPGIRILAGEEGLMAAACLEG-VELVVAAMVGIRSLKAILAALEAGKDIALANKEVLVAAGQLVMDRARR
DXR_LEPIN       NGRTQILYGESSLCELVR-EPEVEIVITAIVGSVGLRPTIAAITAGKRLGIANKETLVTSGPLIQSLIAK
DXR_LEPIC       NGRTQILYGESSLCELVR-EPEVEIVITAIVGSVGLRPTIAAITAGKRLGIANKETLVTSGPLIQSLIAK
DXR_ERWCT       ECKTEVLAGVQAACELAALDG-VDQVMAAIVGAAGLLPTLAAIHAGKQVLLANKESLVTCGRLFMDAVEQ
DXR_ANAMM       GTCVEV--GAGTAGVMDAASRDVDSAVMAITGIAALHPVIRLIKSVKSIALANKESVVCGGELLINAAKQ
DXR_ANAMF       GTCVEV--GAGTAGVMDAASRDVDSAVMAITGIAALHPVIRLIKSVKSIALANKESVVCGGELLINAAKQ
DXR_ORYSJ       DCKPEIIPGEQGVIEVARHPDAVTV-VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQK
DXR_HELMI       GLPIPVVTGEAGLAEAACLP-EVDTVVTAVSGAIGLGPTMAAIEAGKEIALANKETLVAAGPLVMAAARR
DXR_HAEIE       HIPTEVLAGQRAICELA-AHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKN
DXR_SHESH       SLNVEITTGEDQLIDIVSASC-VDSVMAAIVGAAGLVPTLAAVKAGKRVLLANKESLVMSGRLFIDEMRR
DXR_BLOPB       TADIEVLSGVMHACELASTND-VDMVMSAIVGIAGLKPTFSALRAGKKILLANKETLVTGGKLFMKEANR
DXR_AGRVS       GSGIDVAAGSSGLQEAACL--EADWVMAAIVGTAGLQPTLTAAARGADIALANKECLVSAGELFIETVRK
DXR_VIBCM       NQAMEVLYGEEAMCQVAALDD-VDTVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVAQ
DXR_VIBCH       NQAMEVLYGEEAMCQVAALDD-VDTVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVAQ
DXR_VIBC3       NQAMEVLYGEEAMCQVAALDD-VDTVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVAQ
DXR_HAEIN       HIPTEVLAGRRAICELA-AHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKN
DXR_HAEDU       NLTTQVLTGEQAICELA-AHPDANIVMAAIVGAAGLLPTLAAVKAGKQILLANKESLVTCGQIFIDEARK
DXR_NITHX       GSGIECGVGESAI--IEAASRPADWLMAAVSGAAGLKPALAAVDRGTTIALANKECLVCAGDFFMQRAAK
DXR_LYSSC       --------EYPTIHFTFGAQGLVEVAVNAVLGSVGLESTLAAIRMGKTIAIANKETLVTAGHLVMAEAKK
DXR_CLOCE       GFGIEVLWGQDGMKRVVE-HSEADTVVTSVVGTAGLIPTIHAIRHKKNIALANKETLVTAGQLVMEDAKK
DXR_CHLCH       AHKPEVYYGLDGAATIAALDG-VDMVVSAIVGAAGLRPTVAAIKAGKHIALANKETLVVAGELVSRLVAE
DXR_ARATH       EAKLEIIPGEQGVIEVARHPEAVTV-VTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANK
DXR_HAEIG       HIPTEVLAGQRAICELA-AHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKN
DXR_CHLFF       FPEIQAFLREEGLMAAA-TAEEIDMVVAASSGVVALPAIIEAMKSGKVLALANKEVLVSAGEIIKEFAKQ
DXR_YERE8       GSRTEVYSGEKAACELAAIDD-VDQVMAAIVGVAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVMH
DXR_RHOPT       XTDVACGAGESAV--IEAAARPADWVMAAISGAAGLKPALAAVDRGTTVALANKECLVCAGDFFMSRATA
DXR_GLOVI       XXXXXXXXGFDGMPEMFASQAPAEVVVTGIVGCAGLMPTLAAVDAGRDLALANKETLVAGGPVVMPRIRA
DXR_ACIBS       QSAIDVLAGQEGLVDIAS-HTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARD
DXR_HELHP       NGNYKLFFGSEGILEMIESSHS-HLLLNALVGFAGLKPSFKALQCNKKLALANKESLVAGWLLQNADI--
DXR_CHLAB       FPKVQAFLCEEGLLAAA-TANEIDTIVAASSGIVALPAIIAAMRSGKTLALANKEVLVSAGELINGLAQQ
DXR_BRAJA       GTSTECGAGESAV--IEAGARPADWVMAAVSGAAGLKPALAAVDRGAHVALANKECLVCAGDFFMQRAAK
DXR_PROVI       PARPEIVHGIEGAGTVAAAEGS-DMVVSAIVGAAGLTPTIKAIKAGKDIALANKETLVVAGQLVSDLVKQ
DXR_ACIBC       QSDIDVLAGQEGLVDIAS-HTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARD
DXR_ACIBT       QSDIDVLAGQEGLVDIAS-HTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARD
DXR1_BACCZ      SANTKITYGTDGLIAVA-THPDXXXXXXXXXXXXXXXPTIEALKAKKDIAIANKETLVAAGHIVTELAKQ
DXR_GEOBB       GKKPEIMHGVEGMIAAA-TASETTMXXXXXXXXXXXXPTTAAIMAGKDVALANKETLVTAGHLVMQMVRE
DXR_ACIAD       LADIDILSGTTGLVSVAQ-DEAVDVVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGNIMMQAARD
DXR_WOLSU       DSKL-LFGEEGIIESLHLAQSS--FVLNALVGFLGLRPTLESLRLGKTLALANKESLVAGGSFV--DASK
DXR_PARUW       GKTVLA--GMEGLLAAASYS-EADLVISAMTGTMGLQPTIEAIKAGKDVGLANKEALVSGGAIIMKLVKE
DXR_ACIBY       QSDIDVLAGQEGLVDIAS-HTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARD
DXR_ACIB5       QSDIDVLAGQEGLVDIAS-HTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARD
DXR_ACIB3       QSDIDVLAGQEGLVDIAS-HTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAARD
DXR_RHOPA       XTDVACGAGESAV--IEAAARPADWVMAAISGAAGLKPALAAVDRGTTVALANKECLVCAGDFFMSRATA
DXR_NITMU       RAGLEVLWGVDSLEKVASLPD-VDTVMAAIVGAAGIRPTFAAAATGKRVLLANKETMVMAGRIFTDVVKE
DXR_DESPS       GFRGKILWG-NAGNEEVAAYPSASITISAIVGAAGLLPTLAAIEAGKDIGLANKETLVMAGKIVMERARR
DXR_BRASO       -AGTXXXXXXXXXXXXXXXXRPADWVMAAVSGAAGLKPALAAVDRGATVALANKECLVCAGDFFMQRAAQ
DXR_RHOPS       DTEIACGAGESAV--IEAASRPADWVMAAISGAAGLKPALAAVDRGATVALANKECLVCAGDFFMSRAVA
DXR_RHOP2       XTDIAYGAGESAV--IEAAARPADWVMAAISGAAGLKPALAAVDRGATVALANKECLVCAGDFFMSRAVA
DXR1_BACAN      ----------DTLRTRISTNTKITY------GTDGLXPTIEALKAKKDIAIANKETLVAAGHIVTELAKQ
DXR_GEOSM       GKKPEIMHGVEGMIAAA-TASETTMXXXXXXXXXXXXPTTAAIMAGKDVALANKETLVTAGHLVMQMVRE
DXR1_BACHK      ----------DTLRTRISTNTKITY------GTDGLXPTIEALKAKKDIAIANKETLVAAGHIVTELAKQ
DXR_LAWIP       NYKPSIFVGQQGYVKLASLP-EVTTVLSAQVGAAGLHGTVAAAKNGKVICLANKETLVLAGKLIKNLCLQ
DXR_CAMHC       N---KIFSGENGICEMLNRCESKTV-INALVGFAGLIPSLKIQNSGKILCLSNKESLVVGGKFL--DTSK
DXR_RHIEC       GSGIAVASGKSGLMEA--ADRDADWVMAAIVGXXXXXXXXXXXXXXXXXXXXNKECLVSAGDLFIKAIRE
DXR_GLUOX       GTGIRTAAGRQAV--IEAGAMEADWTMAAITGAAGLEPTLAAARNGHAVALANKEALVCAGDVMLRAVAE
DXR_COLP3       DANVSVLSGEQALIDIAECQNS-DTVMASIVGASGLLPTLAAVNAGKRVLLANKEALVTSGAIFMAAVKA
DXR_PROA2       ESGPEIRWGIEGAAVVGEADGS-DMVVSAIVGAAGLVPTVRAIKAGKDIALANKETLVVAGQLVSELVRE
DXR_NEIMA       RTATQVLHGAQALVDVASAD-EVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARA
DXR_GEOMG       DPKPEIHHGIPGLIAAA-TXXXXXXXXXXXXXXXXXXPTAAAIKAGKDVALANKETLVTAGRIMMDLVRE
DXR_ERWT9       NVATEVLSG-EXXXXXXXXXXXXXXXXXXIVGAAGLLPTLAAIRAGKKVLLANKESLVTCGRLFLEAVSA
DXR_DESAP       XXXXEVHAGEPGLSAVA-TWPAADILLVAVAGTTGLVPTVEAIQSGKDVALANKETLVVAGELVTELALG
DXR1_BACCR      SANTKITHGTDGFIAVA-THPDXXXXXXXXXXXXXXXPTIEALKAKKDIAIANKETLVAAGHIVTELAKQ
DXR_THEEB       XXXXKPLXXXXXXXXXXXXXXXXXXXXTGIVGCAGLVPTIAAIKAGKDIALANKETLIAGGPVVLPLLQE
DXR_SHEPW       ---IEVTTGEDELLSLVSCA-EVDTVMAAIVGAAGLPSTLAAVKAGKRVLLANKESLVMSGQLFIEAMQS
DXR_SHEPA       HLKIEVTTGEDELLSLVSCS-EVDTVMAAIVGAAGLPSTLAAVNAGKRVLLANKESLVMSGQLFIEAMQN
DXR_PROMA       NALPHLVAGNDGLN-IAASWHSADLVVTGIVGCAGLLPTLAAIKAGKDIALANKETLIAAGPVVIPELKR
DXR_NEIG1       RTATQVLHGAQALVDVASAD-EVSGVMCAIVXXXXXXXXXXXXQKGKTIYLANKETLVVSGALFMETARA
DXR_GEOSL       GYKPEIHYGVEGLIAAA-TAGDAHMXXXXXXXXXXXXPTAAAIRAGKDVALANKETLVTAGRLIMDLVRD
DXR_PECCP       ECKTEVLAGEQAACDLAALDG-VDQVMAAIVGAAGLLPTLAAIHAGKQVLLANKESLVTCGRLFMDAVAQ
DXR_NITEC       VAGLMVLSGIESLEKVASLP-EIDTVMAAIVGAAGIRPTLSAAQAGKHILLANKETLVMAGRIFMDTIRQ
DXR_NEIMB       RTATQVLHGAQALVDVASAD-EVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARA
DXR_SYNSC       DAGVQLVGGADGLN-VAAAWDSADLVVTGIVGCAGLLPTLAAIRAGKDLALANKETLIAAGPVVLPELKK
DXR_CHLPD       NEKPEIFYGIEXXXXXXXXXXXXXXXXXIV-GAAGLVPTISAIKAGKNIALANKETMVVAGRLVTDLARQ
DXR_THELT       ---------IEMLEKL-----RPDITLVAIPGFSSLILALKAIEVSKRVLLASKEALVCGGWLIKEKLKN
DXR_EXIS2       ------------------TADQADIVITAVVGAVGLRPTLAAIEAGKSIGLANKETLVTAGHLVMKKARE
DXR_BUCAI       HSKIQVLTGEKDICALAALE-ETDHVISAIVGMAGLLPTLSAIHAGKTILLANKESLITSGYFFMKALSS
DXR_BRASB       -AGTXXXXXXXXXXXXXXXXRPADWVMAAVSGAAGLKPALAAVDRGATVALANKECLVCAGDFFMQRAAQ
DXR_NITEU       AAGLRVLSGIESLEKVASLP-EIDTVMAAIVGAAGIRPTLAAARTGKHILLANKETLVMAGRVFMDTLRQ
DXR_CHLPB       SEKPEILWGIXXXXXXXXXXXXXXXXS-AIVGAAGLVPTVSAIKAGKDIALANKETLVVAGQLVSDLVKE
DXR_CAMFF       NLHSRVFTSKDGIDKFLEACYDEFGSTVVINGFSGLRPSLVSQKLGFKLALANKESLVAGGKFL--DTKS
DXR_BACSK       DAQTLAGEFGDSIEFLYGEESESDIVVTAITGSIGLLPTLSXXXXXXXXXXXXXETLVSAGHLVVSAAKE
DXR_RHIE6       GSGIAVASGKSGLMEAADC--EADWVMAAIVGXXXXXXXXXXXXXXXXXXXXNKECLVSAGDLFLKSIRE
DXR_VIBVY       APNTQVLGGQEALCYVA-TLEQVDSVMAAIVGAAGLVPTMAAVKAGKRILLANKEALVMSGQLFIDEVEK
DXR_OLICO       GSGIEVGAGESAL--VEAALRPANWVMAAMSXXXXXXXXXXXXXRGEIVALANKECLVCAGEAFMRHAAA
DXR_GEOKA       GRTTIVYGEEGLIEAAVCP--QADXXXXXXXXXXXXXPTLKAIEAGKAIALANKETLVVAGHLVMAAAKR
DXR_BUCAT       HSKIQVLTGEKDICALAALE-ETDHVISAIVGMAGLLPTLSAIHAGKTILLANKESLITSGYFFMKALSS
DXR_BUCA5       HSKIQVLTGEKDICALAALE-ETDHVISAIVGMAGLLPTLSAIHAGKTILLANKESLITSGYFFMKALSS
DXR_VIBHB       XPSTEVLGGVDALCHV-SALEEVDSVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVEE
DXR_SINMW       GSGIEVAAGRTGLSEA--AERDAGWVMAAIVGNAGLGPTXXXXXXXXXXXXXNKECLVSAGSLFIDAVAE
DXR_VIBVU       APNTQVLGGQEALCYVA-TLEQVDSVMAAIVGAAGLVPTMAAVKAGKRILLANKEALVMSGQLFIDEVEK
DXR_SHELP       HMAIAVSSGEDELAAIVALP-EVDCVMAAIVGAAGLPATLAAVKAGKRVLLANKESLVMSGRLFIDAMQG
DXR_CHLTE       DHKPEILCGLXXXXXXXXXXXXX-MVVSAIVGAAGLVPTVRAIEAGKDIALANKETLVVAGQLVSDLVKK
DXR_THERP       FPDTRVVSGPGGLVEAA-TYETADIVVIALSGNSGIEPTLXXXXXXXXXXXXNKESVVCAGPLLRDIQSR
DXR_SYNP6       NPPL-ILTGEAGVTEVARYGDA-EIVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAAGPVVLPLLQK
DXR_SYNE7       NPPL-ILTGEAGVTEVARYGDA-EIVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAAGPVVLPLLQK
DXR_ELUMP       ENTKLLPPDEDSLIFLASLPSA-DLIINGLVGAVGFMPLVTAIKNGKTIALANKEPIVMAGKSIMEECYR
DXR_VIBPA       SPNTEVLGGVDALCHVASLE-EVDSVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVEQ
DXR_PSYA2       --DIEVVGGDAGLVDIA-TDSQTDTVVAAIVGAAGLPSTLAAARAGKRILLANKEALVMAGQVMINAVKT
DXR_LEPBL       IGKTQVLYGESALCELVR-EPEVQIVITAIVGSVGLRPTIAAITSGKRLGIANKETLVTFGPLVNSLIAK
DXR_LEPBJ       IGKTQVLYGESALCELVR-EPEVQIVITAIVGSVGLRPTIAAITSGKRLGIANKETLVTFGPLVNSLIAK
DXR_BAUCH       NAQLGIAINIISGNQALAALKEIDTVMAAIAGVDGLLSTLSALRAGKRVLLANKESLVSCGRLFMNEVHQ
DXR_RHOS5       GSGTEVAGGTQAIAEA--ADRPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTAEE
DXR_PSYCK       GLDIEVVGGETGLVDIA-TDSQTDTVVAAIVGAAGLPSTLAAARAGKRILLANKEALVMAGQVMINAVKT
DXR_PROM1       --KPLLMAGAEGLNTAAAWGSA-DLVVTGIVGCAGLLPTLAAIEAGKDLALANKETLIAAGPVVIPALKK
DXR_PELLD       TDLPEICHGIEGAGTVAAAEGS-DMVVSAIVGAAGLTPTVKAIKAGKDIALANKETLVVAGQLVSDLVKK
DXR_HELPH       PLGAEVFVGLDGIDAMIEVSNLV---LNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGNLL--DISQ
DXR_AGRT5       GTGIKVAAGMAGLEEAASMD--AGWVMAAIAGTPGLAPTLTAARRGADIALANKECLVSAGDVFLRTVKQ
DXR_RHIME       GSGIEVAAGRSGLTEA--AERDAGWVMAAIVGNAGLGPTXXXXXXXXXXXXXNKECLVSAGSLFIDAVAE
DXR_EDWI9       ECTIAVMSGEHAACELAALD-EVDQVMAAIVGAAGLLPTLAAIRANKRVLLANKEALVTCGRLFMEALSH
DXR_GEOLS       XXXXXXXXXXXXXXCAAATAPXXXXXXXXXXXXXXXXPTAAAIRAGIDVALANKETLVTAGHLFMELVER
DXR_CHLPN       FPHMQFFLGQEGLTQLCIMDT-VTTVVAASSGIEALPAILESMKKGKALALANKEILVCAGELVSKTAKE
DXR_CAMC5       --KSQIFVGAGGLLEMLEACHS-QKVVNAIVGFAGLAPSLKTQELGKSLALANKESLVAGGKFL--DTAK
DXR_SERP5       ENGIEVMAGEQAACELAALDD-VDQVTAAIVGAAGLLPTLAAIRAGKQVLLANKESLVTCGRLFMDAVQQ
DXR_RHOS4       GTGTEVXXXXXXXXXXXD--RPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTARE
DXR_RHOSK       GTGTEVXXXXXXXXXXXD--RPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTAQE
DXR_RHOS1       GTGTEVXXXXXXXXXXXD--RPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTAEE
DXR_AGRRK       DXXXXXXXXXXXXXXXXXXXXSIDWVMAAIVGTAGLAPTLEAARRGADIALANKECLVSAGDLFVRAVAE
DXR_SHESA       ELNIQVTSGEDELIALV-TATEVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATKA
DXR_PSEU5       GVSTRVLDGEGGLSEVA-AHPEVDVVMAAIVGAAGLKPTLAAVQSGKRVLLANKEALVMSGALFMQALRD
DXR_NITOC       PVEIEVSSGSEALETIV-TSPDTDYVMAAIVXXXXXXXXXXXXXXXKRILLANKESLVMSGQLFMSAVSE
DXR_SHEHH       HLDIEVTTGXXXXXXXXXXXXXXTV-MAAIVGAAGLPSTLAAVNAGKRVLLANKESLVMSGQLFIEAMQK
DXR_SACD2       NCTTEVLAGEQALCDVASAV-QVDSVMAAIVGAAGLAPTLAAVEAGKRVLLANKESLVMSGKLFMQAAKA
DXR_RHOPB       GTGIACGAGDSAI--VEAAERPADWXXXXXXXXXXLKPTLAAVDRGAHVALANKECLVCAGEFFMDRAAK
DXR_RHIL3       GTGIAVASGKSGLMEA--ADRDVDWVMAAIVGXXXXXXXXXXXXXXXXXXXXNKECLVSAGDLFIAAIRE
DXR_SHEON       XXNIQVTSGEDELIALV-TAPAVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATRA
DXR_PSE14       DLAAAVLDTRVLVGEEVAAHPRVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGDLFMQAVRQ
DXR_PHOPR       KHEIQVLAGDAGLCQVAALD-EIDTVMAAIVGAAGLLPTMAGVKAGKRILLANKEALVMSGQMFIDACEQ
DXR_WIGBR       XXXCKTSVLFGS-NDICNSSKEVDIVISATVGLSGIFFLFSAIKSGKKILLANKEILVSCGHFFMKQVEK
DXR_SHESR       ELNIQVSSGEDELIALV-TATEVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATKA
DXR_SHEB2       TLNIQVTTGMNDLLGLV-TAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVLLANKEALVMSGELFIEATKR
DXR_CHLL2       -----------------------------IVGAAGLVPTVSAIKAGKHIALANKETLVVAGQLVSDLVKK
DXR_SOLUE       AAGLPKSEWPDLLSXXXXXXPEVDTVISAIVGVAGLEATYEAVCLGKRVGLANKEVLVSGGSLVMEAVRK
DXR_SHESM       ELNIQVSSGEDELIALV-TATEVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATKA
DXR_SHEB5       TLNIQVTTGMNDLLGLV-TAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVLLANKEALVMSGELFIEATKR
DXR_UNCTG       NIKTDVYKGNTGLEKL-TTMPKTDMILAAIIGAVGLXXXXXXXXXXXXXXXXXXXXXVMAGSYIMKLAAE
DXR_SHEB9       TLNIQVTTGMNDLLGLV-TAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVLLANKEALVMSGELFIEATKR
DXR_RHISN       GSGIEVAAGRSGL--IEAAERDAGWLMAAIVGNAGLGPTXXXXXXXXXXXXXNKECLVSAGSLFIEAVAK
DXR_PROMT       --KPLLMAGAEGLNTAAAWGSA-DLVVTGIVGCAGLLPTLAAIEAGKDLALANKETLIAAGPVVIPALKK
DXR_IDILO       QTSTQVMYGDQALAEV-SSDAEVDVVMAAIVGAAGLSPTLAAIDAGKDVLLANKEALVMSGQLFIDHAQR
DXR_RALSO       AEATGIDIRFEALEEAA-AHPDCDAVMAAIVGAAGLRPTLAAVRAGKRVLLANKEALVMSGALFMDAVRQ
DXR_ARTS2       DARPEIITGPDASTRIAEI--EADVVLNGITGSIGLAPTLAALKSGATLALANKESLIVGGALVKAAARE
DXR_RALEH       DAGVKTVSHGEAALESVAADAQTDSVMAAIVGAAGLRPTLAAARAGKRVLLANKEALVMSGRIFMDAVRE
DXR_PASMU       -----------------------DMVMAAIVGAAGLLPTLSAVKAGKRVLLANKEALVTCGQLFIDAVRE
DXR_CELJU       QGCLEVLYGADALASVAGAS-EVDMVMAAIVGAAGLLPTXXXXXXXXXXXXXXXEVLVMAGGLFTQAVAE
DXR_PSEF5       GAGLQVLVGEQGLCEVASAP-EVDAVMAAIVGAAGLRPTLAAVEAGKKILLANKEALVMSGALFMQAVGK
DXR_HELPS       PLGAKVFVGLEGIDAMIEVSNLV---INAIVGVAGLRASFKSLQTNKKLALANKESLVSAGHLL--DISQ
DXR_SYNS9       EALPEMVGGPDGL-EVAASWGSAELVVTGIVGCAGLLPTLAAVRAGKDLALANKETLIAAGPVVLPELKK
DXR_SYNJB       GIRPELVAGTEGLCQVA-AHPAAQRVVTGIVGCAGLLPTLAAIRAGKDIALANKETXXXXXXXXXXXXRE
DXR_STRAW       EALTAQYGPGEPLPEILXXXXXXXXSDCGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKALAKP
DXR_RHOP5       LAGTXXXXXXXXXXXXXXXXRPSDWVMXXXXXXXXXXXXXXXXDRGATVALANKECLVCAGEFFMQRAAD
DXR_RALEJ       MAGVKTVSHGEAALESVASDAQTDSVMAAIVGAAGLRPTLAAARAGKRVLLANKEALVMSGRIFMDAVRE
DXR_DECAR       SVGLEVRYGVEALIEL-SSLPEVDAVMAAIVGAAGLEPTLAAARAGKKVMLANKEVLVMAGELFMHAVRE
DXR_PSEU2       DLAARVLVGEGGLCEVA-ADPRVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMQAVRQ
DXR_LEIXX       SVDADVVLN-------------------GITGSVGLGPTLAALESGRTLALANKESLIVGGELVKRAAAP
DXR_SYNS3       ALPADLVGGPEGLDVVASWDSA-DLVVTGIVGCAGLLPTLAAIRAGKDLAVANKETLIAAGPVVLPELKK
DXR_PROMM       NALPQLLAGPEGLN-VAASWDSADLVVSGIVGCAGLLPTLAAIKAGKDLALANKETLIAAAPVVLPELKR
DXR_LEPBP       GDKALI-----DLVQL----PSVGVVVTAVMGARGVLPTXXXXXXXXXXXXXXXETLVTFGPLINRLVAK
DXR_LEPBA       GDKALI-----DLVQL----PSVGVVVTAVMGARGVLPTXXXXXXXXXXXXXXXETLVTFGPLINRLVAK
DXR_HELPY       PLGAEVFVGLEGIDAMIETSNLV---LNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLL--DISQ
DXR_SYNPX       RKRPQLVGGPDGLN-IAASWESADLVVTGIVGCAGLLPTLAAVRAGKDLALANKETLIAAGPVVLPELKK
DXR_STRCO       EALTAQYGTGEPLPEILEAATQLAASDCGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKALAKP
DXR_PSEMY       AAALEVLVGEEGLCAVAG-HGEVDCVMAAIVGAAGLRPTLAAVQAGKKVLLANKEALVMSGALFMQAVRE
DXR_HELPJ       --GAEVFVGLDGIDAMIEVSNLV---INAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLL--DISQ
DXR_BURCM       AAGSKTIVLYGPQALVVSKSDGCDTXXXXXXXXXXXXXXXXXXXXXKRILLANKESLVMSGAIFMDAVRD
DXR_BURA4       AAGSKTIVLYGPQALVVSKSDGCDTXXXXXXXXXXXXXXXXXXXXXKRILLANKESLVMSGAIFMDAVRD
DXR_ANAD2       PGTEVLSGDAGAV--AVASHPDAAFVLAAISGGAGLRSTAAAIEAGKPVGLANKESMVLAGELLMARAAA
DXR_SYNJA       GMRPELVAGTEGLCQVA-AHPAAQRVVTGIVGCAGLLPTLAAIRAGKDIALANKETXXXXXXXXXXXXRE
DXR_PSEFS       AAGLQVLVGEEGLCQV-SADAEVDTVVAAIVGAAGLRPTLAAVDAGKKILLANKEALVMSGALFMQAVRK
DXR_DESOH       GSRTEVFGEAGYCHAVSLPG--VDMVVSAMVGAAGLGPTXXXXXXXXXXXXXNKEVLVMAGETVMALAAQ
DXR_BURVG       AAKTTVLYGPQALVDV-SASDGCDTXXXXXXXXXXXXXXXXXXXXXKRILLANKESLVMSGGIFMDAVRD
DXR_ANASK       PGTEVLSGDAGAV--AVASHPDAAFVLAAISGGAGLRSTAAAIEAGKPVGLANKESMVLAGELLMARAAA
DXR_SYNY3       AAVAELYXXXXXXXXXXARYGDAESVVTGIVGCAGLLPTMXXXXXXXXXXXXNKETLIAGAPVVLPLVEK
DXR_RALPJ       AAGIEICSGTKALEEAA-AHPDCDAVMAAIVGAAGLRPTLAAVRAGKRVLLANKEALVMSGALFMDAVRE
DXR_BIFLO       XXXVRVTGGPDSV--IAMAGSGANVVLNGITGSIGLEPSIAALKAGSQLALANKESVVAGGHLLFSAQVR
DXR_PSEAB       XXRTRVLFGEQALCEVASAP-EVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKR
DXR_RHOCS       XXXXXXXXXXXXXXXXXQ--RPADWVMAAIVGAAGLEPTLXXXXXXXXXXXXNKECLVCAGELLMAEVRR
DXR_BUCAP       XXXTQVLSGNKAICQLAALKES-DLVISAIVGMAGLLPTLSAINAGKTILLANKESLIVCGIIFMKALSS
DXR_PSEA7       XXRTRVLFGEQALCEVASAP-EVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKR
DXR_BURP8       XXXCKTAVAYGPQALVVSKSDGCDTVVAAIVGAAGLEPSLAAARAGKRILLANKEALVMSGSIFMDAVHD
DXR_PSEAE       XXRTRVLFGEQALCEVASAP-EVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKR
DXR_PSEA8       XXRTRVLFGEQALCEVASAP-EVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKR
DXR_CYAP4       VCEVAAYGDAKTV-------------VTGIVGCAGLLPTIAAIKAGKDIALANKETLIAGGPVVLPLVEQ
DXR_BIFLD       XXXVRVTGGPDSV--IAMAGSGANVVLNGITGSIGLEPSIAALKAGSQLALANKESVVAGGHLLFSAQVR
DXR_TROW8       ATEADVVLN-------------------AITGAAGLLSTYATLKTGKRLALANKESLIMGGKYFL-DMTS
DXR_THET2       ELKAR-FPGLRXXXXXXXXXXXXXXXXXXIPGLAGLAPTRAAVRTGKRVALANKEAMVAAGPLLWREAEA
DXR_BIFLI       XXXVRVTGGPDSV--IAMAGSGANVVLNGITGSIGLEPSIAALKAGSQLALANKESVVAGGHLLFSAQVR
DXR_ACIF5       DAKIQVESGPEALAEAARMSG-VDEVMAAIVGAAGLLPTLAAVEAGKKVYLANKECLVMAGNLFMERVRQ
DXR_ACIF2       DAKIQVESGPEALAEAARMSG-VDEVMAAIVGAAGLLPTLAAVEAGKKVYLANKECLVMAGNLFMERVRQ
DXR_THET8       ELKAR-FPGLRXXXXXXXXXXXXXXXXXXIPGLAGLAPTRAAVRTGKRVALANKEAMVAAGPLLWREAEA
DXR_PSESM       AAGLRVLVGEGGLCEVA-AHPMVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMQAVRQ
DXR_METFK       GLETQVLSGLAALEEVA-AHPEAHVVMAAIVXXXXXXXXXXXXXXXKRILLANKETLVMAGKLFMQAVEE
DXR_CUPTR       DASVATEVSYEAALESIXXXXXXXXXXXXIVGAAGLRPTLAAARAGKRVLLANKEALVMSGRIFMDAVRE
DXR_SYMTH       DYRPEIAWGREGLIRAA-THPESGLVLTSVVGAMGVEPTLAAIEAGKDIALANKETLVAAGELVTAAAQA
DXR_HELP2       --GAKVFVGLEGIDAMIEVSNLV---LNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLL--DISQ
DXR_SHEAM       GLGIEVSSGDEALLGLV-TAAEVDTVMAAIVGAAGLLPTLAAVRAGKRVLLANKEALVMSGELFMEETKK
DXR_SODGM       XXXXXXXXXXXXQAACLATLDEVDTVMXXXXXXXXXXXXXXXXXXXKRVLMANKESLVTCGRLFMNEARR
DXR_ARTCA       -----------------------DVVLNGITGSIGLAPTLAALKSGATLALANKESLIVGGSLVKAAARD
DXR_TROWT       ATEADVVLN-------------------AITGAAGLLSTYATLKTGKRLALANKESLIMGGKYFL-DMTT
DXR_BURPP       EAGCKTEITYGPQALVVSKSDGCDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_HELPG       --GAEVFVGLEGIDAMIEASNLV---LNAIVGVAGLRASFKSLQRNKKLALANKESLVSAGHLL--DISQ
DXR_BURCJ       AAKTVVLHGPQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURCH       AAKTVVLHGPQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURCC       AAKTVVLHGPQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURCA       AAKTVVLHGPQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_AERS4       TSATRVLSGQAALCEVA-AHPDAHSVMAAIVGAAGLAPTMAAVRAGKRILLANKEALVMSGAFFMEAVRE
DXR_DESVV       AGYAPHIHIGPEGYATMATLPEAGTVLSAQVXXXXXXXXXXXXXHGKVICLANKESLVLAGDIIRRHCAG
DXR_DESVH       AGYAPHIHIGPEGYATMATLPEAGTVLSAQVXXXXXXXXXXXXXHGKVICLANKESLVLAGDIIRRHCAG
DXR_BURS3       AAKTTVLHGPQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURPS       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURP6       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURP1       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURP0       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_AERHH       TSATRVMAGPAALCEVA-AHPDAHSVMAAIVGAAGLAPTMAAVRAGKRILLANKEALVMSGAFFMEAVRE
DXR_XYLFM       AAGLKAYAGEAALAELV-ASTTCDTVVAAIVGAAGLHSTXXXXXXXXXXXXXNKESLVLAGMLLMREASI
DXR_BURMS       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURMA       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURM9       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURM7       AARTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_XYLFT       AAGLKAYAGEAALAELV-ASTTCDTVVAAIVGAAGLHSTXXXXXXXXXXXXXNKESLVLAGMLLMREASI
DXR_XYLF2       AAGLKAYAGEAALAELV-ASTTCDTVVAAIVGAAGLHSTXXXXXXXXXXXXXNKESLVLAGMLLMREASI
DXR_JANSC       XXXXXXXXXXXXXXXXXXXDRPADWIMSAIVGAAGLAPGFRALRHGTTLALANKESLVTAGPLLLAEAAT
DXR_BURTA       AAKTQVAYGKQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_BURM1       AARTTVLYGPQALVDVSKSDG-CDTXXXXXXXXXXXXXXXXXXXXXKRILLANKESLVMSGAIFMDAVRD
DXR_DESDG       AGYRPRIHTGQEGYEFLAALPEADCVLSAQXXXXXXXXXXXXXXXXXXXXLANKESLVLAGGLIRRLCHE
DXR_XYLFA       AAGLKAYAGEAALAELV-ASTTCDTVVAAIVGAAGLHSTXXXXXXXXXXXXXNKESLVLAGMLLMREASI
DXR_BURXL       EAGCKTEVTYGPQALVVSESDGCDTXXXXXXXXXXXXXXXXXXXXXKRILLANKEALVMSGAIFMDAVRD
DXR_LARHH       GMNVEILHG-EXXXXXXXXXXXXXXXXXXIVGAAGLAPTMAAVRAGKQVYLANKESLVVAGRLMMEAVAA
DXR_SILST       XXXXXXXXXXXXXXXXXXXR-PADWIMSAIVXXXXXXXXXXXXEQGTTLALANKESLVCAGALLMQTAAD
DXR_PSEPF       -----------------------------IVGAAGLRPTLAAVEAGKKILLANKEALVMSGALFMQAVRK
DXR_PSYWF       QIACEVVGGQAGLDDIA-LDPQVDTXXXXXXXXXXXXXXXXXXXXXXRVLLANKEALVMAGSLMMQAVRD
DXR_JANMA       GLHTQVGYGEAALCAVASAP-ECDSVMAAIVXXXXXXXXXXXXRSGKRVLLANKEALVMSGPLLMEAVAA
DXR_HERAR       GMGLQTQVEYGAAALCTVASAECDCVMAAIVXXXXXXXXXXXXXXXKKILLANKEALVMSGPLLMEAVAA
DXR_RHOBA       TASTQTSSRLTERCRLAATENDVDVVVAAIVGRAGLESTLAAVHAGKRVALANKETLVVAGPVVTRAAAN
DXR_MYCGA       NVKSDLIELIDK--------SKPKVIINAINGYHGIEASLIALSKKKDLLLANKESLVIAGSQLEAIRKD
DXR_PARDP       -----------------------DWTLSAIVGAAGLPPGLEVLNRGGTLALANKETLVAAGPLVMARARE
DXR_TREPA       SCEAEVVVN-------------------GIAGAAGLFASLEVLKTRCTLALANKEXXXXXXXXXXXXXRE
DXR_COREF       GTVIDGPDAAQTLVESVQATDPADAVLNALVGSMGLGATLATLRSGAHLALANKESLVAGGEFVMAQARP
DXR_CORDI       ALGAAVLSGRDAATDLVESV-PADTVLNGLVGSMGLRATLATIQLGEVLALANKESLVAGGTFVTSQAAP
DXR_PSEPK       GCTTEVLEGEAGLCQXXXXXXXXXXXXXXX-GAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRQ
DXR_METCA       XGGIEVLAGPEALEQIASLP-EVDSVMAAIVXXXXXXXXXXXXXXXKDVLLANKEALVMSGPLFMAEVAR
DXR_SILPO       -----------------------------------------------TLALANKETLVCAGALVLETARR
DXR_MYCTU       -----PYHGSDAATRLVE-QTEADXXXXXXXXXXXXRPTLAALKTGARLALANKESLVAGGSLVLRAARP
DXR_MYCTA       -----PYHGSDAATRLVE-QTEADXXXXXXXXXXXXRPTLAALKTGARLALANKESLVAGGSLVLRAARP
DXR_MYCBT       -----PYHGSDAATRLVE-QTEADXXXXXXXXXXXXRPTLAALKTGARLALANKESLVAGGSLVLRAARP
DXR_MYCBP       -----PYHGSDAATRLVE-QTEADXXXXXXXXXXXXRPTLAALKTGARLALANKESLVAGGSLVLRAARP
DXR_MYCBO       -----PYHGSDAATRLVE-QTEADXXXXXXXXXXXXRPTLAALKTGARLALANKESLVAGGSLVLRAARP
DXR_CHRVO       XXXSEVLHGADALVQVAALP-EVDAVMASIVXXXXXXXXXXXXXXXXXXXXXNKESLVVAGRLFMDAVRA
DXR_RHOSR       ---PGVLSGPDAVTELVRTT-EADVVLNALVGSLGLEPTLAALESGARLALANKESLVAGGPLVTAAAAP
DXR_RALME       XXGVPTEVSYETALESIAEDAGTDAVMAAIVXXXXXXXXXXXXXXGKRVLLANKESLVMSGGIFMDAVRE
DXR_KITGR       -----------------------------ITGSIGLAPTXXXXXXXXXXXXXNKESLIVGGPLVKAVAQP
DXR_PSEPW       AAATEVLEGEAGLCEXXXXXXXXXXXXXIV-GAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRR
DXR_BEUC1       -----------------------DVVLNGITGSVGLAPTLAALEAGSTLALANKESLVAGAALVRAAQQR
DXR_XANOR       XXXXXTXXXXXXXXXXXXXXXXCDTVVAAIVGAAGLPSTXXXXXXXXXXXXXNKESLVLAGELLTRTATA
DXR_XANOM       XXXXXTXXXXXXXXXXXXXXXXCDTVVAAIVGAAGLPSTXXXXXXXXXXXXXNKESLVLAGELLTRTATA
DXR_XANC5       XXXXXTQXXXXXXXXXXXXXXXVDTVVAAIVGAAGLPSTXXXXXXXXXXXXXNKESLVLAGELLTRTAAA
DXR_DEIRA       EARERLSGVRVIADPSEXXXXXXXXXXXXMSGLIGLPPTRXXXXXXXXXXXXTKEAMVTSAHLMWEXXXX
DXR_XANAC       RGLATQXXXXXXXXXXXXXXXXCDTVVAAIVGAAGLPSTXXXXXXXXXXXXXNKESLVLAGELLTRTAAA
DXR_MYCPA       RAGDIPFCGPEAATRLVE-ETEADXXXXXXXXXXXXRPTLAALESGARLALANKESLIXXXXXXXXXXXX
DXR_MYCA1       RAGDIPFCGPEAATRLVE-ETEADXXXXXXXXXXXXRPTLAALESGARLALANKESLIXXXXXXXXXXXX
DXR_PSEP1       XCTTEVLEGEAGLCQXXXXXXXXXXXXXXX-GAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRQ
DXR_XANCP       AAGLTTQXXXXXXXXXXXXXXXXXXTVAAIVXXXXXXXXXXXXXXXXXXXXXNKESLVLAGELLTRTAAA
DXR_XANC8       AAGLTTQXXXXXXXXXXXXXXXXXXTVAAIVXXXXXXXXXXXXXXXXXXXXXNKESLVLAGELLTRTAAA
DXR_PSEPG       -------------------------------GAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRR
DXR_NOCFA       ---IKLAGPHAVTELVRRT--EADVVLNALVGSLGLEPXXXXXXXXXXXXXXNKESLVAGGSLVTRAAAP
DXR_HAHCH       DAGVEVRVGVEAMCEXXXXXXXXXXXXXXXXXXXXX-PTLAAVNSGKRILLANKEALVMTGRLFMDAVRR
DXR_CORGL       --GGEIISGTDAA-KILVETTKADTVLNXXXXXXXXXXXXXXXXXXXHLALANKESLVAGGEFVTSKAKL
DXR_MYCS2       ------YSGPDAVTRLVE-DTEADXXXXXXXXXXXXQPTXXXXXXXXXXXXXNKESLVAGGPLVLKAAAP
DXR_XANOP       XXXXXTXXXXXXXXXXXXXXXXCDTVVAAIVGAAGLPSTXXXXXXXXXXXXXNKESLVLAGELLTRTATA
DXR_XANCB       DAGLTTQXXXXXXXXXXXXXXXXXXTVAAIVXXXXXXXXXXXXXXXXXXXXXNKESLVLAGELLTRTAAA
DXR_MYCLE       -----PYHGTDAVTRLVE-ETEADXXXXXXXXXXXXRPTLAALHTGARLALANKEXXXXXXXXXXXXXQP
DXR_MYCLB       -----PYHGTDAVTRLVE-ETEADXXXXXXXXXXXXRPTLAALHTGARLALANKEXXXXXXXXXXXXXQP
DXR_CORGB       --GGEIISGTDAA-KILVETTKADTVLNXXXXXXXXXXXXXXXXXXXHLALANKESLVAGGEFVTSKAKL
DXR_MYCMM       -----AYQGPDAVTRLVE-ETEADXXXXXXXXXXXXRPTXXXXXXXXXXXXXNKESLVAGGPLVLQAAQP
DXR_MYCUA       -----AYQEPDAVTRLVE-ETEADXXXXXXXXXXXXRPTXXXXXXXXXXXXXNKESLVAGGPLVLQAAQP
DXR_ARTAT       NFAPEIFVGPDASTRIAAI--ECDVVLNGITGSIXXXXXXXXXXXXXXXXXXNKESLIVGGALVKAAASP
DXR_PROAC       RGRIRILTGPDASTEL--AAMPADVVCNAIXXXXXXXXXXXXXXXXXXXXXXNKESLVIGGRLVTQAAAS
DXR_BLOFL       NLKYKLVNNIQVLSGVLSALDAVDMVVSTMAGIARLQPIFSAIRVGKKILLANKETLVLSGQLFMTEVYK
DXR_CAUCR       ------------------------------------------------IALANKESLVCXXXXXXXXXXX
DXR_CAUCN       ------------------------------------------------IALANKESLVCXXXXXXXXXXX
DXR_BORA1       ----------------------------------------------KRVLLANKEALVAAGSIFMSAVRQ
DXR_CORJK       HCIRGKDSARELVEAVGPELGECDVILNALVGSXXXXXXXXXXXXXXXXXXXNKESLVAGGQLVLKAADE
DXR_BORPD       ----------------------------------------------KRVLLANKEALVAAGALFMRAVRA
DXR_AZOSE       AAATEVLAGPGALVDVA-AHPDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKEALVLSGRLFMQAVVE
DXR_BORPE       ----------------------------------------------KRVLLANKEALVAAGSLFMAAVRE
DXR_BORPA       ----------------------------------------------KRVLLANKEALVAAGSLFMAAVRE
DXR_BORBR       ----------------------------------------------KRVLLANKEALVAAGSLFMAAVRE
DAPB_PELUB      NCTLDILKIASKLKK---------RVVIGTTGFNQKEEAL-IKKFSKTIPILKAGNMSLGVNLL-----M
COAD_BORAP      SIKIRAFNDFDIEFERYLVNNKLNFKIDTI----------------------------------------
COAD_BORGA      SIKIRAFNDFDIEFERYLVNNKLNFKIDTI----------------------------------------
COAD_BORBZ      SIKIRAFNDFDIEFERYLVNNKLNFEIDTI----------------------------------------
COAD_BORBU      SIKIRAFNDFDIEFERYLVNNKLNFEIDTI----------------------------------------
YCF1_PHAVU      NGREKIYQNLSTFQKMMET--KIDIFTIKKIXXXXXXXXXXXXXXXKRKKLSNE--FITRTKLIDKEL--
RSGA_MYCGE      NLKILAAQHFVGFQKMI---SKCHFSNC------------------------------------------
Y2628_BORBU     NTEISIDENGNIIPVIKNTNGQINYNLIPFKKFESYKVRFDLIPENKNI---NFKELINVYYLDEKNITP
SCPA_MYCGE      NSKLTVFNNYQQL--LVDNNDLIIFATTLVQLFDNEIDQLIVINPTS----KSKDQFNCNWN--------
RSMC_BUCCC      NSKNVIFNNFNHKNKLFLTKNKKEFK---------LHLTFLLSHISKTCVIYVVGEKKCGINSISKIFSN


                         +         .         .         .         .         *         .:210
query           YKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFRNLSLKKFRNISVKDALKHPNWSMGKKITID
DXR_PELUB       YKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFRNLSLKKFRNISVKDALKHPNWSMGKKITID
DXR_SULSY       ----ILPIDSEHSAIFQILKDSNQKEVRRIILTASGGPFVNMPAEDFENITVKQALIHPRWSMGKKITID
DXR_CLOK5       NKVKIFPVDSEHSAIFQCIKGNNFQDIEKLYLTASGGPFRGRTREQLFNVTVKEALNHPSWRMGKKLTID
DXR_CLOK1       NKVKIFPVDSEHSAIFQCIKGNNFQDIEKLYLTASGGPFRGRTREQLFNVTVKEALNHPSWRMGKKLTID
DXR_CLONN       NNVKILPVDSEHGAIFQCLQGNSYKDIETIYVTASGGPFRQSKLEELINITPEQALKHPKWNMGKKISID
DXR_CLOBB       NNVKILPVDSEHSAIYQSLRGNDLKTLNKIILTASGGPFRGKKLCDLNDIGVDDALNHPKWNMGRKISID
DXR_CLOAB       YGVNILPVDSEHGAIFQCLQGNKYKDINKILLTASGGPFRGKSFDELNNVTLNDALNHPKWTMGRKITID
DXR_CLOD6       YNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFRGKKKGELVNITKNEALKHPNWSMGRKISID
DXR_CLOB8       NNVKIFPVDSEHSAIFQCLRGNDINTLRKIILTASGGPFRGRTLESLEDIKVEDALKHPKWNMGRKISID
DXR_CLOPE       NGVKILPVDSEHSAIFQSLQGNAHNKIDKILLTASGGPFRGFTIEDLKSVTPERALKHPKWNMGQKISID
DXR_BACV8       YHTPVLPVDSEHSAIFQCLEIN--NRLEKVILTASGGPFRTYTMEQLQTVTKAQALKHPNWEMGAKITID
DXR_CLOP1       NGVKILPVDSEHSAIFQSLQGNAHNKIDKILLTASGGPFRGFTIEDLKSVTPERALKHPKWNMGQKISID
DXR_CLOBA       NNVKILPVDSEHSAIYQSLRGNDLKTLNKIILTASGGPFRGKKICDLNDISVDDALNHPKWNMGRKISID
DXR_CLOPS       NGVKILAVDSEHSAIFQSLQGNAHNKIDKILLTASGGPFRGFTIKDLKSVTPERALKHPKWNMGQKISID
DXR_WOLWR       XNVQIIPIDSEHNAIFQILQNDDKC-VEKIILTASGGPFLNYSLEQLRNIMVDQALSHPTWNMGKKISVD
DXR_CLOB6       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGRKKEELIDIKPEHALKHPKWNMGRKISID
DXR_WOLPM       XNVQIIPIDSEHNAIFQILQNDDKC-VEKIILTASGGPFLNYSLEQLRNVMVDKALSHPTWNMGKKISVD
DXR_CLOTE       NKVNILPVDSEHGAIFQCLLGNLKGDINKIHLTASGGPFRGKKREELENVTVEQALKHPNWNMGKKISID
DXR_ANAPZ       SGTRIVPVDSEHNAVFRLLSQG--DNPYKITITASGGPFLHWSHDQLKSVTIEDALVHPVWKMGKKISVD
DXR_EHRCJ       KDVKIIPLDSEHNAIYQILADKGHKDLEKITLTASGGPLLSMDYEQMKYVTVQDTVKHPVWKMGKKISVD
DXR_BACTN       YHTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASGGPFRTCTLEQLKSVTKTQALKHPNWEMGAKITID
DXR_THEPX       KDISLLPVDSEHSAILQCLRGNDKKEVSRLILTASGGPFRGKKKEDLRKVTVNEALNHPNWKMGKKITID
DXR_CLOBM       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGKKKEELIDVKPEHALKHPKWNMGRKISID
DXR_BACFN       YRTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASGGPFRTCTMEQLKTVTKVQALKHPNWEMGAKITID
DXR_WOLTR       KNVQIVPIDSEHNAIFQVLQNGNKC-VEKIILTASGGSFLNYSLEQLRNVTVGQALSHPTWNMGKKISVD
DXR_PELPB       HNVHLLPVDSEHSAIFQSLAGHRAEDVERIILTASGGPFRNTSAEELKNVTLEQALKHPQWTMGAKITID
DXR_CLOBL       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGKKKEELIDVKPEHALKHPKWNMGRKISID
DXR_CLOBK       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGKKKEELIEVKPEHALKHPKWNMGRKISID
DXR_CLOBJ       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGKKKEELIDVKPEHALKHPKWNMGRKISID
DXR_BACFR       YRTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASGGPFRTCTMEQLKTVTKVQALKHPNWEMGAKITID
DXR_THEP3       KDITLLPVDSEHSAILQCLRGNDKKEVSRLILTASGGPFRGKKKEDLRKVTVNEALNHPNWKMGKKITID
DXR_CLOPH       HNVNLLPVDSEHSAIFQCLQGNESSTVSRIILTASGGPFRGKSLAELKNVKVEDALKHPNWSMGRKITID
DXR_FUSNN       YKAEIVPVDSEHSALFQSLQGFKKENLKKLIITASGGTFRGKDLAYLENVTVEQALKHPNWSMGKKITID
DXR_CLOBH       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGKKKEELIDVKPEHALKHPKWNMGRKISID
DXR_CLOB1       HNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPFRGKKKEELIDVKPEHALKHPKWNMGRKISID
DXR_BREBN       KGVSIIPVDSEHSAVYQCLQGERMEDVAKIILTASGGSFRHLSREDLEQVTVEQALAHPNWSMGAKITID
DXR_PERMH       YSDIF-PIDSEHSAIFQCLLSGRKEEVEKIILTASGGPFLNLPKEEFRYITPDQALNHPRWKMGKKVSID
DXR_CLOTH       MGVKILPVDSEHSAVFQSLMGNNKKDVAKIILTASGGPFRGRKKEELRNVTLREALNHPNWSMGSKITID
DXR_EUBR3       YGVSILPVDSEHSAIFQSLQGNSMNPIKKILLTASGGPFRGRKLSELEGIRVEDALKHPNWSMGQKITID
DXR_THEYD       SGAKIIPVDSEHSAVFQCINGCNKPYIKKIWLTASGGPFRGKKSYEIENVTPQEALNHPKWKMGKRITID
DXR_THETN       KKIEFLPVDSEHSAILQCLKGNNKREVSNLILTASGGPFRGKKKKDLVNVTVEEALKHPNWKMGKKITID
DXR_PELTS       HRAAILPVDSEHSAVWQCLCGRNSGEVEKIILTASGGPFREMCLEKLEKVTVDMALKHPNWNMGSKITID
DXR_HALOH       -EGRVLPVDSEHNAIFQLLNGHNDKEVERLILTASGGPFLELPRERFKDVSVKDALKHPNWDMGGKITID
DXR_EHRRG       KNVNIIPVDSEHNAIFQILHSNDRENIDKITITGSGGALLYMDHDQMRNITVQETIKHPVWKMGKKISID
DXR_EHRCR       KNVNIVPVDSEHNAIYQILSSSKKN-LEKITLTASGGPLLSMDYDQIKNVTVQDTVKHPIWKMGKKISVD
DXR_THEP1       KRTELIPVDSEHSAIFQVIEPE----VEKVVLTASGGALRDWEISKIDRARPEDVLRHPVWNMGARITVD
DXR_EHRRW       KNVNVIPVDSEHNAIFQILHSNDRENIDKITITGSGGALLYMDYDQMRNITVQETIKHPVWKMGKKISVD
DXR_ALKOO       HKVQIIPVDSEHSAIFQCLQGEDIHNISRIILTASGGAFRNWEKQDIQHAKAQDALKHPTWNMGSKVTID
DXR_THEMA       KGTELIPVDSEHSAIFQVMEPE----VEKVVLTASGGALRDWKISKIDRARPEDVLKHPVWNMGARITVD
DXR_CHLT3       HGCKMLPVDSEHSAIFQCLVGEAPEFVGKIILTASGGPFRTWEKSRFEQITVADALNHPNWKMGSKITID
DXR_WOLPP       RSVQIIPIDSEHNAIFQVLQNDDKC-VEKIILTASGGPFLNYSLEQLRNITVNQALSHPTWKMGKKISVD
DXR_VESOH       FNAELIPVDSEHSAIFQCLKSGK-SGLNKIQLTASGGPFLHTPISQFKSITPDEACAHPNWSMGRKISVD
DXR_EUBE2       CNVNIYPVDSEHSAIFQCLNGERRGEIEKILLTASGGPFRGKKRADLENVQLEDALKHPNWAMGRKITID
DXR_LISMF       KNISLLPVDSEHSAILQALNGENTERIEKLVLTASGGSFRDKTREQLSEVTVKEALKHPNWNMGNKLTID
DXR_LISMC       KNISLLPVDSEHSAILQALNGENTERIEKLVLTASGGSFRDKTREQLSEVTVKEALKHPNWNMGNKLTID
DXR_THENN       KSVELIPVDSEHSAIFQVIEPD----VQKIVLTASGGALRDWDLEKIETATPNDVLKHPVWSMGARITVD
DXR_PORGI       NQVPILPVDSEHSAIFQALLGERQRP-EKILLTASGGPFLHLTAEELQHATREQALRHPNWNMGAKVTID
DXR_PORG3       NQVPILPVDSEHSAIFQALLGERQRP-EKILLTASGGPFLHLTAEELQHATREQALRHPNWNMGAKVTID
DXR_BACHD       HGVKLLPVDSEHSAIFQALQGERMDRLHRIIITASGGSFRDKSRDELNGVTVEDALKHPNWSMGAKITID
DXR_LISMO       KNISLLPVDSEHSAILQALNGENTERIEKIILTASGGSFRDKTREQLSAVTVKEALKHPNWNMGNKLTID
DXR_LISMH       KNISLLPVDSEHSAILQALNGENTERIEKIVLTASGGSFRDKTREQLSLVTVKEALKHPNWNMGNKLTID
DXR_BACSU       YDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRDKTREELESVTVEDALKHPNWSMGAKITID
DXR_SHIFL       SKAQLLPVDSEHNAIFQSLPQPEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVD
DXR_FRATH       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_FRATF       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_ECOLI       SKAQLLPVDSEHNAIFQSLPQPEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVD
DXR_ECO57       SKAQLLPVDSEHNAIFQSLPQPEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVD
DXR_LISIN       KNISLLPVDSEHSAILQALNGENRERIEKIILTASGGSFRDKTREQLSEVTVKEALKHPNWNMGNKLTID
DXR_FRATN       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_CHLMU       NHVQILPIDSEHNALFQCLEGRDPSTIKKLILTASGGPLRNKSKEELQKVTLQEVLKHPIWDMGPKITVD
DXR_FRATW       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_FRATT       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_FRATM       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_FRAT1       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_DESHD       LGRTILPVDSEHSAIFQCLEEDPRT-LDKIILTASGGPFRGWSEEQLREVTPERALQHPNWAMGAKITID
DXR_PHOLL       HNAQLLPIDSEHNAIFQSLPEVIQRNLGRIILTGSGGPFRHTPLEQLAFVTPDQACAHPNWSMGRKISVD
DXR_BACA2       YGVPLLPVDSEHSAIFQALQGEQCKNIERLVITASGGSFRDKTRQELESVTIADALNHPNWSMGAKITID
DXR_CAMJJ       --AKFLPVDSEHAALKFLLEGKK--NIAKLYITASGGAFYKYKIKDLNQVSLKDALKHPNWNMGAKITID
DXR_CAMJE       --AKFLPVDSEHAALKFLLEGKK--NIAKLYITASGGAFYRYKIKDLNQVSVKDALKHPNWNMGAKITID
DXR_CAMJ8       --VKFLPVDSEHAALKFLLEGKK--NIAKLYITASGGAFYRYKIKDLNQVSVKDALKHPNWNMGAKITID
DXR_CYAP7       HGVKLLPADSEHSAIFQCLQGVPEKGLRKILLTASGGSFRDLPVEKLSTVTVQDALKHPNWSMGRKITID
DXR_ZYMMO       HGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQHPNWSMGAKISID
DXR_PROMH       YGAKVLPIDSEHNAIYQSLPTGIQDNLTSILLTGSGGPFRYTPLDELDAMTPDQACAHPNWSMGRKISVD
DXR_MICAN       HRVKLLPADSEHSAIFQCLQGVPTGGLKKIILTASGGAFRDLPVEKLPQVTVADALKHPNWSMGRKITID
DXR_DESHY       LGRTILPVDSEHSAIFQCLEEDPRT-LDKIILTASGGPFRGWSEEQLQEVTPERALQHPNWAMGAKITID
DXR_CAMJR       --AKFLPVDSEHAALKFLLEGKK--NIAKLYITASGGAFYKYKIKDLNQVSLKDALKHPNWNMGAKITID
DXR_FRATO       NNAQLIPVDSEHNAIFQCIDNHDKKEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVD
DXR_LISW6       KNISLLPVDSEHSAILQALNGENPERIEKLVLTASGGSFRDKTRGELSEVTVKEALKHPNWNMGNKLTID
DXR_PROM5       NKSRLLPADSEHSAIFQCIQGLPNNGLKAIHLTASGGAFRDWAVEDLKNVTVEDATSHPNWSMGRKITVD
DXR_TREDE       SGSTIIPVDSEHAAIFQLINAHKKGNIEKIIITASGGPFLNTPREKLSTIKLEDALKHPTWKMGGKISID
DXR_PSYIN       SGAKLWPVDSEHNAIYQALSPKLQNTISKILLTGSGGPFLEKPLAEFAAITPAQAVKHPNWSMGKKISID
DXR_TOLAT       YSARILPVDSEHNAIFQCLPAEAQSGVDKILLTGSGGPFRYTSLSQLSSVTPEQAVAHPNWSMGRKISVD
DXR_MANSM       TKARLLPVDSEHNAIFQSLPPEKELGINKIVLTGSGGPFRYTDLTEFDNITPEQAVAHPNWSMGKKISVD
DXR_CARHZ       LGENLLPVDSEHSAIFQALRGEKLAWVKKLLITASGGPFREYTLEQLKNVTVAEALKHPRWKMGNKITID
DXR_NAUPA       ----ITPIDSEHFGLWYLLIESEKCNVKKLYITASGGALRDWSLEDIKKATLKDVLKHPNWSMGVKITID
DXR_GEOSF       RGVKLYPVDSEHSAVFQSLQGHRKEDVRRIILTASGGPFLNLSGEKLAQVTVKDALNHPNWSMGQKITID
DXR_CAMJD       --AKFLPIDSEHVALKFLLEGKK--NIAKLYITASGGAFYKYKIKDLNQVSVKDALKHPNWNMGAKITID
DXR_FERNB       NNVEIVPVDSEHSAIFQIYEPH----IDHIVITASGGAVRDLPLDKIAGLTPEEVLKHPTWNMGGRITVD
DXR_BACP2       YDVPLLPVDSEHSAIFQCLQGEQAKNIERLIVTASGGSFRDKKRTELEGVTVEEALNHPNWSMGAKITID
DXR_SHEWM       SGAQVLPVDSEHNAIFQALPEPVQQEISHILLTGSGGPFLTSPLSSLPQMTPAQACKHPNWSMGRKISVD
DXR_SALTY       SNARLLPVDSEHNAIFQSLPQSEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVD
DXR_SALTI       SNARLLPVDSEHNAIFQSLPQSEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVD
DXR_SALPA       SNARLLPVDSEHNAIFQSLPQSEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVD
DXR_SALCH       SNARLLPVDSEHNAIFQSLPQSEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKVSVD
DXR_CAMLR       IKA----IDSEHAALKCLID--KRKDIKKLFITASGGAFYKYKIKDLKNVSVKEALKHPNWSMGAKITID
DXR_AQUAE       V----IPVDSEHNALFQLLSSVKREEVKHVYLTASGGPFKDKSLEELKTASVEEALRHPRWNMGAKITID
DXR_MACCJ       YNVNIIPVDSEHSAIFQCLNGEDHKHIEKLIITASGGSFRELSREALKDVTVQDALKHPNWSMGKKITID
DXR_GEOSW       HGVSLLPVDSEHSAIFQCLQGEKRNRVEKIILTASGGSFRDKTREELKNVTVEEALRHPNWSMGAKITID
DXR_ACAM1       HGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGGAFRDWPVEKLPEVTVADALKHPNWSMGKKITVD
DXR_ANAVT       HGVKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFRDWDVERLAEVTVADALKHPNWSMGRKITVD
DXR_ALISL       YGAELLPVDSEHNAIFQCLPESIQRKLGRILLTGSGGPFRYTDISELVSVTPEMAIAHPNWSMGPKISVD
DXR_ACTP2       SGAQLLPVDSEHNAIFQSLDAQQKVGFSKIILTGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISVD
DXR_RUTMC       FNAELIPVDSEHSAIFQCLQSGR-SGLNKIQLTASGGPFLHTPISKFKYITPNQACAHPNWSMGRKISVD
DXR_CHLTR       NGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNKSKEELQKVSLQEVLRHPVWNMGPKITVD
DXR_CHLTA       NGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNKSKEELQKVSLQEVLRHPVWNMGPKITVD
DXR2_BACHK      HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR_EXISA       HGVNLLPVDSEHSAIYQCLNGERREDVSKIILTASGGSFRDRSRDELADVTVEDALNHPNWSMGAKITID
DXR_BACLD       YDVPLLPVDSEHSAIFQALQGENPKHIKRLIVTASGGSFRDRTRRELEGVTVEEALNHPNWSMGAKITID
DXR_ANASP       HGVKLLPADSEHSAIFQCLQGVPKGGLKKILLTASGGAFRDWDVERLAEVTVSDALKHPNWSMGRKITVD
DXR_CHLTB       NGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNKSKEELQKVSLQEVLRHPVWNMGPKITVD
DXR_CHLT2       NGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNKSKEELQKVSLQEVLRHPVWNMGPKITVD
DXR_CHLCV       YQTRILPIDSEHNALYQCLEGKNTSEVKKLVLTASGGPLLYKSKEDLSRVTIRDVLKHPIWNMGAKITVD
DXR_YERPY       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERPP       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERPN       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERPG       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERPE       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERPA       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERP3       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_VIBFM       YGAELLPVDSEHNAIFQCLPQSIQTNLGRILLTGSGGPFRYTDVSELEAVTPEMAIAHPNWSMGPKISVD
DXR_PELPD       HGVKLYPVDSEHSAIFQSLEGHRSDDISKIILTASGGPFLNTSLEQLAGVTVGDALNHPNWSMGRKITID
DXR_CYAP8       HGVKLLPADSEHSAIFQCLQGVPKGGLRRIILTASGGAFRDWPVEQLKFVTVEDAIKHPNWSMGRKITVD
DXR_ACTPJ       SGAQLLPVDSEHNAIFQSLEAQQKVGFSKIILTGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISVD
DXR_YERPS       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_YERPB       SRAQLLPIDSEHNAIFQSLPERNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVD
DXR_CYAA5       HGVKLLPADSEHSAIFQCLQGVPDGGLRRIILTASGGAFRDWPVEQLKYVTVQDALKHPNWSMGQKITVD
DXR2_BACCR      HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR_MENPI       HNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVD
DXR_BACC7       HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR_BACC3       HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR_BACC1       HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR2_BACCZ      HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR2_BACAN      HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR_SHEFN       SGATVLPVDSEHNAIFQCLPTNVQNGISHILLTGSGGPFLNTDLATLSAMTPAQACNHPNWSMGPKISVD
DXR_NOSP7       HGVKLLPADSEHSAIFQCLQGVPKSGLRKILLTASGGAFRDWDVERLADVTVADALKHPNWSMGRKITVD
DXR_VIBF1       YGAELLPVDSEHNAIFQCLPQSIQTNLGRILLTGSGGPFRYTDVSELEAVTPEMAIAHPNWSMGPKISVD
DXR_MYCPE       SSSSRIPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISID
DXR_HAEPS       SGAKLLPVDSEHNAIFQSLEAQEKVGFSKIILTGSGGPFCTKPLNEFSQITPAQAVAHPNWSMGKKISVD
DXR_BACCQ       HNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITID
DXR_PROMP       SKSRLLPADSEHSAIFQCIQGLPNNGLKAIHLTASGGAFRDWEVEDLKNVTVEDATSHPNWSMGRKITVD
DXR_PROM9       NNSRLLPADSEHSAIFQCLQGNYENGLKAIHLTASGGAFRDWPVENLKHVTVEDATSHPNWDMGKKITVD
DXR_DESRM       YKVEILPVDSEHSAIWQCLHGENRSAIRKIQLTASGGPFRQLNRQELENVTPEMALKHPNWSMGQKITID
DXR_NITWN       AGACVLPADSEHNALFQALSSGNRDELTRVIITASGGPFRTWAAADIENATLAQALKHPNWSMGRKITID
DXR_HAEI8       YGSKLLPVDSEHNAIFQSLEAQEKIGFSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVD
DXR_GEOUR       HGVKLYPVDSEHSAVFQSLQGHRMEDVKQIILTASGGPFFTWPAEKLAQVTVSDALNHPNWSMGQKITID
DXR_MOOTA       LSRQIIPVDSEHSAIFQCL--RQGGRVAEVIITASGGPLRQMPRAEMANVTPEQALNHPTWVMGPKITID
DXR_LEPIN       HNTKVVPVDSEHNALFQLLESLNPNSVEKIILTASGGAFRDLPVEQLSSVTKEQALHHPTWNMGPKITID
DXR_LEPIC       HNTKVVPVDSEHNALFQLLESLNPNSVEKIILTASGGAFRDLPVEQLSSVTKEQALHHPTWNMGPKITID
DXR_ERWCT       SDAQLLPIDSEHNAIFQSLPEQSKHGVERIILTGSGGPFRETPVSALADMTPDQACAHPNWSMGRKISVD
DXR_ANAMM       TGVNIVPVDSEHNAVFQILAHD--GCVARVTLTASGGPFLRWTREQMQAVTPSDALAHPVWKMGRKISVD
DXR_ANAMF       TGVNIVPVDSEHNAVFQILAHD--GCVARVTLTASGGPFLRWTREQMQAVTPSDALAHPVWKMGRKISVD
DXR_ORYSJ       HKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVD
DXR_HELMI       REVTILPVDSEHSAIFQCLQGQDRR-LARLILTASGGPFRDKSLEALHQVTPEDALRHPNWRMGPKITID
DXR_HAEIE       YSAKLLPVDSEHNAIFQSLEAQEKIGFSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVD
DXR_SHESH       SGARVLPVDSEHNAIYQALPESLQSNISHILLTGSGGPFLTSELASLASMTPAQACKHPNWSMGRKISVD
DXR_BLOPB       YRACILPIDSEHNAIFQNLPEICQKSLSRIVLTASGGIFFKTPQKQLTKITPEQACVHPNWSMGRKISVD
DXR_AGRVS       GGGKIIPVDSEHSAIFQCLDENHRDTLERIVLTASGGPFRTFTRQQMADVSVQTARAHPNWSMGLKVSIG
DXR_VIBCM       SGAELMPVDSEHNAIFQCLPTESQHGIDHILLTGSGGPFRYSDLATLDSVTPEQAIAHPNWSMGPKISVD
DXR_VIBCH       SGAELMPVDSEHNAIFQCLPTESQHGIDHILLTGSGGPFRYSDLATLDSVTPEQAIAHPNWSMGPKISVD
DXR_VIBC3       SGAELMPVDSEHNAIFQCLPTESQHGIDHILLTGSGGPFRYSDLATLDSVTPEQAIAHPNWSMGPKISVD
DXR_HAEIN       YGSKLLPVDSEHNAIFQSLEAQEKIGFSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVD
DXR_HAEDU       SGATLLPVDSEHNAIFQSLPAQQKIGFSRIILTGSGGPFREKSLAEFDSITPEQAIAHPNWSMGKKISVD
DXR_NITHX       AGACILPADSEHNALFQALSSGNRDELTRVIITASGGPFRTWAAADIEKATLAQALKHPNWSMGRKITID
DXR_LYSSC       YNATILPVDSEHSAIFQSMNGENPKDIERLIITASGGSFRDKTRDQLKHVTVADALNHPNWSMGAKITID
DXR_CLOCE       NNVKIFPVDSEHSAIYQCLLGNKDKQVEKIILTASGGPFRGKNIKELKNITPAQALKHPNWSMGNKITID
DXR_CHLCH       HKVHLLPVDSEHSAIFQSLAGHRAEDVERIILTASGGPFRKTSAEELKQVTLEQALKHPQWSMGAKITID
DXR_ARATH       HNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVD
DXR_HAEIG       YGAKLLPVDSEHNAIFQSLEAQEKIGFSKIILTGSGGPFRYTPLEQFASITPEQAVAHPNWSMGKKISVD
DXR_CHLFF       YQTEIFPVDSEHNALYQCLEGRNALEVKKLLLTASGGPLLHKTKEELAHVTVQDVLKHPIWHMGAKITVD
DXR_YERE8       SRAQLLPIDSEHNAIFQSLPEKVQNGVSRIILTGSGGPLRETPLVQFADVTPDQACAHPNWSMGRKISVD
DXR_RHOPT       AGAQILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITID
DXR_GLOVI       RGVKLLPVDSEHSAIFQCLQGVPEGALKRILLTASGGAFRDWPVEKLAEATTADALKHPNWVMGAKITVD
DXR_ACIBS       HQALLLPVDSEHNAIFQSLPHNPQLGVSKILLTASGGPFLNHSLEQLVHVTPQKACKHPNWSMGQKISVD
DXR_HELHP       -----TPIDSEHFGLWYLQNNRP---ITKLYITASGGAFRDYPLDKIALATPQEALKHPNWQMGYKITID
DXR_CHLAB       YQTKILPIDSEHNALYQCLEGRDTSEVRKLFLTASGGPLLYKSKEELTRVTIQDVLKHPIWNMGAKITVD
DXR_BRAJA       AGACILPADSEHNALFQALGSGNRDELVRVIITASGGPFRTWKPADIEQATLAQALKHPNWSMGQKITID
DXR_PROVI       NGVELLPVDSEHSAIFQSLLGHRAEDVERIILTASGGPFRNTPLEEMKKAGPEQALKHPQWTMGAKITID
DXR_ACIBC       HQALLLPVDSEHNAIFQSLPHNPQLGVSKILLTASGGPFLNHSLEQLTHVTPQQACKHPNWSMGQKISVD
DXR_ACIBT       HQALLLPVDSEHNAIFQSLPHNPQLGVSKILLTASGGPFLNHSLEQLTHVTPQQACKHPNWSMGQKISVD
DXR1_BACCZ      NGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTID
DXR_GEOBB       KKVNLYPVDSEHCAVFQSMAGHRSQDIARVILTASGGPFLNWGREKLQAATVADALNHPNWSMGRKITVD
DXR_ACIAD       HQALLLPVDSEHNAIFQSLPSNPQLGVSRILLTASGGPFLDYPLEQLSEVTPQQACKHPNWSMGQKISVD
DXR_WOLSU       ----IIPVDSEHFSLWFLKSDKP---FSRLFITASGGAFRDTPLEEIPLQKAQAALRHPNWSMGRKITVD
DXR_PARUW       KNINLLPIDSEHSAIFQCLNGEALKSVQRIILTSSGGPFRTWTQEQLETVTVEQALNHPTWSMGPKVTID
DXR_ACIBY       HQALLLPVDSEHNAIFQSLPHNPQLGVSKILLTASGGPFLNHSLEQLVHVTPQQACKHPNWSMGQKISVD
DXR_ACIB5       HQALLLPVDSEHNAIFQSLPHNPQLGVSKILLTASGGPFLNHSLEQLVHVTPQQACKHPNWSMGQKISVD
DXR_ACIB3       HQALLLPVDSEHNAIFQSLPHNPQLGVSKILLTASGGPFLNHSLEQLVHVTPQQACKHPNWSMGQKISVD
DXR_RHOPA       AGAQILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITID
DXR_NITMU       NHATLLPIDSEHNAIFQSLPQHFSGDLRRILLTASGGPFRQMPLAALENVTPGQACAHPNWVMGQKISVD
DXR_DESPS       KGVALLPVDSEHSAIFQALHAGKRADLAKIILTASGGPFHGRTAAELAQVTPAQALAHPNWSMGRKVSID
DXR_BRASO       AGACILPADSEHNALFQALSSGNREELVRVIITASGGPFRTWAPQDIEQATLEQALKHPNWSMGQKITID
DXR_RHOPS       AGARILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITID
DXR_RHOP2       AGSCILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWSAADIEQATLAQALKHPNWSMGQKITID
DXR1_BACAN      NGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTID
DXR_GEOSM       KKVKLYPVDSEHCAVFQSMAGHRSQDIARVILTASGGPFLNWGREQLQGATVADALNHPNWSMGRKITVD
DXR1_BACHK      NGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTID
DXR_LAWIP       SGAVILPVDSEHNAIFQALYTRNPKTVQNIILTASGGPFRNKKYEFLKNVTPEQAINHPNWKMGTKISVD
DXR_CAMHC       IRA----IDSEHFGLKFLLENSAKP--AKMIITASGGAFYKTPIKDLSSKKAADALKHPNWNMGAKITID
DXR_RHIEC       GGGRLLPVDSEHNAIFQVLEENQRHAIERVILTASGGPFRNASLEEMKHVTAETARAHPNWSMGLKISID
DXR_GLUOX       AGATLLPVDSEHNAIAQSLGGCDMESVEKIILTASGGPFRKSSIEEMRAATPEKALKHPTWTMGAKITID
DXR_COLP3       SGAELLPIDSEHNAIFQCLPSQQQNGISKILLTGSGGPFRTRAIDTLESVTPSQACAHPNWDMGRKISVD
DXR_PROA2       HKVQLLPVDSEHSAIFQSLSGHRTEDIERIILTASGGPFRKTPAEELKLVKPEQALKHPQWSMGAKITID
DXR_NEIMA       NGAAVLPVDSEHNAVFQVLPRDNEHGIASIILTASGGPFLTADLNTFDSITPDQAVKHPNWRMGRKISVD
DXR_GEOMG       NGVRLYPVDSEHSAVFQSLEGQSGKDVKRIILTASGGPFLNLPLDRLSRVSVADALNHPNWSMGQKITID
DXR_ERWT9       SKAQLLPIDSEHNAIFQSLPASENNGIESIILTGSGGPFRDTPLVELPHMTPDQACAHPNWSMGRKISVD
DXR_DESAP       RGVQILPVDSEHSAVWQCTAY-RRTEVTGVVLTASGGPFRRFSREELERVRPEDALRHPTWRMGPKITVD
DXR1_BACCR      NGCRLIPVDSEHSAIFQCLKGENNKEIEKLIVTASGGAFRDKTRDEMQTLQAKDALKHPNWLMGAKLTID
DXR_THEEB       YGVKLLPADSEHSAIFQCLQGVPEGGLRKIILTASGGAFRDWPVEKLAQVTVADALKHPNWSMGPKITVD
DXR_SHEPW       SGATVLPVDSEHNAIFQCLSERTQLEIGRILLTGSGGPFLNSELSTLSSMTPAQACKHPNWSMGQKISVD
DXR_SHEPA       SGAQVLPVDSEHNAIFQCLSERSQLEIGRILLTGSGGPFLTSDLSSLVNMTPDQACKHPNWSMGRKISVD
DXR_PROMA       SGSRLLPADSEHSAIFQCLQGTPTPGLRNIQLTASGGAFRDWATEDLKHASIKDATSHPNWSMGKKITVD
DXR_NEIG1       NGAAVLPVDSEHNAIFQVLDRLNEHGIDSIILTASGGPFLTTDLSTFDSITPEQAVKHPNWRMGRKISVD
DXR_GEOSL       KNVRLYPVDSEHSAVFQSMEGQSRKDVLRIILTASGGPFLNLPLDQLSRVSIDDALNHPNWSMGRKITID
DXR_PECCP       SGAQLLPIDSEHNAIFQSLPEQSQNGVERIILTGSGGPFRETAVSALADMTPDQACAHPNWSMGRKISVD
DXR_NITEC       YHATLLPIDSEHNAIFQSLPQHYNGDLRRILLTASGGPFHKADLQTLSTVTPEQACAHPNWVMGRKISVD
DXR_NEIMB       NGAAVLPVDSEHNAVFQVLPRDNEHGIASIILTASGGPFLTADLNTFDRITPAQAVKHPNWRMGRKISVD
DXR_SYNSC       SGSRLLPADSEHSAIFQCLQGTPTPGLRRIQLTASGGAFRDWTAADLEKATVADATSHPNWSMGRKITVD
DXR_CHLPD       HKVTIIPVDSEHSAIYQSLLGHRHEDVLRLILTASGGPFLNTSAEELREVTLEQALKHPKWTMGAKITID
DXR_THELT       CETNLIPVDSEHTALMQIYEEP----FEEVIITSSGGALRDWELHNLHNAKPKDVLKHPVWKMGERITVD
DXR_EXIS2       KGVAILPVDSEHAAIFQCLNGERRQDVRQIILTASGGSFRDQTREQLANVTVEQALNHPNWSMGAKITID
DXR_BUCAI       SGAKIIPIDSEHNAIFQVLPLEEKNSIKHLVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVD
DXR_BRASB       AGACILPADSEHNALFQALSSGNREELVRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITID
DXR_NITEU       HHATLLPIDSEHNAIFQSLPQHFNGDLRRILLTASGGPFRTVDLKILETVTPEQACAHPNWVMGRKISVD
DXR_CHLPB       HKVTLLPVDSEHSAIFQSLSGHRKEDIERIILTASGGPFRHTSAEDLRHVGPEKALKHPQWTMGAKITID
DXR_CAMFF       IN----PIDSEHFGLKFLLKNRPA--VKKMIITASGGAFYDMHINELEFVTAKSALKHPNWSMGAKITID
DXR_BACSK       NDVPLIPVDSEHSAIFQALNGEPKKAVDRLILTASGGSFRDKSRAELDGVTVEQALAHPNWSMGAKVTID
DXR_RHIE6       GGGRLLPVDSEHNAIFQVLEENQRHAVERVVLTASGGPFRTASLKEMADVTVETARAHPNWSMGLKISID
DXR_VIBVY       SGAQLLPVDSEHNAIFQCLPQAVQGNLGRILLTGSGGPFRYTDVAELEAVTPEQAIAHPNWSMGPKISVD
DXR_OLICO       NNATVLPVDSEHNAIFQSLGAGRREDLVRIILTASGGPFRTATREQIENATVEQALKHPNWSMGRKITID
DXR_GEOKA       RGVPLLPVDSEHSAIFQCLQGERMEHVDKLILTASGGSFRDKTRRELAHVTVEEALCHPNWSMGAKITID
DXR_BUCAT       SGAKIIPIDSEHNAIFQVLPLEEKNSIKHLVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVD
DXR_BUCA5       SGAKIIPIDSEHNAIFQVLPLEEKNSIKHLVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVD
DXR_VIBHB       HGAELLPVDSEHNAIFQCLPQQVQTSLGRCNLEEHXXPFRYTDIAELEKVTPAQAIAHP