[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21732.1

[Show Plain Result]


## Summary of Sequence Search
    1::378
    1::357     2e-52  34%  381 aa  LPXB_RICBR RecName: Full=Lipid-A-disaccharide synthase;       
    1::357     2e-52  34%  381 aa  LPXB_RICB8 RecName: Full=Lipid-A-disaccharide synthase;       
   31::397     5e-49  29%  415 aa  LPXB_GLUOX RecName: Full=Lipid-A-disaccharide synthase;       
    1::357     2e-48  33%  380 aa  LPXB_RICTY RecName: Full=Lipid-A-disaccharide synthase;       
    1::356     5e-48  34%  385 aa  LPXB_RICCK RecName: Full=Lipid-A-disaccharide synthase;       
    1::356     7e-48  31%  390 aa  LPXB_RICFE RecName: Full=Lipid-A-disaccharide synthase;       
    1::370     4e-47  31%  446 aa  LPXB_RICCN RecName: Full=Lipid-A-disaccharide synthase;       
   16::346     1e-46  31%  393 aa  LPXB_COLP3 RecName: Full=Lipid-A-disaccharide synthase;       
    6::354     2e-46  31%  401 aa  LPXB_RHOCS RecName: Full=Lipid-A-disaccharide synthase;       
    4::339     9e-46  32%  376 aa  LPXB_COXBU RecName: Full=Lipid-A-disaccharide synthase;       
    4::339     9e-46  32%  376 aa  LPXB_COXBR RecName: Full=Lipid-A-disaccharide synthase;       
   13::362     2e-45  31%  396 aa  LPXB_ACIAD RecName: Full=Lipid-A-disaccharide synthase;       
    1::357     3e-45  35%  380 aa  LPXB_RICPR RecName: Full=Lipid-A-disaccharide synthase;       
    1::360     6e-45  34%  388 aa  LPXB_SULSY RecName: Full=Lipid-A-disaccharide synthase;       
    6::347     1e-44  29%  388 aa  LPXB_MAGSM RecName: Full=Lipid-A-disaccharide synthase;       
    6::343     2e-44  29%  393 aa  LPXB_GRABC RecName: Full=Lipid-A-disaccharide synthase;       
    1::373     4e-44  30%  379 aa  LPXB_PERMH RecName: Full=Lipid-A-disaccharide synthase;       
    1::356     5e-44  30%  391 aa  LPXB_RICAH RecName: Full=Lipid-A-disaccharide synthase;       
    4::339     5e-44  32%  376 aa  LPXB_COXBN RecName: Full=Lipid-A-disaccharide synthase;       
    4::339     5e-44  32%  376 aa  LPXB_COXB2 RecName: Full=Lipid-A-disaccharide synthase;       
    4::339     6e-44  32%  376 aa  LPXB_COXB1 RecName: Full=Lipid-A-disaccharide synthase;       
    7::377     8e-44  29%  384 aa  LPXB_GEOMG RecName: Full=Lipid-A-disaccharide synthase;       
    8::351     1e-43  27%  384 aa  LPXB_GEOSL RecName: Full=Lipid-A-disaccharide synthase;       
    6::362     9e-43  33%  384 aa  LPXB1_LEGPL RecName: Full=Lipid-A-disaccharide synthase 1;       
    8::355     2e-42  27%  379 aa  LPXB_IDILO RecName: Full=Lipid-A-disaccharide synthase;       
    6::335     1e-41  29%  381 aa  LPXB_PSYIN RecName: Full=Lipid-A-disaccharide synthase;       
    6::362     1e-41  33%  384 aa  LPXB1_LEGPH RecName: Full=Lipid-A-disaccharide synthase 1;       
    6::353     1e-41  27%  379 aa  LPXB_VIBHB RecName: Full=Lipid-A-disaccharide synthase;       
    6::362     2e-41  32%  384 aa  LPXB1_LEGPA RecName: Full=Lipid-A-disaccharide synthase 1;       
   11::342     2e-41  28%  386 aa  LPXB_DESPS RecName: Full=Lipid-A-disaccharide synthase;       
   11::347     4e-41  28%  383 aa  LPXB_SHEHH RecName: Full=Lipid-A-disaccharide synthase;       
   10::339     4e-41  28%  396 aa  LPXB_HAHCH RecName: Full=Lipid-A-disaccharide synthase;       
   10::349     4e-41  28%  383 aa  LPXB_ALCBS RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     6e-41  28%  379 aa  LPXB_VIBPA RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     6e-41  28%  383 aa  LPXB_VIBFM RecName: Full=Lipid-A-disaccharide synthase;       
    6::345     6e-41  28%  379 aa  LPXB_AERHH RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     1e-40  27%  383 aa  LPXB_VIBF1 RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     2e-40  29%  380 aa  LPXB_PHOPR RecName: Full=Lipid-A-disaccharide synthase;       
    6::348     2e-40  29%  382 aa  LPXB_ALTMD RecName: Full=Lipid-A-disaccharide synthase;       
    9::337     2e-40  27%  393 aa  LPXB_ACTP7 RecName: Full=Lipid-A-disaccharide synthase;       
    2::334     5e-40  31%  380 aa  LPXB_FRAP2 RecName: Full=Lipid-A-disaccharide synthase;       
    9::337     7e-40  27%  393 aa  LPXB_ACTPJ RecName: Full=Lipid-A-disaccharide synthase;       
   15::355     9e-40  27%  397 aa  LPXB_MANSM RecName: Full=Lipid-A-disaccharide synthase;       
    1::355     1e-39  26%  376 aa  LPXB_THICR RecName: Full=Lipid-A-disaccharide synthase;       
   11::347     1e-39  28%  383 aa  LPXB_SHEPA RecName: Full=Lipid-A-disaccharide synthase;       
    8::348     1e-39  26%  390 aa  LPXB_HAEI8 RecName: Full=Lipid-A-disaccharide synthase;       
    9::337     1e-39  26%  393 aa  LPXB_ACTP2 RecName: Full=Lipid-A-disaccharide synthase;       
    9::349     3e-39  25%  389 aa  LPXB_HAES1 RecName: Full=Lipid-A-disaccharide synthase;       
    8::354     3e-39  26%  387 aa  LPXB_HAEPS RecName: Full=Lipid-A-disaccharide synthase;       
    8::364     4e-39  28%  385 aa  LPXB2_LEGPA RecName: Full=Lipid-A-disaccharide synthase 2;       
    7::354     5e-39  27%  380 aa  LPXB_VIBVY RecName: Full=Lipid-A-disaccharide synthase;       
    7::354     5e-39  27%  380 aa  LPXB_VIBVU RecName: Full=Lipid-A-disaccharide synthase;       
    8::348     5e-39  26%  390 aa  LPXB_HAEIG RecName: Full=Lipid-A-disaccharide synthase;       
    6::342     6e-39  28%  382 aa  LPXB_SHELP RecName: Full=Lipid-A-disaccharide synthase;       
    9::349     6e-39  25%  389 aa  LPXB_HAES2 RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     6e-39  27%  383 aa  LPXB_ALISL RecName: Full=Lipid-A-disaccharide synthase;       
    8::348     8e-39  26%  390 aa  LPXB_HAEIN RecName: Full=Lipid-A-disaccharide synthase;       
    4::355     1e-38  27%  388 aa  LPXB_SACD2 RecName: Full=Lipid-A-disaccharide synthase;       
    8::348     1e-38  26%  390 aa  LPXB_HAEIE RecName: Full=Lipid-A-disaccharide synthase;       
    8::336     1e-38  26%  390 aa  LPXB_HAEDU RecName: Full=Lipid-A-disaccharide synthase;       
    8::364     2e-38  28%  385 aa  LPXB2_LEGPH RecName: Full=Lipid-A-disaccharide synthase 2;       
   11::341     3e-38  26%  385 aa  LPXB_SHESM RecName: Full=Lipid-A-disaccharide synthase;       
   11::341     5e-38  26%  385 aa  LPXB_SHESR RecName: Full=Lipid-A-disaccharide synthase;       
   11::341     5e-38  26%  385 aa  LPXB_SHESA RecName: Full=Lipid-A-disaccharide synthase;       
    9::348     9e-38  27%  385 aa  LPXB_PSEHT RecName: Full=Lipid-A-disaccharide synthase;       
    9::359     1e-37  26%  396 aa  LPXB_RHOPB RecName: Full=Lipid-A-disaccharide synthase;       
  230::586     1e-37  29%  626 aa  LPXB_CHLCV RecName: Full=Lipid-A-disaccharide synthase;       
   11::342     1e-37  26%  392 aa  LPXB_SHEB2 RecName: Full=Lipid-A-disaccharide synthase;       
   11::341     1e-37  25%  393 aa  LPXB_SHEAM RecName: Full=Lipid-A-disaccharide synthase;       
   11::341     3e-37  26%  385 aa  LPXB_SHEON RecName: Full=Lipid-A-disaccharide synthase;       
   11::342     4e-37  28%  380 aa  LPXB_SHESH RecName: Full=Lipid-A-disaccharide synthase;       
   11::351     4e-37  25%  392 aa  LPXB_PASMU RecName: Full=Lipid-A-disaccharide synthase;       
    9::344     4e-37  26%  384 aa  LPXB_BLOFL RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     6e-37  26%  379 aa  LPXB_VIBCM RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     6e-37  26%  379 aa  LPXB_VIBCH RecName: Full=Lipid-A-disaccharide synthase;       
    6::353     6e-37  26%  379 aa  LPXB_VIBC3 RecName: Full=Lipid-A-disaccharide synthase;       
    1::357     7e-37  27%  381 aa  LPXB_SOLUE RecName: Full=Lipid-A-disaccharide synthase;       
    6::337     1e-36  27%  383 aa  LPXB_MYXXD RecName: Full=Lipid-A-disaccharide synthase;       
    3::342     1e-36  27%  390 aa  LPXB_MAGSA RecName: Full=Lipid-A-disaccharide synthase;       
  225::578     1e-36  29%  604 aa  LPXB_CHLPN RecName: Full=Lipid-A-disaccharide synthase;       
   11::341     1e-36  27%  384 aa  LPXB_SHEWM RecName: Full=Lipid-A-disaccharide synthase;       
   11::342     1e-36  26%  384 aa  LPXB_SHESW RecName: Full=Lipid-A-disaccharide synthase;       
   11::342     1e-36  26%  384 aa  LPXB_SHEPC RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATW RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATT RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATO RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATN RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATM RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATH RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRATF RecName: Full=Lipid-A-disaccharide synthase;       
    2::362     1e-36  28%  380 aa  LPXB_FRAT1 RecName: Full=Lipid-A-disaccharide synthase;       
    6::356     2e-36  29%  375 aa  LPXB_PSEPK RecName: Full=Lipid-A-disaccharide synthase;       
   15::357     2e-36  26%  389 aa  LPXB_PHOLL RecName: Full=Lipid-A-disaccharide synthase;       
   11::360     2e-36  28%  396 aa  LPXB_NITWN RecName: Full=Lipid-A-disaccharide synthase;       
    9::352     2e-36  26%  384 aa  LPXB_NEIMA RecName: Full=Lipid-A-disaccharide synthase;       
   11::361     2e-36  28%  393 aa  LPXB_RHOP2 RecName: Full=Lipid-A-disaccharide synthase;       
  230::585     3e-36  29%  625 aa  LPXB_CHLFF RecName: Full=Lipid-A-disaccharide synthase;       
   16::340     3e-36  29%  387 aa  LPXB_BLOPB RecName: Full=Lipid-A-disaccharide synthase;       
    1::347     4e-36  24%  378 aa  LPXB_METFK RecName: Full=Lipid-A-disaccharide synthase;       
    7::347     4e-36  31%  383 aa  LPXB_GEOLS RecName: Full=Lipid-A-disaccharide synthase;       
    6::356     5e-36  29%  375 aa  LPXB_PSEP1 RecName: Full=Lipid-A-disaccharide synthase;       
    6::339     6e-36  27%  385 aa  LPXB_WIGBR RecName: Full=Lipid-A-disaccharide synthase;       
   11::366     8e-36  25%  393 aa  LPXB_RHOPA RecName: Full=Lipid-A-disaccharide synthase;       
   46::392     1e-35  27%  439 aa  LPXB_XANAC RecName: Full=Lipid-A-disaccharide synthase;       
   11::360     1e-35  28%  396 aa  LPXB_NITHX RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     2e-35  26%  382 aa  LPXB_SALPK RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     2e-35  26%  382 aa  LPXB_SALPA RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     2e-35  26%  382 aa  LPXB_SALAR RecName: Full=Lipid-A-disaccharide synthase;       
    9::339     2e-35  30%  386 aa  LPXB_CHRVO RecName: Full=Lipid-A-disaccharide synthase;       
    7::337     3e-35  26%  382 aa  LPXB_SHEFN RecName: Full=Lipid-A-disaccharide synthase;       
    8::364     3e-35  26%  385 aa  LPXB2_LEGPL RecName: Full=Lipid-A-disaccharide synthase 2;       
    9::347     4e-35  26%  382 aa  LPXB_SALTY RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALTI RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALSV RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALPC RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALPB RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALNS RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALHS RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALG2 RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALEP RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALDC RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     4e-35  26%  382 aa  LPXB_SALCH RecName: Full=Lipid-A-disaccharide synthase;       
    6::356     4e-35  28%  375 aa  LPXB_PSEPG RecName: Full=Lipid-A-disaccharide synthase;       
    6::342     4e-35  29%  378 aa  LPXB_PSEA7 RecName: Full=Lipid-A-disaccharide synthase;       
    8::346     4e-35  26%  387 aa  LPXB_NITOC RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     9e-35  27%  382 aa  LPXB_SHIDS RecName: Full=Lipid-A-disaccharide synthase;       
   10::355     9e-35  25%  383 aa  LPXB_ANADE RecName: Full=Lipid-A-disaccharide synthase;       
    9::347     1e-34  26%  382 aa  LPXB_SALA4 RecName: Full=Lipid-A-disaccharide synthase;       
   45::391     2e-34  26%  438 aa  LPXB_XANCP RecName: Full=Lipid-A-disaccharide synthase;       
   45::391     2e-34  26%  438 aa  LPXB_XANC8 RecName: Full=Lipid-A-disaccharide synthase;       
    9::330     2e-34  27%  384 aa  LPXB_NEIMB RecName: Full=Lipid-A-disaccharide synthase;       
    9::358     2e-34  26%  392 aa  LPXB_BRAJA RecName: Full=Lipid-A-disaccharide synthase;       
    6::337     3e-34  29%  380 aa  LPXB_PSESM RecName: Full=Lipid-A-disaccharide synthase;       
    9::330     3e-34  27%  384 aa  LPXB_NEIMF RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ESCF3 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOUT RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOLU RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOL6 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOL5 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOK1 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO81 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO7I RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO45 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO27 RecName: Full=Lipid-A-disaccharide synthase;       
   49::389     3e-34  28%  432 aa  LPXB_XANOR RecName: Full=Lipid-A-disaccharide synthase;       
   49::389     3e-34  28%  432 aa  LPXB_XANOM RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_SHISS RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_SHIFL RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_SHIF8 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOSM RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOLI RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOLC RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOHS RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECODH RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECOBW RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  27%  382 aa  LPXB_ECO8A RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO5E RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO57 RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     3e-34  26%  382 aa  LPXB_ECO24 RecName: Full=Lipid-A-disaccharide synthase;       
   10::355     3e-34  26%  383 aa  LPXB_ANASK RecName: Full=Lipid-A-disaccharide synthase;       
   46::392     4e-34  26%  439 aa  LPXB_XANC5 RecName: Full=Lipid-A-disaccharide synthase;       
    6::342     4e-34  29%  378 aa  LPXB_PSEAB RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     4e-34  26%  382 aa  LPXB_ECOSE RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     4e-34  26%  382 aa  LPXB_ECO55 RecName: Full=Lipid-A-disaccharide synthase;       
    6::342     6e-34  29%  378 aa  LPXB_PSEAE RecName: Full=Lipid-A-disaccharide synthase;       
    6::342     6e-34  29%  378 aa  LPXB_PSEA8 RecName: Full=Lipid-A-disaccharide synthase;       
    4::345     8e-34  24%  383 aa  LPXB_SYNAS RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     8e-34  26%  382 aa  LPXB_SHIBS RecName: Full=Lipid-A-disaccharide synthase;       
    9::336     8e-34  26%  382 aa  LPXB_SHIB3 RecName: Full=Lipid-A-disaccharide synthase;       
    1::339     8e-34  25%  382 aa  LPXB_ACIBL RecName: Full=Lipid-A-disaccharide synthase;       
   10::355     1e-33  26%  383 aa  LPXB_ANAD2 RecName: Full=Lipid-A-disaccharide synthase;       
    5::356     1e-33  29%  379 aa  LPXB_PSEFS RecName: Full=Lipid-A-disaccharide synthase;       
    6::352     1e-33  27%  382 aa  LPXB_DECAR RecName: Full=Lipid-A-disaccharide synthase;       
    9::332     2e-33  27%  382 aa  LPXB_ENT38 RecName: Full=Lipid-A-disaccharide synthase;       
  230::585     2e-33  27%  627 aa  LPXB_CHLAB RecName: Full=Lipid-A-disaccharide synthase;       
    6::335     3e-33  29%  375 aa  LPXB_PSEPW RecName: Full=Lipid-A-disaccharide synthase;       
    2::339     5e-33  24%  386 aa  LPXB_CHRSD RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     5e-33  25%  389 aa  LPXB_BURP8 RecName: Full=Lipid-A-disaccharide synthase;       
    8::336     6e-33  25%  383 aa  LPXB_ERWCT RecName: Full=Lipid-A-disaccharide synthase;       
    6::352     8e-33  26%  385 aa  LPXB_XYLFM RecName: Full=Lipid-A-disaccharide synthase;       
    4::346     1e-32  25%  391 aa  LPXB_AZOSE RecName: Full=Lipid-A-disaccharide synthase;       
    4::345     1e-32  24%  391 aa  LPXB_AZOSB RecName: Full=Lipid-A-disaccharide synthase;       
    6::335     2e-32  28%  375 aa  LPXB_PSEE4 RecName: Full=Lipid-A-disaccharide synthase;       
    7::346     2e-32  26%  384 aa  LPXB_CELJU RecName: Full=Lipid-A-disaccharide synthase;       
    8::336     2e-32  25%  383 aa  LPXB_PECCP RecName: Full=Lipid-A-disaccharide synthase;       
    9::332     2e-32  27%  383 aa  LPXB_KLEP7 RecName: Full=Lipid-A-disaccharide synthase;       
    7::345     2e-32  26%  400 aa  LPXB_ACIC5 RecName: Full=Lipid-A-disaccharide synthase;       
    8::349     3e-32  27%  392 aa  LPXB_PELCD RecName: Full=Lipid-A-disaccharide synthase;       
    2::365     3e-32  26%  384 aa  LPXB_CYAP7 RecName: Full=Lipid-A-disaccharide synthase;       
    9::329     3e-32  26%  382 aa  LPXB_CITK8 RecName: Full=Lipid-A-disaccharide synthase;       
    5::356     4e-32  27%  376 aa  LPXB_PSEPF RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     7e-32  27%  389 aa  LPXB_BURCJ RecName: Full=Lipid-A-disaccharide synthase;       
    6::352     9e-32  26%  385 aa  LPXB_XYLFT RecName: Full=Lipid-A-disaccharide synthase;       
    6::352     9e-32  26%  385 aa  LPXB_XYLF2 RecName: Full=Lipid-A-disaccharide synthase;       
    9::332     1e-31  26%  383 aa  LPXB_KLEP3 RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     2e-31  27%  389 aa  LPXB_BURM1 RecName: Full=Lipid-A-disaccharide synthase;       
   20::343     2e-31  27%  394 aa  LPXB_YERPS RecName: Full=Lipid-A-disaccharide synthase;       
   20::343     2e-31  27%  394 aa  LPXB_YERPE RecName: Full=Lipid-A-disaccharide synthase;       
    6::326     2e-31  29%  377 aa  LPXB_PSEMY RecName: Full=Lipid-A-disaccharide synthase;       
    6::352     3e-31  26%  385 aa  LPXB_XYLFA RecName: Full=Lipid-A-disaccharide synthase;       
    8::346     3e-31  26%  382 aa  LPXB_SERP5 RecName: Full=Lipid-A-disaccharide synthase;       
    6::328     4e-31  28%  380 aa  LPXB_AZOVD RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     5e-31  26%  389 aa  LPXB_BURCH RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     5e-31  26%  389 aa  LPXB_BURCC RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     5e-31  26%  389 aa  LPXB_BURCA RecName: Full=Lipid-A-disaccharide synthase;       
   15::336     6e-31  30%  390 aa  LPXB_NEIG1 RecName: Full=Lipid-A-disaccharide synthase;       
  229::588     8e-31  25%  607 aa  LPXB_CHLTR RecName: Full=Lipid-A-disaccharide synthase;       
  229::588     8e-31  25%  607 aa  LPXB_CHLTA RecName: Full=Lipid-A-disaccharide synthase;       
   16::355     1e-30  34%  401 aa  LPXB_SILPO RecName: Full=Lipid-A-disaccharide synthase;       
    7::337     3e-30  27%  380 aa  LPXB_PSE14 RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     4e-30  26%  389 aa  LPXB_BURVG RecName: Full=Lipid-A-disaccharide synthase;       
    7::337     5e-30  27%  380 aa  LPXB_PSEU2 RecName: Full=Lipid-A-disaccharide synthase;       
    9::338     7e-30  26%  389 aa  LPXB_BURS3 RecName: Full=Lipid-A-disaccharide synthase;       
    5::320     1e-29  27%  374 aa  LPXB_PSEF5 RecName: Full=Lipid-A-disaccharide synthase;       
   40::338     3e-29  27%  389 aa  LPXB_BURCM RecName: Full=Lipid-A-disaccharide synthase;       
   40::338     3e-29  27%  389 aa  LPXB_BURA4 RecName: Full=Lipid-A-disaccharide synthase;       
  229::588     3e-29  25%  607 aa  LPXB_CHLMU RecName: Full=Lipid-A-disaccharide synthase;       
   24::352     2e-28  25%  402 aa  LPXB_RALEJ RecName: Full=Lipid-A-disaccharide synthase;       
    8::336     2e-28  27%  381 aa  LPXB_ERWT9 RecName: Full=Lipid-A-disaccharide synthase;       
   39::340     1e-27  25%  390 aa  LPXB_RALSO RecName: Full=Lipid-A-disaccharide synthase;       
    1::328     2e-27  30%  364 aa  LPXB_CAMJR RecName: Full=Lipid-A-disaccharide synthase;       
    1::328     2e-27  30%  364 aa  LPXB_CAMJ8 RecName: Full=Lipid-A-disaccharide synthase;       
    2::344     4e-27  27%  382 aa  LPXB_ALHEH RecName: Full=Lipid-A-disaccharide synthase;       
    1::332     5e-27  24%  372 aa  LPXB_THIDA RecName: Full=Lipid-A-disaccharide synthase;       
   39::330     7e-27  24%  389 aa  LPXB_BURPP RecName: Full=Lipid-A-disaccharide synthase;       
   39::330     9e-27  25%  389 aa  LPXB_BURXL RecName: Full=Lipid-A-disaccharide synthase;       
    1::332     3e-26  27%  356 aa  LPXB_AQUAE RecName: Full=Lipid-A-disaccharide synthase;       
   51::351     6e-26  25%  401 aa  LPXB_RALME RecName: Full=Lipid-A-disaccharide synthase;       
    4::209     8e-26  29%  393 aa  LPXB_BORPE RecName: Full=Lipid-A-disaccharide synthase;       
    4::209     8e-26  29%  393 aa  LPXB_BORPA RecName: Full=Lipid-A-disaccharide synthase;       
    4::209     8e-26  29%  393 aa  LPXB_BORBR RecName: Full=Lipid-A-disaccharide synthase;       
    8::323     1e-25  28%  382 aa  LPXB_SODGM RecName: Full=Lipid-A-disaccharide synthase;       
    1::328     1e-25  29%  364 aa  LPXB_CAMJE RecName: Full=Lipid-A-disaccharide synthase;       
    5::347     2e-25  24%  395 aa  LPXB_BORA1 RecName: Full=Lipid-A-disaccharide synthase;       
   10::347     3e-24  26%  389 aa  LPXB_VEREI RecName: Full=Lipid-A-disaccharide synthase;       
    5::202     1e-23  29%  393 aa  LPXB_BORPD RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     6e-23  22%  388 aa  LPXB_BURPS RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     6e-23  22%  388 aa  LPXB_BURP6 RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     6e-23  22%  388 aa  LPXB_BURP0 RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     6e-23  22%  388 aa  LPXB_BURMS RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     6e-23  22%  388 aa  LPXB_BURMA RecName: Full=Lipid-A-disaccharide synthase;       
   40::338     8e-23  23%  388 aa  LPXB_BURTA RecName: Full=Lipid-A-disaccharide synthase;       
   10::328     1e-22  24%  389 aa  LPXB_RHOFD RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     1e-22  22%  388 aa  LPXB_BURM9 RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     1e-22  22%  388 aa  LPXB_BURM7 RecName: Full=Lipid-A-disaccharide synthase;       
   40::330     1e-22  22%  388 aa  LPXB_BURP1 RecName: Full=Lipid-A-disaccharide synthase;       
   80::369     2e-21  26%  394 aa  LPXB_SYNY3 RecName: Full=Lipid-A-disaccharide synthase;       
    1::356     1e-20  23%  392 aa  LPXB_PROM3 RecName: Full=Lipid-A-disaccharide synthase;       
   17::320     2e-20  28%  360 aa  LPXB_HELPH RecName: Full=Lipid-A-disaccharide synthase;       
   17::320     3e-20  27%  360 aa  LPXB_HELPY RecName: Full=Lipid-A-disaccharide synthase;       
   36::320     3e-20  28%  360 aa  LPXB_HELPG RecName: Full=Lipid-A-disaccharide synthase;       
   36::320     5e-20  28%  360 aa  LPXB_HELP2 RecName: Full=Lipid-A-disaccharide synthase;       
   36::320     8e-20  28%  360 aa  LPXB_HELPS RecName: Full=Lipid-A-disaccharide synthase;       
   36::320     1e-19  27%  360 aa  LPXB_HELAH RecName: Full=Lipid-A-disaccharide synthase;       
   17::320     1e-19  28%  360 aa  LPXB_HELPJ RecName: Full=Lipid-A-disaccharide synthase;       
    1::356     4e-19  22%  392 aa  LPXB_PROMM RecName: Full=Lipid-A-disaccharide synthase;       
   16::140     1e-14  28%  141 aa  LPXB_PROMI RecName: Full=Lipid-A-disaccharide synthase;       
  132::286     2e-07  28%  369 aa  MURG_CLOTH RecName:
  132::346     6e-07  27%  364 aa  MURG_THEPX RecName:
  132::346     6e-07  27%  364 aa  MURG_THEP3 RecName:
  207::434     3e-05  27%  464 aa  KDTA_RICCN RecName: Full=3-deoxy-D-manno-octulosonic-acid
  132::285     2e-04  28%  363 aa  MURG_BACSU RecName:
  296::417     2e-04  32%  728 aa  YL271_MIMIV RecName: Full=Putative ankyrin repeat protein L271;
  168::318     5e-04  29%  330 aa  SYW_RICTY RecName: Full=Tryptophanyl-tRNA synthetase;       
  168::318     8e-04  29%  330 aa  SYW_RICPR RecName: Full=Tryptophanyl-tRNA synthetase;       
    1::378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIFILTGEPSGDKLASTVISKLKMNNPNIEYLSVGGTHIKKLGIKSIFDLKEITYLGFTSVLXXXXXX
LPXB_RICBR      MKKIYFIAGEASGDFAGGRIIRNLKADK-ELKIIGIGGRNMEEAGFESLFPISEINLMGFFEVIPHIFRI
LPXB_RICB8      MKKIYFIAGEASGDFAGGRIIRNLKADK-ELKIIGIGGRNMEEAGFESLFPISEINLMGFFEVIPHIFRI
LPXB_GLUOX      ---IWILAGEASGDVIGARLMQALHAQDPSLVFAGVGGGRMEALGLHSLFPMSDLAVMGLVEVVPRLRQL
LPXB_RICTY      MKKIYFIAGEMSGDFIGGHIIQNLK-SNEGLEFTGIGGQYMEEAGFKSLFTITAINFIGFXXXXXXXXXX
LPXB_RICCK      MAKIYFIAGEMSGDFIGGRIIQHLK-NNTGVQFVGVGSKYMEEAGFKSLFPISAINLIGFVEXXXXXXXX
LPXB_RICFE      MTKIYFIAGETSGDFIGGRIIQHLK-DNIEIKCMGVGGKYMEEAGFKSLFSITSINLMGFVEILPHIFKL
LPXB_RICCN      MIKIYFIAGEVSGDFVGGRIMQHLKNNNDAVQFVGVGGKYMEEAGFKSLFPITSINLMGFVEILPHIFKL
LPXB_COLP3      -----MVVGEHSGDTLGAGLITSLRQTHPHAKFIGIGGPKMLALGFESLFAMDELSVMGLVEVLGRIRRL
LPXB_RHOCS      ---IFLIAGEPSGDVLGGRLMAALRAMEGHVEFAGVGGPRMAEQGLQSLFPMEDLALFGXXXXXXXXXXX
LPXB_COXBU      -KSVLLIAGEPSGDLLGAHLAQSLKSLEPNLKLAGMGGKRMREAGVEVFINADKLAVVGLLEILRQFRDI
LPXB_COXBR      -KSVLLIAGEPSGDLLGAHLAQSLKSLEPNLKLAGMGGKRMREAGVEVFINADKLAVVGLLEILRQFRDI
LPXB_ACIAD      --KIGIVVGEVSGDTLGVQLMRSFREQGIDAEFEGIGGPQMIAEGFNSFYPMETLSVMGIVEVLKDIKKL
LPXB_RICPR      MKKIYFIAGEMSGDFIGGHVIQNLK-SNEGLEFTGIGGKYMEEAGFKSLFTITAINLIGFXXXXXXXXXX
LPXB_SULSY      MKKIFLSVGEISGDNYASELAKHLK----EYQITGITGPKMRAIGVKPVANLEDISVVGLTEALSKYKKI
LPXB_MAGSM      --RIAIVTGEASGDLLAASLVSGLKKRFPRMQIYGIGGPRMKMLGLDSMADAQELSIIGVVEVLNRFPRI
LPXB_GRABC      ---IYIVAGEHSGDVLGARLIHALRAINPSIRFAGIGGPRMEECGFQSLFPMHELAVMGLIEILPRVLKL
LPXB_PERMH      MKKAFISVGEISGDNYASQLVKAL----PDFMWVGITGPKMREAGVETVEKLENISVVGLMEALPKYFKI
LPXB_RICAH      MTKVYFIAGETSGDFIGGRIIQNLK-SNKGVEFTGIGGKCMEEAGFKSLFPITCINLMGFVEILPHIFNL
LPXB_COXBN      -KSVLLIAGEPSGDLLGAHLAQSLKSLEPNLKLAGMGGKRMREAGVEVFINADKLAVVGLLEILRQFRDI
LPXB_COXB2      -KSVLLIAGEPSGDLLGAHLAQSLKSLEPNLKLAGMGGKRMREAGVEVFINADKLAVVGLLEILRQFRDI
LPXB_COXB1      -KSVLLIAGEPSGDLLGAHLAQSLKSLEPNLKLAGMGGKRMREAGVEVFINADKLAVVGLLEILRQFRDI
LPXB_GEOMG      -KRVMIVAGEASGDLHGSNLVKEALRLDPTLSFFGIGGPHMRAAGVETVVDSSEMAVVGLVEVLAHFGVI
LPXB_GEOSL      --RIMIVAGEASGDLHGAGLVREALRLDPTLSFFGIGGPRMREAGVETLVDSSEMAVVGIVEVLAHIGVI
LPXB1_LEGPL     --RVVIVAGEESGDHHAAELVKQLKAVYPDLEISGIGGKHLRAAGVHLISDLTRYAVTGLTEIIPFLKIF
LPXB_IDILO      --KIAIVAGEHSGDLLGAGLMQAIAKRHPNATFIGVGGPLMAERGMDSFFAMDDLAVMGIAEVFQQLPKL
LPXB_PSYIN      --RIGLIAGEASGDILGEGLIKALKIHYPDAVFEGIAGPKMIAQGCTALHPLEALSVMGFVEVLGKLGSI
LPXB1_LEGPH     --RVVIVAGEESGDHHAAELVKQLKAVYPDLEISGIGGKHLRAAGVHLISDLTRYAVTGLTEIIPFLKIF
LPXB_VIBHB      --RIGIIAGELSGDTLGEGFIKAVKQQYPDAEFVGIGGPKMIAQGCESLFDMEELAVMGLVEVLGRLPRL
LPXB1_LEGPA     --RVVIVAGEESGDHHAAELVKQLKAVYPNLKISGIGGKHLRAAGVHLISDLTRYAVTGLTEIIPFLKIF
LPXB_DESPS      --EIMVVTGEASGDIHGANLVRALKEKDSSLSFSGMGGPELASLGVEILYDAKKISVVGLVEVFSHLPSI
LPXB_SHEHH      -----MVAGEISGDILGAGLIKALKTRYPDAKFVGIGGPRMEALGFESIFSYEELAVMGIVEVLSRLPRL
LPXB_HAHCH      --RIGIVAGEASGDLLGAGLMQEIKALYPQATFEGIGGERMLKEGFNTFFQMERLSIMGLVEVLGRLPEL
LPXB_ALCBS      ---VALIAGEASGDILGAGLMQALENRYPGARFIGVGGEEMAQAGLTSLFPMEKLSVMGITEVLSHLPEL
LPXB_VIBPA      --RIGIIAGELSGDTLGEGFIKAVKERYPNAEFVGIGGPKMIAQGCESLFDMEELAVMGLVEVLGRLPRL
LPXB_VIBFM      --RIGIVAGELSGDTLGEGFIKSIKAQYPDAEFVGIGGPKMIAQGCDSLFDMEELAVMGLVEVLGRLPRL
LPXB_AERHH      --RIGIVAGEVSGDILAAGLVRELQARYPDAQFEGIAGPRMQALGVKALFEMEELSVMGITEVLGRLPRI
LPXB_VIBF1      --RIGIVAGELSGDTLGEGFIKSIKAQYPDAEFVGIGGPKMIAQGCDSLFDMEELAVMGLVEVLGRLPRL
LPXB_PHOPR      --RIGIVAGEISGDILGAGFIRAIKAQYPDAEFVGVAGPRMEAEGCKALFDMEELAVMGIVEVLGRLPRL
LPXB_ALTMD      --RIGMVAGEPSGDILAAGMVAELKRQYPDAIIEGIGGPNMIDAGFHSLFDMETLSVMGLVEVLAHLPAI
LPXB_ACTP7      ---IALVAGEISGDILGAGLINALKLHYPNARFIGVAGPRMIQAGCETLFDMEELAVMGLAEVVKHLPRL
LPXB_FRAP2      --RIGIVAGELSGDQLGATLVEALKKKYPNAEIEGIGGPKMEAQGFKSLYPMDALSLIGFLEILSKGLSI
LPXB_ACTPJ      ---IALVAGEISGDILGAGLINALKLHYPNARFIGVAGPRMIQAGCETLFDMEELAVMGLAEVVKYLPRL
LPXB_MANSM      ---IAIVAGEVSGDILGGGLIKALKVKYPQARFVGIAGKNMLAESCESLVDIEEIAVMGLVEILKHLPRL
LPXB_THICR      -----MVAGEASGDTLGADLILSLKKRFPNARFVGIGGQKMIANGFESWYPLEKLSVMGLFEVLKHLPSL
LPXB_SHEPA      -----MVAGEISGDILGAGLIKALQKQYPDAKFVGIGGPRMEALGFESIFSYEELAVMGIVEVLSRLPRL
LPXB_HAEI8      ---IALVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGTRMLAEGCKTLVDMEELSVMGLAEILKHLPRL
LPXB_ACTP2      ---IALVAGEISGDILGAGLINALKLHYPNARFIGVAGPRMIQAGCETLFDMEELAVMGLAEVVKHLPRL
LPXB_HAES1      ---IGIVAGEVSGDILGAGLIRALKIQYPQARFIGIAGKNMLAEGCKTLVDMEEIAVMGLVEVIKYLPRL
LPXB_HAEPS      ---IAIVAGEISGDILGAGLIKALKVHYPNARFIGVAGEKMLKEGCETLFDMEKLAVMGLAEVVRHLPRL
LPXB2_LEGPA     --RIAMVAGELSGDLLGAGVIRELKQHLTNVEFMGVGGPQMLKEGFHSLIDISELSVMGISDVLRRYPQL
LPXB_VIBVY      --RIGIVAGELSGDTLGEGFIKAIKAVHPDAEFVGIGGPKMIALGCQSLFDMEELAVMGLVEVLGRLPRL
LPXB_VIBVU      --RIGIVAGELSGDTLGEGFIKAIKAVHPDAEFVGIGGPKMIALGCQSLFDMEELAVMGLVEVLGRLPRL
LPXB_HAEIG      ---IALVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGTRMLAEGCKTLVDMEELSVMGLAEILKHLPRL
LPXB_SHELP      -QKVFMVAGELSGDILGAGLIKALKQQYPDARFVGIGGPQMDALGFESLFSFEELAVMGLVEVLSRLPRL
LPXB_HAES2      ---IGIVAGEVSGDILGAGLIRALKIQYPQARFIGIAGKNMLAEGCKTLVDMEDIAVMGLVEVIKYLPRL
LPXB_ALISL      --RIGIVAGELSGDTLGEGFIKSVKAQYPNAEFVGIGGPKMIAQGCESLFDMEELAVMGLVEVLGRLPRL
LPXB_HAEIN      ---IALVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGPRMLAEGCETLVDMEELSVMGLAEILKHLPRL
LPXB_SACD2      LKRVAIVVGEASGDILGAGLMAALKKRYPDCEFEGIGGPKMLALGFNSLYQMDRLAVMGFVEPLKRLPEL
LPXB_HAEIE      ---IALVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGPRMLAEGCETLVDMEELSVMGLAEILKHLPRL
LPXB_HAEDU      ---IALVAGEISGDILGAGLINALKIHYPNARFIGVAGPQMIQAGCQTLFDMEELAVMGLAEVVKHLPRL
LPXB2_LEGPH     --RIAMVAGELSGDLLGAGVIRELKQHLTNVEFMGVGGPQMLKEGFHSLIDISELSVMGISDVLRRYPQL
LPXB_SHESM      -----MVAGELSGDILGAGLMAALQKTHPNARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_SHESR      -----MVAGELSGDILGAGLMAALQKTHPNARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_SHESA      -----MVAGELSGDILGAGLMAALQKTHPNARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_PSEHT      --RIGIVAGELSGDILGEGLIKALKKHFPDAIFEGIAGPKMQAQGCNTLYDMDELSVMGLVEVLGRLPRL
LPXB_RHOPB      VRKIFLIATEESGDRLGASLMRELRDRGAAVRFEGVGGRAMAREGLTSLFPIEELSIIGLSAVARRLPTI
LPXB_CHLCV      ----FLSAGEPSGDTLGSDLLRNIKELNPNIHCFGVGGPLMRKEGLEPLIRMEEFQVSGFLEVFCAVFSL
LPXB_SHEB2      -----MVAGELSGDILGAGLMAALQKNHPDARFVGIGGPRMEALGFRSLFAMEELAVMGIVEVLSRLPRL
LPXB_SHEAM      -----MVAGELSGDILGAGLVKALKARHPDARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_SHEON      -----MVAGELSGDILGAGLMAALQKTHPNARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_SHESH      -----MVAGELSGDILGAGLIKALQHQYPDARFVGIGGPRMEALGFESIFSFEELAVMGIVEVLSRLQRL
LPXB_PASMU      ---IAIVAGEVSGDILGAGLIRSLKVQYPHARFIGIAGPRMLAEGAETLVDMEELSVMGLAEVVKHLPRL
LPXB_BLOFL      ---IGIVVGENSGDILGVGLIRSLKKCFKKVQFFGIGGFRMRSENMECWYDISELSIMGITGVIFRLPKL
LPXB_VIBCM      --RIGIVVGELSGDTLGEGFIKAIRARYPDAEFVGIGGPKMNALGCQSLFDMEELAVMGLVEVLGRLPRL
LPXB_VIBCH      --RIGIVVGELSGDTLGEGFIKAIRARYPDAEFVGIGGPKMNALGCQSLFDMEELAVMGLVEVLGRLPRL
LPXB_VIBC3      --RIGIVVGELSGDTLGEGFIKAIRARYPDAEFVGIGGPKMNALGCQSLFDMEELAVMGLVEVLGRLPRL
LPXB_SOLUE      MPKILVSAGEASGDLYASLVVQELRRIMPDAEFFGCTGPRLRAAGVRTIVDSADLAVVGLIEVVAHIPRI
LPXB_MYXXD      --RILVVAGEASGDTHXXXXXXXXXXXXPDLTFFGMGGARLAAQGVELLFDAREVSVMGITEVLPRIPRI
LPXB_MAGSA      ---IYLIAGEPSGDLLGGRLMAALKERGEGVSFAGIGGESMRAEGLTSLFPMTELSVMGLVEVLPRIPKI
LPXB_CHLPN      ----FLSAGEASGDILGGKLIQSIKSLYPNIRFWGVGGPAMRQEGLQPILNMEEFQVSGFAEVLGSLFRL
LPXB_SHEWM      -----MVAGELSGDILGAGLIKALKKQYPNARFIGIGGPKMDALGFESLFSFEELAVMGIVEVLARLPRL
LPXB_SHESW      -----MVAGELSGDILGAGLMAALQKSHPDARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_SHEPC      -----MVAGELSGDILGAGLMAALQKSHPDARFVGIGGPRMEALGFESLFAMEELAVMGIVEVLSRLPRL
LPXB_FRATW      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRATT      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRATO      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRATN      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRATM      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRATH      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRATF      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_FRAT1      --RIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGFKSLYPMDALSLIGFLEIISKGLRI
LPXB_PSEPK      ---VALVAGEASGDILGSGLMRALKARHPDVRFIGVGGPLMEAEGLQSYFPMERLAVMXXXXXXXXXXXX
LPXB_PHOLL      ---IGLIAGETSGDILGAGLIRALKAKVPNARFVGVAGPLMQAEGCEAWYEMEELAVMGIVEVLGRLPRL
LPXB_NITWN      -RKIFLIATEESGDRLGSSLMKALRRRGCSVRFEGVGGQTMAREGLVSLFPIEELSIMGFTAVVKQLPMI
LPXB_NEIMA      ---IAVSVGEASGDLLGAHLIRAIRKRCPQARFVGIGGELMKAEGFESLYDQERLAVRGFVEVVRRLPEI
LPXB_RHOP2      VRRLFLIATEESGDRLGAALMQALKTRGDGVVFEGVGGRAMAEQGLVSLFPIEELSIMGISAXXXXXXXX
LPXB_CHLFF      ----FLSAGEPSGDILGSDLLHNIKTCDPTIRCFGVGGPLMRKEGFEPLIHMEEFQVSGFLEVFFSIFGL
LPXB_BLOPB      ---IGIVAGEASGDILGAGLIRTLKKYLKKVRFFGIGGPCMQSEDMKSWYNIEELSVMGFAEIVMKLPRL
LPXB_METFK      MPTIGIVAGEASGDLLGSHLIRALKKQRPDLKFVGIAGPKMIAEGAETLFPMERLSVRGYVEVLRHLPGL
LPXB_GEOLS      -KRVMIVAGEASGDIYGAGLVRAVQAADPAFSFFGIGGPRMREAGCETLVDSADMAVVGLVEVLKHFDVX
LPXB_PSEP1      ---VALVAGEASGDILGSGLMRALKARHPDVRFIGVGGPLMEAEGLQSYFPMERLAVMXXXXXXXXXXXX
LPXB_WIGBR      ---IGIVAGEASGDFLGAELIKSLNIIHSNIKFVGIAGPMLKEKNVESWFSIEELSIMGIFEIINRIPKI
LPXB_RHOPA      VRTVYLIATEESGDRLGAALMRELRARGSKVRFAGVGGHCMAGEGLASLFPIEELSIIGFAAVVQRLPMI
LPXB_XANAC      --RIALIAGEASGDILGAGLIEQLRLRYPNAEFVGIGGDAMRGVGCQTWFDASELAVMGLTEVLRHLPRL
LPXB_NITHX      -RRIFLIATEESGDRLGSSLMKVLRRRDDAVRFEGVGGRSMAREGLVSLFPIEDLSIMGFAAVVKQLPMI
LPXB_SALPK      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALPA      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALAR      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_CHRVO      --KVAMVAGEASGDLLAAHLMDALRAHRSDIEFAGIGGPRMEARGFHSMVPQEKLAVRGYSEVLKSXXXX
LPXB_SHEFN      --KVFIVAGEISGDILGAGLVNSLKKRYPDARFIGIGGPRMQALGFESLFPMEELSIMGLVEVLSHLPRL
LPXB2_LEGPL     --RIAMIAGEMSGDLLGAGVIRELKKHLKNVEFIGVGGPQMLEEGFQSLANMSELSVMGISDVLRRYPQL
LPXB_SALTY      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALTI      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALSV      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALPC      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALPB      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALNS      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALHS      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALG2      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALEP      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALDC      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SALCH      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_PSEPG      ---VALVAGEASGDILGSGLMRALKARHPDVRFIGVGGPLMEAEGLQSYFPMERLAVMXXXXXXXXXXXX
LPXB_PSEA7      --RVALVAGEASGDILGSGLMQALRARHPEIEFIGVGGPRMEAEGLSSYFPMERLSVMGLVEVXXXXXXX
LPXB_NITOC      ---VAIVAGEASGDQHAAHLIREVKKIAPGVRFGGIAGPQMRAAGVEPLFDSSRLAVVGLVEVLSHLNEI
LPXB_SHIDS      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEIEELAVMGIVEVLGRLRRL
LPXB_ANADE      --QILIVAGEASADLHAARTLHELQRLRPGLTAFGVGGPRLREAGLEALAPAEDISVMGLAEVLPRIPRI
LPXB_SALA4      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_XANCP      --RIALIAGEASGDILGAGLIDALRRRYPDAEFVGIGGDAMRSAGCQTWFDASELAVMGLTEVLRHLPRL
LPXB_XANC8      --RIALIAGEASGDILGAGLIDALRRRYPDAEFVGIGGDAMRSAGCQTWFDASELAVMGLTEVLRHLPRL
LPXB_NEIMB      ---IAVSVGEASGDLLGAHLIRAIRKRCPQARFTGIGGELMKAEGFESLYDQERLAVRGFVEVVRRLPEI
LPXB_BRAJA      -RKIFLIATEESGDRLGSALMKVLRQRGDGVQFEGVGGRTMAREGLETLFPIEELSIVGFAAVVQQLPKI
LPXB_PSESM      --RIALVAGEASGDILGSGLMRALKARHPDVRFIGVGGPLMEAEGMQSYFPMERLSVMXXXXXXXXXXXX
LPXB_NEIMF      ---IAVSVGEASGDLLGAHLIRAIRKRCPQARFVGIGGELMKAEGFESLYDQERLAVRGFAEVVRRLPEI
LPXB_ESCF3      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOUT      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOLU      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOL6      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOL5      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOK1      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO81      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO7I      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO45      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO27      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_XANOR      -----LIAGEASGDILGAGLIAQLRLRYPNAEFVGIGGDAMRGAGCQTWFDASELAVMGLTEVLRHLPRL
LPXB_XANOM      -----LIAGEASGDILGAGLIAQLRLRYPNAEFVGIGGDAMRGAGCQTWFDASELAVMGLTEVLRHLPRL
LPXB_SHISS      ---IALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SHIFL      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SHIF8      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEIEELAVMGIVEVLGRLRRL
LPXB_ECOSM      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOLI      ---IALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOLC      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOHS      ---IALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECODH      ---IALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECOBW      ---IALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO8A      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO5E      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO57      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO24      ---IALVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ANASK      --QILIVAGEASADLHAARTLHELQRLRPGITAFGVGGPRLREAGLEALAPAEDISVMGLAEVLPRIPRI
LPXB_XANC5      --RIALIAGEASGDILGAGLIEQLRLRYPNAEFVGIGGDAMRGVGCQTWFDASELAVMGLTEVLRHLPRL
LPXB_PSEAB      --RVALVAGEASGDILGSGLMQALRARHPDIEFIGVGGPRMEAEGLSSYFPMERLSVMGLVEVXXXXXXX
LPXB_ECOSE      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ECO55      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_PSEAE      --RVALVAGEASGDILGSGLMQALRARHPDIEFIGVGGPRMEAEGLSSYFPMERLSVMGLVEVXXXXXXX
LPXB_PSEA8      --RVALVAGEASGDILGSGLMQALRARHPDIEFIGVGGPRMEAEGLSSYFPMERLSVMGLVEVXXXXXXX
LPXB_SYNAS      -KLVLIVAGEASGDLHGASLVGAMVKREPGIRFYGIGGVNLKTAGVDLWADAADMAVVGLTEVASKLRGI
LPXB_SHIBS      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_SHIB3      ---IALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ACIBL      MLKVLISAGEASGEMYGAALLDALRKLSPDVEAFGLGGEKMRAAGCDIIVDSKDVAVVGIAEVVAHLPRI
LPXB_ANAD2      --QILIVAGEASADLHAARTLHELQRLRPGITAFGVGGPRLREAGLEALAPAEDISVMGLAEVLPRIPRI
LPXB_PSEFS      --RIALVAGEASGDILGAGLMRALKAQHPAVQFIGVGGPLMQAEGLTSYFPMERLSVMXXXXXXXXXXXX
LPXB_DECAR      --RIAMVAGEASGDLLASHLIAALKTHLPDAVFYGIGGPKMQAQGFDSWWPMEKLSVMGYWDALKHYREI
LPXB_ENT38      ---IALVAGETSGDILGAGLIRALKAREPNARFVGVAGPLMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_CHLAB      ----FISAGEASGDTLGSDLLRHIKALHPDKRCFGVGGPLMRQEGLEPLIHMEEFQVSGFLEILTSIFTL
LPXB_PSEPW      ---VALVAGEASGDILGSGLMRALKARHPQVRFIGVGGPLMEAEGMQSYFPMERLAVMXXXXXXXXXXXX
LPXB_CHRSD      --RIYLVAGELSGDILGAGLMQALKRRHPDAEFRGIGGPRMLAEGMQSLYPLETLSVMGLVEVLKHLPGL
LPXB_BURP8      --RLAMVAGEPSGDLLAASMLDGLAARLPDTQYFGIGGPRMIAKGFDAHFAMEKLSVRGYVEALKHVPEI
LPXB_ERWCT      ---IGLVAGETSGDILGAGLIRALKEKVPGARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLPRL
LPXB_XYLFM      --RIALIAGEASGDHLGAGLIQQLRLHFPTAEFIGIGGDMMRSAGCQTWFDTTELAVMGLTEVLRHLPRL
LPXB_AZOSE      --RIAMVAGEASGDLLASHLIRAIRQQVPEAEFYGIGGPKMQAEGFDALWPCERLAVHGYVDALKRYREL
LPXB_AZOSB      --RIAMVAGEASGDLLASHLIRAIRARVPDAEFFGIGGPKMQAEGFDARWPCELLAVHGYVDALKRYREL
LPXB_PSEE4      ---VALVAGEASGDILGSGLMRAIKARHPDVRFIGVGGPLMEAEGMSSYFPMERLAVMXXXXXXXXXXXX
LPXB_CELJU      ---IGIVVGEASGDILGAALMTELRRHFPNAEFSGIGGPRMLELGFHSYFPQDRLAVMGLIEPLKRLPEL
LPXB_PECCP      ---IGLVAGETSGDILGAGLIRSLKEKVPDARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLPRL
LPXB_KLEP7      ---IALVAGETSGDILGAGLIRALKARIPNARFVGVAGPLMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_ACIC5      ---IFLSAGEASGEHYGAALIPALRALYADARFFGLGGQRMQALGMERIVRAEDVAVMGITEVVRHLPRI
LPXB_PELCD      -RRIMVVTGEASGDLHGAHLIEAAGKVDPGLSFFGVGGACMAKAGCEILIPGEDLAVMGLVEVLGHFPTI
LPXB_CYAP7      --RIFISTGEVSGDLQGAMLIEALKLKAMDLEIVALGGDRMAETGVSLLGKTPKIASIGLIEALPFIMPT
LPXB_CITK8      ---IALVAGETSGDILGAGLIRALKARVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_PSEPF      --RIALVAGEASGDILGAGLMRALKAQHPAVEFIGVGGPLMQAEGLTSYFPMERLSVMXXXXXXXXXXXX
LPXB_BURCJ      --RLAMVAGEPSGDXXXXXXXXXXXXXXPSAQYYGIGGQRMIAQGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_XYLFT      --RIAIIAGEASGDHLGAGLIQQLRLHFATAEFIGIGGDMMRSAGCQTWFDTSELAVMGLTEVLRHLPRL
LPXB_XYLF2      --RIAIIAGEASGDHLGAGLIQQLRLHFATAEFIGIGGDMMRSAGCQTWFDTSELAVMGLTEVLRHLPRL
LPXB_KLEP3      ---IALVAGETSGDILGAGLIRALKARIPDARFVGVAGPLMQAEGCEAWYEMEELAVMGIVEVLGRLRRL
LPXB_BURM1      --RLAMVAGEPSGDXXXXXXXXXXXXXXPATHYYGIGGARMIAQGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_YERPS      ---IGLVAGETSGDILGAGLIRALKVQVPNARFVGVAGPLMQAEGCEAWYEMEELAVMGXXXXXXXXXXX
LPXB_YERPE      ---IGLVAGETSGDILGAGLIRALKVQVPNARFVGVAGPLMQAEGCEAWYEMEELAVMGXXXXXXXXXXX
LPXB_PSEMY      --RVALVAGEASGDILGSGLMQAIKARHPDAEFIGVGGARMEAEGLKSYFPMERLAVMXXXXXXXXXXXX
LPXB_XYLFA      --RIALIAGEASGDHLGAGLIQQLRLRLPTAEFVGIGGDMMRSARCQTWFDTSELAVMGLTEVLRHLPRL
LPXB_SERP5      ---IGLVAGETSGDILGAGLIRALKAQIPDARFVGVAGPLMQAEGCETWYEMEELAVMGXXXXXXXXXXX
LPXB_AZOVD      --RVALVAGEASGDILGASLMQALKAVRPDIEFIGVGGPRMQAEGLQSYFPMERLAVMGXXXXXXXXXXX
LPXB_BURCH      --RLAMVAGEPSGDXXXXXXXXXXXXXXPSAQYYGIGGQRMIAQGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_BURCC      --RLAMVAGEPSGDXXXXXXXXXXXXXXPSAQYYGIGGQRMIAQGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_BURCA      --RLAMVAGEPSGDXXXXXXXXXXXXXXPSAQYYGIGGQRMIAQGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_NEIG1      ---IAVSVGEASGDLLGAHLIRAIRKRCPQARLTGIGGELMKAEGFESLYDQERLAVRGFVEXXXXXXXX
LPXB_CHLTR      ----FISAGEHSGDTLGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQVSGFWEVLLALPKL
LPXB_CHLTA      ----FISAGEHSGDTLGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQVSGFWEVLLALPKL
LPXB_SILPO      LMRVFILAGEPSGDRLGGALMAGLRQLCPDVQFDGVGGPAMESEGLSSRFPMAELSIMGLVEVLPKYFHL
LPXB_PSE14      ---IALVAGEASGDILGSGLMRALKVRHPDIRFIGVGGPLMEAEGMQSYFPMERLSVMXXXXXXXXXXXX
LPXB_BURVG      --RLAMVAGEPSXXXXXXXXXXXXXXXXPSTHYYGIGGQRMLAHGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_PSEU2      ---IALVAGEASGDILGSGLMRALKVRHPDIRFIGVGGPLMEAEGMQSSFPMERLSVMXXXXXXXXXXXX
LPXB_BURS3      --RLAMVAGEPXXXXXXXXXXXXXRERLPSAQYYGIGGQRMIAQGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_PSEF5      --RIALVAGEASGDILGAGLMRALKVQHPAVEFIGVGGPLMEAEGLVSYFPMERLAVMXXXXXXXXXXXX
LPXB_BURCM      --------------------------------YYGIGGQRMLAHGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_BURA4      --------------------------------YYGIGGQRMLAHGFDSHWQMDKLTVRGYVEALGQIPEI
LPXB_CHLMU      ----FISAGEHSGDTLGGNLLKEIHAKYPDIHCFGVGGPQMRAQNFCTLFSMEKFQISGFWEVLLALPKL
LPXB_RALEJ      ---IAMVAGEASGDLLASLMLGGLKARGDTVSYAGIGGKRMMTEGFVSQWPMETLSVNGYVEVLGSLREI
LPXB_ERWT9      ---IALVAGETSGDILGAGLIRALKEKHPDARFVGVAGPLMQSEGCEAWYEMEELAVMGIVEVXXXXXXX
LPXB_RALSO      -----------------------------DVAYEGIGGARMAEQGFASHWPMHKLSVNGYVEVLGQLREI
LPXB_CAMJR      MKTFLVCALEPSANLHLKEVLKAYKKDFGEFELHGIYDESLCKLNSKPLYSSHEFSAMGFIEVLPLIFKA
LPXB_CAMJ8      MKTFLVCALEPSANLHLKEVLKAYKKDFGEFELHGIYDESLCKLNSKPLYSSHEFSAMGFIEVLPLIFKA
LPXB_ALHEH      --RVALVAGEHSGDRLGAGLIRAIRARCPEAEFDGVGGPLMQAEGLRSHYPMEALSVMGLVEVXXXXXXX
LPXB_THIDA      -----MVAGEASGDLLGAHFFDALKKNRPGLTAAGIAGPRMVEAGVKAIYPSEKLAVNGYVEVLRHLPEL
LPXB_BURPP      -------------------------------QYYGIGGPRMIATGFDAHFPMEKLSVRGYVEALKHIPGI
LPXB_BURXL      -------------------------------QYYGIGGPRMIATGFDAHFPMEKLTVRGYVEALKHIPEI
LPXB_AQUAE      MKKIFLSLADRSA---SNYVYEILKEGFEEYEIYGLTDEKLEKIGVKSVARYSEISTVGLIEALPKVFKF
LPXB_RALME      ------------------------------VDYAGIGGHRMMAQGFVSHWPMETLSVNGYVEVLGSLREI
LPXB_BORPE      --RIGMVAGEPSGDLLAGRIIAGLQARAPGVHCAGIGGPQMAARGFEAWHPMHALTVFGYIDAFKRIPSL
LPXB_BORPA      --RIGMVAGEPSGDLLAGRIIAGLQARAPGVHCAGIGGPQMAARGFEAWHPMHALTVFGYIDAFKRIPSL
LPXB_BORBR      --RIGMVAGEPSGDLLAGRIIAGLQARAPGVHCAGIGGPQMAARGFEAWHPMHALTVFGYIDAFKRIPSL
LPXB_SODGM      ---IGLVAGETSGDILGAGLIRALRGHLPEARFVGVAGPRMQAEGMEAWYDMEELAVMGIVEVVEXXXXX
LPXB_CAMJE      MKTFLVCALEPSANLHLKEVLKAYKKDFGEFELHGIYDESLCKLNSKPLYSSHEFSAMGFIEVLPLIFKA
LPXB_BORA1      ---IGMVAGEPSGDXXXXXXXXXXXXXXPDVHCAGIGGPQMQAQGFEAWHPMHALTVFGYIDALKRIPSL
LPXB_VEREI      --RIAMVAGEASGDMLAALLIGGLQADWPGIELCGIGGPEMARRGFTPWWPSERLAVHGYSQMXXXXXXX
LPXB_BORPD      ---IGMVAGEPSGDLLASRVIAGLRRDE-TVQCQGIGGPAMQAAGFDAWHPMHALTVFGYVDALKRLPSL
LPXB_BURPS      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURP6      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURP0      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURMS      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURMA      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURTA      --------------------------------YYGIGGPRMTAVDFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_RHOFD      --QVALVAGETSXXXXXXXXXXXXREQWPLMTAVGIGGPQMARRGLVAWWGHDKLSVHGFGEVLRRYREI
LPXB_BURM9      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURM7      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_BURP1      --------------------------------YYGIGGPRMSAVEFDAHWPMEKLAVRGYVEALKHIPEI
LPXB_SYNY3      ----------------------------------------------------------------------
LPXB_PROM3      MVRLLISTGEVSGDLQGSLLIQALQREVERLELMALGGPRMQASGAELLADTAPMGAIGLWEALPLVLPT
LPXB_HELPH      --------------------LEELRQNLPK-DYRFIGVFE----GKNALYSPREFSIMGFRDVIGRLGFL
LPXB_HELPY      --------------------LEELRQNLPE-DYRFIGVFEGKEV----LYSPREFSIMGFRDVIGRLGFL
LPXB_HELPG      --------------------------------------------GKNALYSPREFSIMGFRDVIGRLGFL
LPXB_HELP2      --------------------------------------------GKNALYSPREFSVMGFRDVIGRLGFL
LPXB_HELPS      --------------------------------------------GKEALYSPREFSIMGFRDVIGRLGFL
LPXB_HELAH      --------------------------------------------GSGALYSPREFSVMGFRDVIGRLGFL
LPXB_HELPJ      --------------------LEELRHNLPK-DYRFIGVFESKE----ALYSPREFSIMGFRDVIGRLGFL
LPXB_PROMM      MVRLLISTGEVSGDLQGSLLIQALQREVERLELMALGGPRMQASGAELLADTAPMGAIGLWEALPLVLPT
LPXB_PROMI      ---IGLVAGETSGDILGAGLIRALKQMHPNIRFVGVAGPLMQAEGCEAWYEMEELAVMGIVEVLERLPRL
MURG_CLOTH      ----------------------------------------------------------------------
MURG_THEPX      ----------------------------------------------------------------------
MURG_THEP3      ----------------------------------------------------------------------
KDTA_RICCN      ----------------------------------------------------------------------
MURG_BACSU      ----------------------------------------------------------------------
YL271_MIMIV     ----------------------------------------------------------------------
SYW_RICTY       ----------------------------------------------------------------------
SYW_RICPR       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXTVEEIIKFNPDILFSVDSPDFTLRVAEKVXXXXXXXXXXXYVAPQVWVWRKNRVKKIKKFIDHI
LPXB_RICBR      KKLINKTVEDIIDNKPDILITIDSPGFTYRVAAKVRERLPELKMIHIVAPSVWAYKEGRAAKYAKIYNCL
LPXB_RICB8      KKLINKTVEDIIDNKPDILITIDSPGFTYRVAAKVRERLPELKMIHIVAPSVWAYKEGRAAKYAKIYNCL
LPXB_GLUOX      SQRLLEAVQDIELRKPDLVVTIDSPGFTLRLLQKIERSGIKRVH--YVAPQVWAWRENRVKEFPGLWDRL
LPXB_RICTY      XXXXDKTVENIINSKVDLLITIDSPGFTYRVAKRVRKFLPNLKIIHIVAPSVWAYKAGRAVDYAKIYDCL
LPXB_RICCK      XXXXXXTVEDIINSKADLLITIDSPGFTYRVAKQVRKLLPKLKMIHIVAPSVWAYKEGRAIKYAKIYDCL
LPXB_RICFE      KKLIDKTVEDITNSRADLLITIDSPGFTYRVAKRVRKLLPKLKMIHIVAPSVWAYKEDRAVKYAQIYDCL
LPXB_RICCN      KKLIDKTVEDIINSKADLLITIDSPGFTYRVAKRVRKLLPKLKMIHIVAPSVWAYKEGRAVKYAKIYDCL
LPXB_COLP3      LHVRKTLTDFFITNKPDVFIGIDAPDFNIGLELKLKVKGIKTVH--YVSPSVWAWREKRIFKIAKATDMV
LPXB_RHOCS      XXXXDQTTKAVLERTPDAVVSIDAPDFCFRVEQRLRRAGARMPLIHYVAPTVWAWRPGRARKVAKFLDHL
LPXB_COXBU      RHAMQTLKRYFKKTPPDLVVFIDYPGFNLHMAKQAKKAGIKVLY--YVSPQIWAWRYGRIKKIKKYVDHM
LPXB_COXBR      RHAMQTLKRYFKKTPPDLVVFIDYPGFNLHMAKQAKKAGIKVLY--YVSPQIWAWRYGRIKKIKKYVDHM
LPXB_ACIAD      FAVRDGLVQRWREHPVDVFVGIDAPDFNLRLSKSLKEKNLPIRTVQYVSPSVWAWRQGRVKGIKATIDLV
LPXB_RICPR      XXXXDKTVEHIINSKADLLITIDSPGFTYRVAKRVRKLLPNLKMIHIVAPSVWAYKADRAVNYAKIYDCL
LPXB_SULSY      KEVFKQSVQAL-KSGVDLLIVVDFPGFNIKLLKEAKKLGIKTVY--FISPQVWAWGSGRVKEIVENTDLL
LPXB_MAGSM      RTIFNALLKRLQSEPPDLLITVDLPDFSLRMARKAKQLGIPTVH--YVSPQVWAWRSGRAKTIASYLDLL
LPXB_GRABC      RRRLQQTVQDIETRRPDLVLTIDSPGFCLRLLRAI--QPFGIKRVHYVAPQVWAWREHRVKRFPGLWERM
LPXB_PERMH      KETFKRSVE-ILDKGIDLLVVVDFPGFNLKLLKEAKKRGIKTVY--FIAPQVWAWGKGRIPKIAQYTDLL
LPXB_RICAH      KKLIDKTVQDIINSQADLLITIDSPGFTYRVAKQLRKLLPKLKMIHIVAPSVWAYKDGRAVKYAKIYDCL
LPXB_COXBN      RHAMQTLKRYFKKTPPDLVVFIDYPGFNLHMAKQAKKAGIKVLY--YVSPQIWAWRYGRIKKIKKYVDHM
LPXB_COXB2      RHAMQTLKRYFKKTPPDLVVFIDYPGFNLHMAKQAKKAGIKVLY--YVSPQIWAWRYGRIKKIKKYVDHM
LPXB_COXB1      RHAMQTLKRYFKKTPPDLVVFIDYPGFNLHMAKQAKKAGIKVLY--YVSPQIWAWRYGRIKKIKKYVDHM
LPXB_GEOMG      YKAYA-TLKRLITTNPDLLILIDYPDFNM--LXXXXXXXXXXXXLYYISPQVWAWRTGRVKKIARLVDRM
LPXB_GEOSL      SRAFMTLRQVIVSNPPDLLILIDYPDFNMLLARVARRHGVKVLY--YISPQVWAWRTGRVKTIGRLVDRM
LPXB1_LEGPL     RKAFQDIKQHLSTQKPDLLILVDYPAFNLRXXXXXXXXXXXXXXXXX-SPQIWAWKGKRIHLIKDCIDKM
LPXB_IDILO      LKHRKNLVNYLISEQPDVMIGIDAPDFNLTVEARLKKAGISTIH--YVSPSVWAWREGRIKGIKKAVDHV
LPXB_PSYIN      LRIRKSIINHFIANPPDIFIGIDAPDFNLTVELKLKQHNIKTIH--YVSPSVWAWKQWRIHKIAKATDLV
LPXB1_LEGPH     RKAFQDIKQHLSTQKPDLLILVDYPAFNLRXXXXXXXXXXXXXXXXX-SPQIWAWKGKRIHLIKDCIDKM
LPXB_VIBHB      LKVKAQLVKYFTENPPDVFIGIDAPDFNLRV--ELDLKNAGIKTVHYVSPSVWAWRQKRIFKIEAATNLV
LPXB1_LEGPA     HKAFQDIKQHLSTQKPDLLILVDYPAFNLRXXXXXXXXXXXXXXXXX-SPQIWAWKGKRIHLIKDSIDKM
LPXB_DESPS      FAAKKILQRRLKNKPPALLIIIDLPDFNLMLAKKAKALGIPVFY--YITPQVWAWRSGRIKTIGERTDQL
LPXB_SHEHH      LKVRATLIDELVKINPDCFIGIDAPDFNIGLELKL--KNRGIKTVHYVSPSVWAWRPKRIFKIAKATDMV
LPXB_HAHCH      LAMRRRIVDHFTATPPDLFLGIDSPDFTIGIELKLRQAGIKTAH--YVSPSVWAWRQNRVFKIAKAVDLM
LPXB_ALCBS      LRLRKSLVRFLLEQRPDVVVGIDSPDFTLPIARRL--HDRGLKTVHYVSPSVWAWRQGRIKGIKKSIDLM
LPXB_VIBPA      LKVKAELVKYFTQNPPDVFVGIDAPDFNLRL--ELDLKQAGIKTVHYVSPSVWAWRQKRIFKIEAATNLV
LPXB_VIBFM      LKVKAELVRYFTQNPPDVFIGIDAPDFNLRLEKTLKDNGIKTVH--YVSPSVWAWRPKRIFKIDAATDLV
LPXB_AERHH      LKVRRELLRHFIANPPDIFIGVDAPDFNIGVELKL--RRAGIKTVHYVSPSVWAWRQNRIHKIKAATDMV
LPXB_VIBF1      LKVKAELVRYFTQNPPDVFIGIDAPDFNLRLEKTLKDNGIKTVH--YVSPSVWAWRPKRIFKIDAATDLV
LPXB_PHOPR      LKVKAELVKYFTENPPDVFVGIDAPDFNLRL--ELDLKQHGIKTVHYVSPSVWAWRQKRIFKIEAATNLV
LPXB_ALTMD      LKVKKQLLAHFEQNPPDIFVGVDAPDFNLRVEKALKARGIKTMH--YVSPTVWAWREKRIHKIAKAANRV
LPXB_ACTP7      LKRRKQVIETMLAEKPDIFIGIDAPDFNLTVEEKL--KASGIKTIHYVSPSVWAWRQNRVQKIARATNLV
LPXB_FRAP2      LNIRRKIIKYFKHNKPDIFIGIDAPDFNLTVEKKL--RASGIKTIHYVSPKIWVWREYRIKKIRKATDKI
LPXB_ACTPJ      LKRRKQVIETMLAEKPDIFIGIDAPDFNLTVEEKL--KASGIKAIHYVSPSVWAWRQNRVQKIARATNLV
LPXB_MANSM      LKIRSDIVQKLSALKPDIFIGIDSPEFNLYVEDRLKAQGIKTIH--YVSPSVWAWRQNRIYKIAKATNLV
LPXB_THICR      LRLRKELIQKLLQLKPDVFIGIDAPDFNFKM--EGILKENAIPTIHYVGPSVWAWREKRLLKICKQVDGV
LPXB_SHEPA      LKVRATLIDELVKTQPDCFIGIDAPDFNIGLELKL--KNRGIKTVHYVSPSVWAWRPKRIFKIAKATDMV
LPXB_HAEI8      LKIRKNVIQTMLQEKPDVYIGIDAPDFNLDVELKL--KANGIKTIHYVSPSVWAWRQNRIHKIAKATHQV
LPXB_ACTP2      LKRRKQVIETMLAEKPDIFIGIDAPDFNLTVEEKL--KASGIKTIHYVSPSVWAWRQNRVHKIARATNLV
LPXB_HAES1      LKIRRLVIDTMLAEKPDIFIGIDAPDFNLDIELKLKKQGIKTLH--YVSPSVWAWRQKRIVKIAQATNLV
LPXB_HAEPS      LKRRKQVIDTMLALKPDIFIGIDAPDFNLGVEEKL--KAQGIKTIHYVSPSVWAWRQNRVHKIASATDLV
LPXB2_LEGPA     YLIRERLLREWTINPPDVFIGIDYPDFNLSVEARLKKQHIKTIHL--VSPKVWAWRQKRVHLIKKAVDLV
LPXB_VIBVY      LKVKAELVRYFTENPPDVFVGIDAPDFNLRL--ELDLKNAGIKTVHYVSPSVWAWRQKRIFKIAKATHLV
LPXB_VIBVU      LKVKAELVRYFTENPPDVFVGIDAPDFNLRL--ELDLKNAGIKTVHYVSPSVWAWRQKRIFKIAKATHLV
LPXB_HAEIG      LKIRKNVIQTMLQEKPDVYIGIDAPDFNLDVELKL--KANGIKTIHYVSPSVWAWRQNRIHKIAKATHQV
LPXB_SHELP      LKVRKTLIDELTALKPDCFIGIDAPDFNIGLELKL--KAQGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_HAES2      LKIRRLVIDTMLAEKPDIFIGIDAPDFNLDIELKLKKQGIKTLH--YVSPSVWAWRQKRIFKIAQATNLV
LPXB_ALISL      LKVKAELVRYFSQNPPDVFIGIDAPDFNLRLEKTLKDSGIKTVH--YVSPSVWAWRPKRIFKIDAATDLV
LPXB_HAEIN      LKIRKNVIQTMLQEKPDVYIGIDAPDFNLDVELKL--KANGIKTIHYVSPSVWAWRQNRIHKIAKATHQV
LPXB_SACD2      LGIRKSLRQRYLTNPPDVFIGIDAPDFNLNL--EVNLREAGVPVVHYVSPSVWAWRRGRLKKIAKAVDLM
LPXB_HAEIE      LKIRKNIIQTMLQEKPDVYIGIDAPDFNLDVELKL--KANGIKTIHYVSPSVWAWRQNRIHKIAKATHQV
LPXB_HAEDU      LKRRKQVIQTMLQQQPDIFIGIDAPDFNLTIEQKL--KAKGITTIHYVSPSVWAWRQDRIHKIKRATNLV
LPXB2_LEGPH     YLIRERLLREWTINPPDVFIGIDYPDFNLSVEARLKKQHIKTIHL--VSPKVWAWRQKRVHLIKKAVDLV
LPXB_SHESM      LHVRSSLIKSITELKPDCFIGIDAPDFNIGLELKL--KAQGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_SHESR      LHVRSSLIKSITELKPDCFIGIDAPDFNIGLELKL--KAQGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_SHESA      LHVRSSLIKSITELKPDCFIGIDAPDFNIGLELKL--KAQGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_PSEHT      LKIRKQLVQHFIDNPPDVFIGIDAPDFNLRVEKPL--KDAGIKTVQYVSPSVWAWREKRIHTISAATNLV
LPXB_RHOPB      LRHIRTAAHAALQAAPDVLVIIDSPDFTHRVARRVRARDPSIPIVNYVSPTVWAWRPGRAKVMRKYVDHV
LPXB_CHLCV      YKKYRKLYKAILKENPETVFCIDFPDFHFFLIRKLRKCGYRGKIIHYVCPSIWAWRPNRKKILEKHLDTL
LPXB_SHEB2      LTVRASLIKEITALKPDCFIGIDAPDFNIGLELKL--KARGIKTVHYVSPSVWAWRPKRIFKIAKATHMV
LPXB_SHEAM      LKVRSSLVSQLLALKPDCFIGIDAPDFNIGVELKL--KQQGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_SHEON      LHVRASLIKSITELKPDCFIGIDAPDFNIGLELKL--KAQGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_SHESH      LKVRKTLIDEICSIEPACFIGIDAPDFNIGLELKL--KARGIKTVHYVSPSVWAWRPKRIFKIAKATDMV
LPXB_PASMU      LKIRRQLIHTMLQEKPDIFIGIDAPDFNIDVELKLKENGIKTIH--YVSPSVWAWRQNRIHKIAKATHLV
LPXB_BLOFL      LNMRRELIKRFLKLKLNIFIGIDFPDFNISLEKRLKKYGITTIH--YVSPSIWAWRSNRVFALKEATHNV
LPXB_VIBCM      LKVKAELVKYFTANPPDVFVGIDAPDFNLRL--ELSLKQAGIKTVHYVSPSVWAWRQNRIHGIAAATHLV
LPXB_VIBCH      LKVKAELVKYFTANPPDVFVGIDAPDFNLRL--ELSLKQAGIKTVHYVSPSVWAWRQNRIHGIAAATHLV
LPXB_VIBC3      LKVKAELVKYFTANPPDVFVGIDAPDFNLRL--ELSLKQAGIKTVHYVSPSVWAWRQNRIHGIAAATHLV
LPXB_SOLUE      YGXXXXXXXXXXXXXXXXXILTDSPDFHLRVARKLHRQEVPVVYL--VAPQAWAWRRGRVREMRRTIRRL
LPXB_MYXXD      LQILKGLAEAAAERKPDVAILVDIPDFNLRLAKKLKALGVPVAY--YVSPMIWAWRRGRVRTIKRLVDRM
LPXB_MAGSA      LRRVKQTISDIETKRPDALVTIDSWGFNGRIQAGLKARGVPVPRIHYVAPMVWAWKSGRXXXXXXXXXXX
LPXB_CHLPN      YRNYRKILKTILKHKPATLIFIDFPDFHLLLIKKLRKHGYRGKIIHYVCPSIWAWRPKRKRILEQHLDML
LPXB_SHEWM      LKVRKTLIDEICAIKPDCFIGIDAPDFNIGLELKL--KDRGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB_SHESW      LKVRASLIKDITALKPDCFIGIDAPDFNIGLELKL--KARGIKTVHYVSPSVWAWRPKRIFKIAKATHMV
LPXB_SHEPC      LKVRASLIKDITALKPDCFIGIDAPDFNIGLELKL--KARGIKTVHYVSPSVWAWRPKRIFKIAKATHMV
LPXB_FRATW      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRATT      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRATO      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRATN      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSVGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRATM      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRATH      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRATF      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_FRAT1      LSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKELRSAGIKTIH--YVSPKIWVWREYRIKKIRKATDKI
LPXB_PSEPK      XXXXXXXIQTLIEEKPDVFIGIDAPDFTLNIELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_PHOLL      LKIRKDLTTRFTELKPDVFVGIDAPDFNITLEGRLKQRGIRTIH--YVSPSVWAWRQKRVFKIGKATDMV
LPXB_NITWN      VRRIRGTADAVIAAAPDVLVIIDSPDFTHXXXXXXXXXXXGLPIVDYVSPSVWAWRSGRARAMRSYVDHV
LPXB_NEIMA      LRIRRGLVRDLLSLKPDVFVGIDAPDFNLGVAERL--KRSGIPTVHYVSPSVWAWRRERVGKIVHQVNRV
LPXB_RHOP2      XXXXXXTADAVLGAKPDMLIIIDSPDFTHRVARRVRVRDPSIAIVNYVSPTVWAWRPGRARAMRRYVDHV
LPXB_CHLFF      FKKYRRLYKAILQENPETVFCIDFPDFHFFLIKKLRKCGYKGKIIHYVCPSIWAWRPKRKKILEKYLDTL
LPXB_BLOPB      LYIRRNLARRFINLKPDVFIGIDSPDFNISLENRLKKRGIRTIH--YVSPSVWAWRKKRIFALKKATDNI
LPXB_METFK      LKIRKEVAQYFLDHRPDVFIGIDAPDFNFTLERKL--KHQGIPTVHYVSPSIWAWRRGKIKKIQQAVSHM
LPXB_GEOLS      XXXXXXXXXXXXXXXXXXXXXXXXXGFNLRLXXXXXXXXXXXLY--YISPQIWAWRQGRVKKIKRLVDHM
LPXB_PSEP1      XXXXXXXIQTLIEEKPDVFIGIDAPDFTLNIELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_WIGBR      LNIRNKIFNRLSFLKPDLFIGIDSPEFNIHLEFKLKKNGIKIIH--YVSPSIWAWRKSRIFKIKESVDKV
LPXB_RHOPA      LKLIRRAVDAVLTAKPDILVIIDSPDFTHRVARRVRQRDPSIPIVDYVSPTVWAWRPGRARAMLGYVDHV
LPXB_XANAC      LKLRSAFRERVLAWKPDVFIGIDAPDFNLPVER--WLKQRGIKTVHYVSPSVWAWREKRAEKIGVSADLV
LPXB_NITHX      LRRIRETADAVIAAEPDMLVIIDSPDFTHXXXXXXXXXXPALPIVDYVSPSVWAWRPGRARAMRRYVDHV
LPXB_SALPK      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALPA      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALAR      LHIRADLTRRFTALKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_CHRVO      XXXXXXXXXXXXXXXPDVFIGVDAPDFNLGL--EAGLKKGGIPTVHYVSPSVWAWRPERVQKIGRAVNHV
LPXB_SHEFN      LHIRSSLVKQITELAPDCFIGIDAPDFNIGVELKL--KAKGIKTVHYVSPSVWAWRPKRIFKIAKATNMV
LPXB2_LEGPL     YFIRERLLKEWTINPPDVFIGIDYPDFNLSVETRLKRQNVKTVHL--VSPKVWAWRQKRVYLIKKAVDLV
LPXB_SALTY      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKKGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALTI      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALSV      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALPC      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALPB      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALNS      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALHS      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALG2      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALEP      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALDC      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_SALCH      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTHMV
LPXB_PSEPG      XXXXXXXIQTLIDEKPDVFIGIDAPDFTLNIELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_PSEA7      XXXXXXXXXXXIDARPDVMIGIDAPDFTLGVEHRLRQAGLRTVH--YVSPSVWAWRQKRVLKIREACDLM
LPXB_NITOC      YGAMQKMRHFLEEKHPDLLILVDYPEFNLRLAKRAKTLGIKVLY--YISPQVWAWRQYRVHQIGQVVDMM
LPXB_SHIDS      LHIHADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ANADE      LGILRMLGRAAAERRPKAALLVDLPDFNLRLAARLKKLGIPVVY--YVSPTIWAWRQGRAKQIARVVDRM
LPXB_SALA4      LHIRADLTRRFTELKPDVFVGIDAPDFNITLEGNL--KKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMV
LPXB_XANCP      LKLRSAFRERVLAWKPDVFIGIDAPDFNLPVER--WLKQRGVRTVHYVSPSVWAWREKRAEKIGVSADLV
LPXB_XANC8      LKLRSAFRERVLAWKPDVFIGIDAPDFNLPVER--WLKQRGVRTVHYVSPSVWAWREKRAEKIGVSADLV
LPXB_NEIMB      LRIRRGLVRDLLSLKPDVFVGIDAPDFNLGVAEKL--KRSGIPTVHYVSPSVWAWRRERVGKIVHQVNRV
LPXB_BRAJA      LRLIRETADAVLEAVPDALVIIDSPDFTHXXXXXXXXXNPAIPIVDYVSPQLWAWRPGRARTMLGYVDHV
LPXB_PSESM      XXXXXXXXQTLIDEKPDVFIGIDAPDFTLNI--ELQLRRAGIKTVHYVSPSVWAWRQKRVLKIREGCDLM
LPXB_NEIMF      LRIRRGLVRDLLSLKPDVFVGIDAPDFNLGVAERL--KRSGIPTVHYVSPSVWAWRRERVGKIVHQVNRV
LPXB_ESCF3      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOUT      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOLU      LHIRADLTTRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOL6      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOL5      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOK1      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO81      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO7I      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO45      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO27      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_XANOR      LKLRSAFRERVLAWKPDVFIGIDAPDFNLPVER--WLKQRGIKTVHYVSPSVWAWREKRAEKIAVSADLV
LPXB_XANOM      LKLRSAFRERVLAWKPDVFIGIDAPDFNLPVER--WLKQRGIKTVHYVSPSVWAWREKRAEKIAVSADLV
LPXB_SHISS      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_SHIFL      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_SHIF8      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOSM      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGVKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOLI      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOLC      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOHS      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECODH      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECOBW      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO8A      LHIRADLTKRFGELKPDIFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO5E      LHIRADLTKRFGELKPDVFVGIDAPDFNIILEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO57      LHIRADLTKRFGELKPDVFVGIDAPDFNIILEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO24      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ANASK      LGILRMLGXXXXXXXXXXXLLVDLPDFNLRLAARLKKLGIPVVY--YVSPTIWAWRQGRAKKIARVVDRM
LPXB_XANC5      LKLRSAFRERVLAWKPDVFIGIDAPDFNLPVER--WLKQRGIKTVHYVSPSVWAWREKRAEKIGVSADLV
LPXB_PSEAB      XXXXXXXXXXXIEARPDVMIGIDAPDFTLGVEHKLRQAGLRTVH--YVSPSVWAWRQKRVLKIREACDLM
LPXB_ECOSE      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ECO55      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_PSEAE      XXXXXXXXXXXIEARPDVMIGIDAPDFTLGVEHKLRQAGLRTVH--YVSPSVWAWRQKRVLKIREACDLM
LPXB_PSEA8      XXXXXXXXXXXIEARPDVMIGIDAPDFTLGVEHKLRQAGLRTVH--YVSPSVWAWRQKRVLKIREACDLM
LPXB_SYNAS      LTVMHRLKKSMQLLKPDLVILIDYPDFNLPLARSAKKNGIPVFY--YISPQVWAWRKGRLRTISGLVDRM
LPXB_SHIBS      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_SHIB3      LHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_ACIBL      YGEFHKLLREADRRKPDVAVLIDFPDFHFRLAKALHARGIPVVY--YVSPQLWAWRRGRIKLVQRYVKKM
LPXB_ANAD2      LGILRMLGXXXXXXXXXXXLLVDLPDFNLRLAARLKKLGIPVVY--YVSPTIWAWRQGRAKKIARVVDRM
LPXB_PSEFS      XXXXXXXIQTLIEEKPDVFIGIDAPDFTLTLELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_DECAR      AGIXXXXXXXXXXXXPDIFIGVDAPDFNLGLETNLKAAGVRTIH--YVSPSIWAWRGGRVKKIAKAVNRV
LPXB_ENT38      LHIRADLTGRFTDLKPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTDMV
LPXB_CHLAB      IKKYRKLYKAILKENPEIVFCIDFPDFHFFLIKKLRKCGYTGKIVHYVCPSIWAWRPKRKKILEKYLDTL
LPXB_PSEPW      XXXXXALIQTLIAEKPDVFIGIDAPDFTLNIELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_CHRSD      IKVRRHLRRDALAWQPDVMIGIDAPDFNLGLERQLRATGMRTVH--YVSPSVWAWRQGRVKTIARSVDAM
LPXB_BURP8      LGIRNELKRQLLAEPPSAFIGVDAPDFNFGLEHPLRDAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_ERWCT      LKIRRDLTQRFSELQPDVFVGIDAPDFNITLEGNLKQHGINTIH--YVSPSVWAWRQKRVFKIGKATNLV
LPXB_XYLFM      LKIRREFCKRALAWHPDVLIGIDAPDFNLTVER--WFKQRHIRTVHYVSPSIWAWREKRAAKIGASVDRV
LPXB_AZOSE      SGIRKALLRRVQADRPDAFIGVDAPDFNLWLEGRIRSSGIPAIH--FVSPSIWAWRGGRIKGIARSVSHM
LPXB_AZOSB      SGIRKKLLKQVRRERPDAFIGVDAPDFNLWLEGKIKAAGIPAIH--FVSPSIWAWRGGRIKRIARSVTRM
LPXB_PSEE4      XXXXXXXIATLIDEKPDVFIGIDAPDFTLNIELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_CELJU      LRIRKFLREHFTANPPSVFIGIDSPDFTIPLEGALKEKGIKTVH--YVSPSVWAWRQKRIINIARSVDLM
LPXB_PECCP      LKIRRDLTQRFSELQPDVFVGIDAPDFNITLEGNLKQRGINTIH--YVSPSVWAWRQKRVFKIGKATNLV
LPXB_KLEP7      LHIRADLTRRFGELRPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRSTDLV
LPXB_ACIC5      YGEYLKLKRSIIERKPDLAILIDFPDVNLSLARTLHEQGTPVLY--FVSPQLWAWKKYRIRKVQRYVDRM
LPXB_PELCD      WRAFRK-LKKILHGRPDALVLIDFAEFNLLLAAQAKKAGVPVLY--YVSPQVWAWRRGRVRRIASVVDRL
LPXB_CYAP7      WKLQRKAKQYLQENPPDLLILIDYCGPNVAIGKYARKNIPQVPILYYIAPQAWVWTTNKTQDLVNITDHL
LPXB_CITK8      LHIRADLTRRFTELQPDVFVGIDAPDFNITLEGNL--KKQGIKTIHYVSPSVWAWRQKRVFKIGRSTNMV
LPXB_PSEPF      XXXXXDLIATLIAEKPDVFIGIDAPDFNLNIELKLRQAGIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_BURCJ      LRIRGELKRQLLAERPDAFIGVDAPDFNFSVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_XYLFT      LKIRREFCKRALAWHPDVLIGIDAPDFNLTVER--WFKQRHIRTVHYVSPSIWAWREKRAAKIGASVDRV
LPXB_XYLF2      LKIRREFCKRALAWHPDVLIGIDAPDFNLTVER--WFKQRHIRTVHYVSPSIWAWREKRAAKIGASVDRV
LPXB_KLEP3      LHIRADLTRRFGELRPDVFVGIDAPDFNITLEGNLKKQGIKTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_BURM1      LRIRGELKRQLLAERPDAFIGVDAPDFNFNVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_YERPS      XKIRKDLTQRFSELSPDVFVGIDAPDFNITLEGRLKQRGIRTIH--YVSPSVWAWRQKRVFKIGKATDMV
LPXB_YERPE      XKIRKDLTQRFSELSPDVFVGIDAPDFNITLEGRLKQRGIRTIH--YVSPSVWAWRQKRVFKIGKATDMV
LPXB_PSEMY      XXXXXXXARDLIAAKPDVFIGIDAPDFNLGLELKLRRAGIKTVH--YVSPSVWAWRQKRVLKIREACDLM
LPXB_XYLFA      LKIRREFCKRALAWHPDVLIGIDAPDFNLTVER--WFKQRHIRTVHYVSPSIWAWREKRAAKIGASVDRV
LPXB_SERP5      XKIRKDLTRRFSDLAPDVFVGIDAPDFNITLEGRLKQRGIRTIH--YVSPSVWAWRQKRVFKIGKATDLV
LPXB_AZOVD      XXXXXXXXXXXXXARPDLYIGIDAPDFNLGI--ELRLRRAGIRTVHYVSPSVWAWRQKRVLKIRQACDLM
LPXB_BURCH      LRIRGELKRQLLAERPAAFIGVDAPDFNFNVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_BURCC      LRIRGELKRQLLAERPAAFIGVDAPDFNFNVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_BURCA      LRIRGELKRQLLAERPAAFIGVDAPDFNFNVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_NEIG1      XXXXXXXXXXXXSLKPDVFVGIDAPDFNLGVAEKLKRAGIPTLH--YVSPSVWAWRRERVGKIVHQVNRV
LPXB_CHLTR      WYRYQLLYRNILKTNPRTVICIDFPDFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVXXXXXXXX
LPXB_CHLTA      WYRYQLLYRNILKTNPRTVICIDFPDFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVXXXXXXXX
LPXB_SILPO      KRRIAETAQAVLAMRPDVMITIDSPDFSLRVA-RLVKDASDIRTVHYVAPSVWAWRPGRADKMAKVIDHV
LPXB_PSE14      XXXXXXXXQTLINEKPDVFIGIDAPDFTLNI--ELQLRRAGIKTVHYVSPSVWAWRQKRVLKIREGCDLM
LPXB_BURVG      LRIRGELKRQLLAERPDAFIGVDAPDFNFNVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_PSEU2      XXXXXXXXQTLINEKPDVFIGIDAPDFTLNI--ELQLRRAGIKTVHYVSPSVWAWRQKRVLKIREGCDLM
LPXB_BURS3      LRIRGELKRQLLAERPDAFIGVDAPDFNFNVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_PSEF5      XXXXXXXIQTLIAEKPDVFIGIDAPDFTLNIELKLRQARIKTVH--YVSPSVWAWRQKRVLKIREGCDLM
LPXB_BURCM      LRIRGELKRQLLAERPDAFIGVDAPDFNFSVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_BURA4      LRIRGELKRQLLAERPDAFIGVDAPDFNFSVEQAARDAGIPSIH--FVCPSIWAWRGGRIKKIAKSVDHM
LPXB_CHLMU      WYRRRILYKTILKRNPQAVICIDFPDFHFLLIKKLRSLGYKGKIVHYVCPSIWAWRPSRKTTXXXXXXXX
LPXB_RALEJ      LATRRAIRDSLLANPPLCFIGVDAPDFNFGL--EVPLRRAGIPVVHFVSPSIWAWRGGRIRTIARAVDHI
LPXB_ERWT9      XXXXXXXXXXFTALKPDVFVGIDAPDFNITLEGRLKQQGIRTIH--YVSPSVWAWRQKRVFKIGRATDLV
LPXB_RALSO      LAIRRELKQNLLADPPMAFIGVDAPDFNFNV--EIAMRRAGVPVVHFVSPSIWAWRAGRIKTIARAVDHI
LPXB_CAMJR      KKAIKELVNLTLSQTMDAVLCIDSPAFNIPFAKALKKAGSKIPRIYYILPQVWAWKKGRIPIIESHFDIL
LPXB_CAMJ8      KKAIKELVNLTLSQTMDAVLCIDSPAFNIPFAKALKKAGSKIPRIYYILPQVWAWKKGRIPIIESHFDIL
LPXB_ALHEH      XXXXXXXVARYRTDPPDVFVGIDLPDFNLSIERRLKAVGVPTVH--YVSPQVWAWRQGRVRTIGRSVDRI
LPXB_THIDA      LWIRARITRHFLRERPRVFVGIDAPDFTLEAALK----RAGVPTIHFVSPSIWAWRPERIERIKQAVSHM
LPXB_BURPP      LGIRNELKRQLLAEPPSVFVGVDAPDFNFGLEHPLREAGIPTVH--FVCPSIWAWRGGRIKKIAKAVDHM
LPXB_BURXL      LGIRTELKRQLLAEPPSVFVGVDAPDFNFGLEHPLRDAGIPTVH--FVCPSIWAWRGGRIKKIAKAVDHM
LPXB_AQUAE      LKIYRKILKNLK--NTDTLIACDAPALNLRLI-KDARKLGVKRIIYFISPQVWAWKPKRAEIIANYCDHV
LPXB_RALME      LATRREIREQLLARPPLCFIGVDAPDFNFGL--EVPLRRAGIPVVHFVSPSIWAWRGGRIRTIARAVDHI
LPXB_BORPE      LSTYGDVKRRLLAEPPSVFVGIDAPDFNLRLEHQLRQAGTPTVH--FVGPSIWAWRYERINKIRAAVSHM
LPXB_BORPA      LSTYGDVKRRLLAEPPSVFVGIDAPDFNLRLEHQLRQAGTPTVH--FVGPSIWAWRYERINKIRAAVSHM
LPXB_BORBR      LSTYGDVKRRLLAEPPSVFVGIDAPDFNLRLEHQLRQAGTPTVH--FVGPSIWAWRYERINKIRAAVSHM
LPXB_SODGM      XXXXXXXXXXFTALRPDVFVGIDAPDFTITLEGRLKRRGIRTIH--YVSPSVWAWRQKRVFKIGRATDNV
LPXB_CAMJE      KKAIKELANLSFTQKINGILCIDSPAFNIPFAKALKKAGSKIPRIYYILPQVWAWKKGRIPIIESHFDIL
LPXB_BORA1      LSIYGQTKQRMLAERPAAFVGIDAPDFNLRL--ELQLRQAGIPTVHFVGPSIWAWRYERIHKIRAAVSHM
LPXB_VEREI      XXXXXXXXXXXXXXXPALFIGIDAPDFNLGL--EADLRAAGVKTVHFVCPSIWAWRAHRVGQIRRSADHV
LPXB_BORPD      LRTYGDVKRRWLASPPSVFVGVDAPDFNLKL--ELALRQAGTPTVHFVGPSIWAWRYERIHKIREAVSHM
LPXB_BURPS      LRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURP6      LRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURP0      LRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURMS      LRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURMA      LRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURTA      LRIRGELKRQLLAEPPDAFIGIDAPDFNFGLEQALRGAGIPTVH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_RHOFD      VGIXXXXXXXXXXXXPDVFIGVDAPDFNLDLEQDLKAQGIKTVH--FVSPSIWAWRPERVEKIRRSVDHV
LPXB_BURM9      LRIRGELKRQLFAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURM7      LRIRGELKRQLFAEPPDAFVGIDAPDFNFGLEQALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_BURP1      LRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEPALRGAGIPTIH--FVCPSIWAWRGGRIKKIVKAVDHM
LPXB_SYNY3      -------VKRYLKTNPDLLVLIDYMGPNLTIANYLRKTYPNLPILYYIAPQAWVWSKRETAQIMAVTDRL
LPXB_PROM3      LRLQSRVDHVLKQRPPDAVVLIDYMGANVRLGHKLRRWFPRVPIIYYIAPQEWAWRDGGTTQLLSFTDRI
LPXB_HELPH      LKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKSLEKYCDFL
LPXB_HELPY      LKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKSLEKYCDFL
LPXB_HELPG      LKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKSLEKYCDFL
LPXB_HELP2      LKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKSLEKYCDFL
LPXB_HELPS      LKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKSLEKYCDFL
LPXB_HELAH      FKVYKEMIQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKTLEKYCDFL
LPXB_HELPJ      LKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAXXXXXXXXXXXIMYYILPQVWAWKKWRAKSLEKYCDFL
LPXB_PROMM      LRLQSRVDHVLKQRPPDAVVLIDYMGANVRLGHKLRRWFPRVPIIYYIAPQEWAWRDGGTTQLLSFTDRI
LPXB_PROMI      LKIRKDLTQRFTQLKPDVFVGIDAPDFNITLEGRL--KQKGLKTIHYVSPSVWAWRQKRV----------
MURG_CLOTH      ------------------------------------------------------------KILSKFVDRV
MURG_THEPX      ------------------------------------------------------------KVLSRFVKVV
MURG_THEP3      ------------------------------------------------------------KVLSRFVKVV
KDTA_RICCN      --------------------------------------------------KAWLQRKSFFQLILKNCSKI
MURG_BACSU      ------------------------------------------------------------KFLSKYVNKV
YL271_MIMIV     ----------------------------------------------------------------------
SYW_RICTY       ----------------------------------------------------------------------
SYW_RICPR       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLLFNFEKKYFDEENIKNTFVGHPLIEKKDNVITSLDNLISKDKKIISLFPGSRKSETSVLLPILLNFIK
LPXB_RICBR      FALLPFEPPYFTKVGLDCRYIGHPIMEQEDKVALRQELEIDEDTKVLCVTLGSRKGEILRHLPIFIPAIE
LPXB_RICB8      FALLPFEPPYFTKVGLDCRYIGHPIMEQEDKVALRQELEIDEDTKVLCVTLGSRKGEILRHLPIFIPAIE
LPXB_GLUOX      LCLLPFEPDWFAQRGLEGRFVGHPVLQRQGNAQRRLRHNIPAHAPVVILMPGSRRSEAPRLLPVFRKMLD
LPXB_RICTY      FALLPFEPPYFTKVGLDCRYIGHPILEQRDKIALRKEFKIDDNESILCVTFGTRKGEILRHLPIFITAIQ
LPXB_RICCK      FAVLPFESPYFTKVGLDCRYIGHPIMEQEDKIALRKEFKIDENEKVLCVTLGSRRGEILRHLPVFIASIE
LPXB_RICFE      FALLPFEPPYFTRLGLDCRYIGHPIMEQEDKVALRKEFKIDENERVLCVTLGSRKGEILRHLPVFVSSIE
LPXB_RICCN      FALLPFEPPYFTKVGLDCRYIGHPIMEQEDKIALREEFKIDENERVLCVTLGSRKGEILRHLSVFVSSIE
LPXB_COLP3      LALLPFEKAFYDKHNVPCTFVGHPLIPMQSDKVLARDKLLAQDKKILALMPGSRGGELSRLLEDFFESAK
LPXB_RHOCS      LALLPFEPPYFEAVGLPCTFVGHPVVESGDGERFRRRHGIAPDATVLTVLPGSRRSEVTKLLPDFGATLE
LPXB_COXBU      AVLFDFEEKLYQKENVPVSFVGHPLANASRNEICKQFNL-DPDKPIVALFPGSREQEINKLLPMMVQAGK
LPXB_COXBR      AVLFDFEEKLYQKENVPVSFVGHPLANASRNEICKQFNL-DPDKPIVALFPGSREQEINKLLPMMVQAGK
LPXB_ACIAD      LCLFPFEKNFYEQHSVRAAFVGHPLLPLNNSLVEAKQALLNPEKTYIALLPGSRKGEVERLLPMLLGSAE
LPXB_RICPR      FALLPFEPPYFTKVGLDCRYIGHPIMEQRDKIALRKELKIDENERILCVTLGTRKGEILRHLPIFIDAIQ
LPXB_SULSY      ISILPFEEEIYKSDKFKFAYVGHPLLENEDSFKQKLN--IPKNKRIIGLLAGSRESEVNVILPILIEAAR
LPXB_MAGSM      LCLFPFEPRYYANTGLEAHFVGHPLVQEAVPSYSRSEARVSEAGQLVAIMPGSRRSEIQRLLETFLRTAE
LPXB_GRABC      LCLLPFEEKWFAERNVPGQFVGHPVLEQGDAARFRARHSLADNARVIVLMPGSRANEAGRLLPVYGETLR
LPXB_PERMH      IAIWPFEKEIYTDDSFRVEYVGHPILDXXXXXXXXXXXXXXXXXXXXXLLPGSRESEVKTLLPILLSSAE
LPXB_RICAH      FALLPFEPPYFTKVGLDCRYIGHPIMEQEDKIALREEFKIDKNERVLCVTLGSRQGEIRKHLPVFISSIE
LPXB_COXBN      AVLFDFEEKLYQKENVPVSFVGHPLANASRNEICKQFNL-DPDKPIVALFPGSREQEINKLLPMMVQAGK
LPXB_COXB2      AVLFDFEEKLYQKENVPVSFVGHPLANASRNEICKQFNL-DPDKPIVALFPGSREQEINKLLPMMVQAGK
LPXB_COXB1      AVLFDFEEKLYQKENVPVSFVGHPLANASRNEICKQFNL-DLDKPIVALFPGSREQEINKLLPMMVQAGK
LPXB_GEOMG      AVVFPFEVPFYEKAGVPVSFVGHPLADRVSPSMSRSEALLDPSRRVVGLFPGSRRGEIARLFPVILESAK
LPXB_GEOSL      AVVFPFEVPFYERAGVPVSFVGHPLADRRDEALASFG--LDPGRRVVGLFPGSRRGEIAKLFPVILESAQ
LPXB1_LEGPL     AVIFPFEKTIYENAGVPVSFVGHPLVKKKDKHSSRTSLGLPLNEPIIALLPGSRHSEIERHIPILVNTAK
LPXB_IDILO      LCLLPFEKDFYDKHQLPATFVGHPLADPMQWQQTEARNELELEPAVLAILPGSRKGEIARMAPVFLKVAN
LPXB_PSYIN      LAFLPFEKAFYDRFDVPCRFIGHPLEPEKQQARQSLG--LQADAKLLAILPGSRKAEVEILGPIFLQSAA
LPXB1_LEGPH     AVIFPFEKTIYENAGVPVSFVGHPLVKKKHSGRTSLG--LPLNEPIIALLPGSRHSEIERHIPILVNTAK
LPXB_VIBHB      LAFLPFEKAFYDKFNVPCEFIGHTLADQSDKASAREILGLEQDKQWLSVLPGSRGSELKMLSQPFIETCK
LPXB1_LEGPA     AVIFPFEKTIYENAGVPVSFVGHPLVKKKDKHSSRTFLGLPLDEPIIALLPGSRHSEIERHIPILVNTAK
LPXB_DESPS      GVILPFEEEFFRQRGQAASYVGHPLLDNV-SIKLSREEFLTKHRKYVGLLPGSREKEISALLPDFLRAAK
LPXB_SHEHH      LSLLPFEKAFYDKHQVPCTFVGHTLIELESDKAQARELLLDKEAEYLAILPGSRGGELKMLAEPFVKAAS
LPXB_HAHCH      LTLLPFEARFYREHNVPVKFVGHPLAEHPDKVAMRHELGIDASGEVIAVLPGSRGGEVSRLGPTFIETIA
LPXB_ALCBS      LTLLPFEARFYEEHDVPVAFVGHPLADRTDVXXXXXXXXXXXXXXXXXVLPGSRGGEVGQLMPAFLDAMV
LPXB_VIBPA      LAFLPFEKAFYDKFNVPCEFIGHTLIPLQSEQAPARDLLLEQDKKWLAVLPGSRGSELKMLSQPFIETCK
LPXB_VIBFM      LAFLPFEKAFYDKYNVACEFIGHTLIPMETDKFAARELLLEQDRKWLAVLPGSRGGEVALIAKPFIETCQ
LPXB_AERHH      LAFLPFEKAFYDRFDAPCRFVGHPLVPDQAAVRRTLG--IDANRRWLAVLPGSRSAEVGFMSPLFLEACK
LPXB_VIBF1      LAFLPFEKAFYDKYNVACEFIGHTLIPMETDKIAARDLLLEQEREWLAVLPGSRGGEVALIAKPFIETCQ
LPXB_PHOPR      LAFLPFEKAFYDKFNVPCEFVGHTMLETDKAAAQALLNL-DGSKRWLAVLPGSRGSEMGMLAAPFIETCK
LPXB_ALTMD      LGLFPFEQQVYDKYHVPYTFVGHTMADEPDQNAARQELGVESNAYVLAVLPGSRRGEVETLLPVFLETIE
LPXB_ACTP7      LAFLPFEKAFYDRFNVPCRFIGHTMIALKPNRSEACATLLDETQRYLAILVGSRASEVRFLAEPFLKAAK
LPXB_FRAP2      LAILPFEVEYYNRHNFEAIYVGHPLAK---NISLEIDR--SKYKKILSVLPGSRTTEVTRLLPLFLDAIE
LPXB_ACTPJ      LAFLPFEKAFYDRFNVPCRFIGHTMIALKPNRSEACATLLDETQRYLAILVGSRASEVRFLAEPFLKAAQ
LPXB_MANSM      LAFLPFEKAFYDRFNVPCRFIGHPLNPNRTEACKMLN--IDENQRYVAILAGSRGSEVEFLAEPFLQTAQ
LPXB_THICR      LVLFPFETAYYDKYGIPSKFVGHPLADSPDKHSARQQLGLSSDTPVTGILPGSRSSEINLMIDVYVQVAT
LPXB_SHEPA      LSLLPFEKAFYDEYQVPCTFVGHTLIELESDKAQARELLLDKEAEYLAILPGSRGGELKMLAEPFVKAAS
LPXB_HAEI8      LAFLPFEKAFYDKFNVPCRFIGHTMIPLKPNRAEACQMLIDPAQRYLAILVGSRGSEVEFLAEPFLKTAL
LPXB_ACTP2      LAFLPFEKAFYDRFNVPCRFIGHTMADKPNRAEACVGLNLDEAQRYLAILVGSRASEVGFLAEPFLKAAQ
LPXB_HAES1      LAFLPFEKAFYDRFNVPCRFVGHTMADQPDRQDACFQLNLEPKHRYVAILVGSREAEVQFLTPPFLQTAQ
LPXB_HAEPS      LAFLPFEKAFYDRFNVPCRFIGHTMADNRQEACRLLQ--LDENQHYVAILVGSRGSEVNFLSEPFLKTAQ
LPXB2_LEGPA     LTLFPFEEAFYLQHGVSAQFIGHPLADLIE-INPSCSALRKKDDTILAVLPGSRVGEIKYMGPLFLEVMQ
LPXB_VIBVY      LAFLPFEKAFYDKFNVPCEFIGHTLADESDKAPARELLGLEQDKQWLAVLPGSRGSELKMLSQPFIETCK
LPXB_VIBVU      LAFLPFEKAFYDKFNVPCEFIGHTLADESDKAPARELLGLEQDKQWLAVLPGSRGSELKMLSQPFIETCK
LPXB_HAEIG      LAFLPFEKAFYDKFNVPCRFIGHTMIPLKPNRAEACQMLIDPAQRYLAILVGSRGSEVEFLAEPFLKTAL
LPXB_SHELP      LSLLPFEKAFYDKHNVPCTFVGHTL---ADDIPLESDKLSAREAEYLAILPGSRGGELKQLAEPFVQAAV
LPXB_HAES2      LAFLPFEKAFYDRFNVPCRFVGHTMADQPDRQDACFQLNLEPKHRYVAILVGSREAEVQFLTPPFLQTAQ
LPXB_ALISL      LAFLPFEKVFYDKYNVACEFIGHTLADQSDKIAARKLLGLELDRQWLAVLPGSRGGEVALIAKPFIETCQ
LPXB_HAEIN      LAFLPFEKAFYDKFNVPCRFIGHTMIPLKPNRAEACQTLIDPAQRYLAILVGSRGSEVEFLAEPFLKTAL
LPXB_SACD2      LTLFPFESSFFNEQNIPNLFVGHPLADEKTGARERLGLSAENNERWVALLPGSRGGEVEHLCERFLLAAQ
LPXB_HAEIE      LAFLPFEKAFYDKFNVPCRFIGHTMIPLKPNRAEACQTLIDPAQRYLAILVGSRGSEVEFLAEPFLKTAL
LPXB_HAEDU      LAFLPFEKAFYDRFNVACRFIGHTMIALKPNRTEACQILIDENQRYLAILAGSRASEVDFLAEPFLKAAL
LPXB2_LEGPH     LTLFPFEEAFYRQHGVSAQFIGHPLADLIE-INPSCSTLRKKDDTILAVLPGSRVGEIKYMGPLFLEVMQ
LPXB_SHESM      LSLLPFEKAFYDKHQVPCTFVGHTLADESDKASARQLLELDPDAEYLAILPGSRGGELKQLAEPFVKAAL
LPXB_SHESR      LSLLPFEKAFYDKHQVPCTFVGHTLADESDKASARQLLELDPDAEYLAILPGSRGGELKQLAEPFVKAAL
LPXB_SHESA      LSLLPFEKAFYDKHQVPCTFVGHTLADESDKASARQLLELDPEAEYLAILPGSRGGELKQLAEPFVKAAL
LPXB_PSEHT      LALLPFEKEFYDKHQVPCTFVGHTLADEHDDSKARKELGLSPDDKVLALLPGSRGSEVGLLSETYIKTAV
LPXB_RHOPB      LALLPFEDEYRRLQGPPCSYVGHPLTEQIATLRPNPEEQLRRDPPVLLVLPGSRRSEIRHHMAVFGEALG
LPXB_CHLCV      LLILPFEKEIFKDSPLKTIYLGHPLVKTIANFQDCKQQLEISDQPSVALFPGSRPGDIFRNLQVQARAFR
LPXB_SHEB2      LSLLPFEKAFYDQHQVPCTFVGHTLADQSXXXXXXXXXXXXXXXEYLAILPGSRGGELKQLAEPFVKAAL
LPXB_SHEAM      LSLLPFEKAFYDQHQVPCTFVGHTLADDIPLELSKADARLDRDAEYLAILPGSRGGELKMLSEPFIKAAV
LPXB_SHEON      LSLLPFEKAFYDKHQVPCTFVGHTLADESDKACARQVLELDQEAEYLAILPGSRGGELKQLAEPFVKAAL
LPXB_SHESH      LSLLPFEKAFYDKHDVPCTFVGHPLISDK----TAARNLLDADAEYLAVLPGSRGGELKQLAEPFVKAAS
LPXB_PASMU      LAFLPFEKAFYDRFEVPCRFIGHTMIALKPNRQEACEYLLDASQRYVAILVGSRGSEVTFLAEPFLQAAK
LPXB_BLOFL      LLLFPFEKSIYARCGIPNQFIGHPLADEPNKIALRQKFDIPSNRCCLAILPGSRPKEIQILTKIFMHCAK
LPXB_VIBCM      LAFLPFEKAFYDKFNVPCEFIGHTL---ADSIPLASDKLLDEQRRWLAVLPGSRGSEMKMLAEPFIATCQ
LPXB_VIBCH      LAFLPFEKAFYDKFNVPCEFIGHTL---ADSIPLASDKLLDEQRRWLAVLPGSRGSEMKMLAEPFIATCQ
LPXB_VIBC3      LAFLPFEKAFYDKFNVPCEFIGHTL---ADSIPLASDKLLDEQRRWLAVLPGSRGSEMKMLAEPFIATCQ
LPXB_SOLUE      LCIFPFEEEFFRRYGVPATYIGHPLAGLVHPALSREEHRLAAERPLVSVLPGSRRGEAARHIPALLDAVD
LPXB_MYXXD      LCILPFEEDFYREAGVSARYVGSPVVEQPDTATAFRERLLSKDAPTLALLPGSRMGEIRRLLPDMVEAAK
LPXB_MAGSA      XXXXPNEPEWFEKEGLKTLHVGHPVIERGDGAAFRVRHGFAPDRKLLCVLPGSRHSETAKLLAPFGETIA
LPXB_CHLPN      LLILPFEEGLFKNTSLETVYLGHPLVEEISDYASWKEKFLNSDRPIVAAFPGSRRGDISRNLRIQVQAF-
LPXB_SHEWM      LSLLPFEKAFYDRHDVPCTFVGHTL---ADDIPMSSDKSAARQQEYLAVLPGSRGGELKQLAEPFVKAAS
LPXB_SHESW      LSLLPFEKAFYDKHQVPCTFVGHTLADRSDKAAARQXXXXXXXXXXXXXXPGSRGGELKQLAEPFVKAAL
LPXB_SHEPC      LSLLPFEKAFYDKHQVPCTFVGHTLADRSDKAAARQXXXXXXXXXXXXXXPGSRGGELKQLAEPFVKAAL
LPXB_FRATW      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRATT      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRATO      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRATN      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRTKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRATM      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRATH      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRATF      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_FRAT1      LAILPFETEYYNRHKFEAIYVGHPLAK---NIPIHIDRAKYRDKPILSVLPGSRTTEVSRXXXXXXXXXX
LPXB_PSEPK      LTLLPFEARFYEEQGVPVRFVGHPL---ADTIPLEADRPAAREGPVVALMPGSRGGEVGRLGALFLDAAE
LPXB_PHOLL      LAFLPFEKAFYDKFNVPCRFIGHTMADAQPNKATARELLILPESVCLALLPGSRHSEVEMLSADFLKTAQ
LPXB_NITWN      LALLPFEPEAYRRGGPPCTYVGHPLLEQIGVLRPDAQERQRRDADTLLVLPGSRRSEIRHHLSVFGETIG
LPXB_NEIMA      LCLFPMEPQLYLDAGGRAEFVGHPLMPLEDDRETARKTLVDAGIPVFALLPGSRVSEIDYMAPVFFQTAL
LPXB_RHOP2      LALLPFEEEYRRLRGPPCTYVGHPLTEQIAHLRPSPAEQARRDAEVLVVLPGSRRSEIHHLMAVFGETLG
LPXB_CHLFF      LLILPFEKDLFINSPLKTIYLGHPLVKTISNCSSWKQQLSISDQPIVALFPGSRPGDIFRNLQVQIRAFL
LPXB_BLOPB      LVILPFEKKIYDHFNIPCQFIGHSLADQNPNKVSARQKLIPHDVYCLAVLPGSRIREIKMLAHDFLVCAK
LPXB_METFK      LALFPFEPEIYRQAGVAVSYVGHPLADEPDMEGAREELKLPQDSLVVAMLPGSRQSEVQQLADLYIKTAK
LPXB_GEOLS      AVILPFEVPFYEQAGVPVSFVGHPMADTRDQAATSFG--LDTSRQIVGLFPGSRRSEVSRLLPTILEAAR
LPXB_PSEP1      LTLLPFEARFYEEQGVPVRFVGHPL---ADTIPLEADRPAAREGPVVALMPGSRGGEVGRLGALFLDAAE
LPXB_WIGBR      LALLPFEKKIYDDFNIPCKFVGHPLADKKYSIRSNLE--IDKNSVCLALLPGSRLTEINLLSKKFLYAAX
LPXB_RHOPA      LALLPFEAEYRRLQGPPCSYVGHPLTEQFGSLRPDAAEQARREASVLLVLPGSRRSEVRHHAAAFGDTLA
LPXB_XANAC      LCLFPMEPPIYAKHGVDARFVGHPMADQSDRAAARATLGLSASSTVLAVLPGSRHGEISRLGDTFFQAAW
LPXB_NITHX      LALLPFEEEYRRLAGPPCTYVGHPLIEQVGMLRPDAQERQRRDAPALLVLPGSRRSEIDHHMAVFGETLR
LPXB_SALPK      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALPA      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALAR      LAFLPFEKAFYDKFNVPCRFIGHTMADAMPNKNTARDVLIPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_CHRVO      LCLFPMEPPLYRQAGVPVTYVGHPLIPLEPDREAMRDQLLPQGVPVFTLMPGSRQSELEYMVPIYLDTAR
LPXB_SHEFN      LSLLPFEKAFYDQHQVPCTFVGHTL---ADDIPMHSDKLAARNAEYLAVLPGSRGGELKQLAEPFVKAAQ
LPXB2_LEGPL     LTLFPFEESFYQQYDVPAQFVGHPLADNPNNADLRKKYNYKPDDTILAVLPGSRIGEIKYIGPLFLEVMQ
LPXB_SALTY      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALTI      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALSV      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALPC      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALPB      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALNS      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALHS      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALG2      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALEP      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALDC      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SALCH      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_PSEPG      LTLLPFEARFYEEQGVPVRFVGHPL---ADTIPLEADRSVAREGPIVALMPGSRGGEVGRLGALFLDAAE
LPXB_PSEA7      LALFPFEARFYEEHGVPVRFVGHPLANQADRVAARERLGLPLDGQVVALMPGSRGGEVGKLGELFLDTAQ
LPXB_NITOC      AVVLPFEVPFYEQAGVPVNFVGHPLQHEVKSKFNRNEAVVNPCCKTLGLLPGSRHSEIKRLLPVLLEAAE
LPXB_SHIDS      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDTHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ANADE      LCILPFEERFYEGTGVSARFVGHPFAERPESYRSALG--LPAARTTIAMVPGSRPSELKRLLPPMLEAAE
LPXB_SALA4      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_XANCP      LCLFPMEPPIYAKHGVDARFVGHPMADQADREAARAKLGLSTSSTVLAVLPGSRHGEISRLGDTFFQAAW
LPXB_XANC8      LCLFPMEPPIYAKHGVDARFVGHPMADQADREAARAKLGLSTSSTVLAVLPGSRHGEISRLGDTFFQAAW
LPXB_NEIMB      LCLFPMEPQLYLDAGGRAEFVGHPLMPLEDDRETARQTLVDAGIPVFALLPGSRVSEIDYMAPVFFTALL
LPXB_BRAJA      LGLLPFEEEYRKLGGPPCSYVGHPLIEQLGSLRPNAEEQKRRNSEVLLVLPGSRRSEIRHHIEVFGAALR
LPXB_PSESM      LTLLPFEARFYEEKGVPVRFVGHPLADESDRGATRAELGLSVDGPVVALMPGSRGGEVGRLGALFFDAAE
LPXB_NEIMF      LCLFPMEPQLYLDAGGRAEFVGHPLMPLEDDRETARKTLVDAGIPVFALLPGSRVSEIDYMAPVFFTALL
LPXB_ESCF3      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOUT      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOLU      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOL6      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOL5      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOK1      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO81      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO7I      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO45      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO27      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_XANOR      LCLFPMEPPIYAKHGVDARFVGHPMADQADRDAARATLGLSASSTVLAVLPGSRHGEISRLGDTFLQAAW
LPXB_XANOM      LCLFPMEPPIYAKHGVDARFVGHPMADQADRDAARATLGLSASSTVLAVLPGSRHGEISRLGDTFLQAAW
LPXB_SHISS      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SHIFL      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SHIF8      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOSM      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOLI      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOLC      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNGARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOHS      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECODH      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECOBW      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO8A      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO5E      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNSARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO57      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNSARDVLG--IPYDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO24      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ANASK      LCILPFEERFYEGTGVSARFVGHPFAERAEAYRSALG--LPASRTTIAMVPGSRPSELKRLLPPMLQAAE
LPXB_XANC5      LCLFPMEPPIYARHGVDARFVGHPMXXXXXXXXXXXXXXLSASSTVLAVLPGSRHGEISRLGDTFFQAAW
LPXB_PSEAB      LALFPFEARFYEEHGVPVRFVGHPLANXXXXXXXXXXXXXXXXXQVVALMPGSRGGEVGKLGALFLDTAQ
LPXB_ECOSE      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ECO55      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_PSEAE      LALFPFEARFYEEHGVPVRFVGHPLANXXXXXXXXXXXXXXXXXQVLALMPGSRGGEVGKLGALFLDTAQ
LPXB_PSEA8      LALFPFEARFYEEHGVPVRFVGHPLANXXXXXXXXXXXXXXXXXQVLALMPGSRGGEVGKLGALFLDTAQ
LPXB_SYNAS      AVILPFEEPLYRQAGVDVSFVGHPLLDVVQATSSRDETLLREDVTTVALLPGSRKGEVTRLLPVMLKAAR
LPXB_SHIBS      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_SHIB3      LAFLPFEKAFYDKYNVPCRFIGHPLDPDKNAARDVLG--IPHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ACIBL      LVIFPFEEQFYREHNVEAEFTGHPLGELSVTVDPRTEFAVDPAKPWVGILPGSRRKEVQMILPTLIDAAK
LPXB_ANAD2      LCILPFEERFYEGTGVSARFVGHPFAERAEAYRSALG--LPASRTTIAMVPGSRPSELKRLLPPMLQAAE
LPXB_PSEFS      LTLLPFEARFYEEKGVPVRFVGHTL---ADTIPLQADRTAARDGPLVALMPGSRGGEVGRLASVFFDAAE
LPXB_DECAR      LALFPMEPALYEKERVPVTYVGHPLADSKQAVREKLS--LPRDYPIFAMLPGSRQGELAMMAETFVETAK
LPXB_ENT38      LAFLPFEKAFYDRFNVPCRFIGHPLDPDKNAARDSLG--IPHDAHCLALLPGSRGAEVEMLSADFLRTAQ
LPXB_CHLAB      LLILPFENELFINSPLKTIYLGHPLVKTISNCPSWKQALAISDQPIVALFPGSRPGDILRNLQVHIRAFL
LPXB_PSEPW      LTLLPFEARFYEEQGVPVRFVGHPL---ADTIPLAADRQAARAGPVVALMPGSRGGEVGRLGALFLDAAQ
LPXB_CHRSD      LTFLPFEAAFYARHQVPVAFVGHPLADENDRQAARTALGLSSTAPLLAVLPGSRGNEIRFLGPTFLDSAV
LPXB_BURP8      LCVFPFEKALLEKSGVTATYVGHPLADEPDTAGARLELGLPESGPVIAVLPGSRRSEIALIGPTFFDAME
LPXB_ERWCT      LAFLPFEKAFYDRFNVPCRFIGHTMADAMDKMTARATLGIAPDAHCLALLPGSRGAEVEMLSADFLNTAV
LPXB_XYLFM      LCLFPMEPPIYARYGIDARFVGHPMADQTDRATARTXXXXXXXXXXXXXXXXXRHSEISQLGNTFLEAAG
LPXB_AZOSE      LCLFPFEPALYEKAGIPVSYVGHPLADVPDRAAARELLSLPTDCRIVALLPGSRQSEVRSLAATYIETAR
LPXB_AZOSB      LCMFPFEPELYERAGVPVSYVGHPLADEPDRAAARERLDIAPERKVVALLPGSRQSEVRNLGELFIETAA
LPXB_PSEE4      LTLLPFEARFYEEQGVPVRFVGHPLIPLESDXXXXXXXXXXXXXPVIALMPGSRGGEVGRLGALFLDAAQ
LPXB_CELJU      LTLLPFEARFYEEHGVPVEFVGHHLADAPDNVKTAARQLLGGQGRIVALLPGSRSSEVERMAELFFRTAV
LPXB_PECCP      LAFLPFEKAFYDRFNVPCRFIGHPLHPDKQAARATLG--IAPEAHCLALLPGSRNAEVEMLSADFLKTAV
LPXB_KLEP7      LAFLPFEKAFYDKFNVPCRFIGHTM---ADAMPLDPDKGAARDRRCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_ACIC5      LVIFPFEEAFYQGHGVQADFVGHPLTEVPLPTITRAEHHLDPAKHWVGLLPGSRGKEIRLNLPEMIAAAK
LPXB_PELCD      AAIFPFEPELYQGLDIDVEYVGHPLLDERDAFLRRLG--LDPARQVIGLFPGSRKNELKYIAETILQSAV
LPXB_CYAP7      LAIFSEEARYFAQKGMSVSWVGHPILDRMAQAPTREEARIKPDQTAIALLPVSRKQELKYLLPVVCQAAQ
LPXB_CITK8      LAFLPFEKAFYDKFNVPCRFIGHPLDPDKNAARDVLG--ISHDAHCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_PSEPF      LTLLPFEARFYEEKGVPVRFVGHTLIPXXXXXXXXXXXXGLPDGPLVALMPGSRGGEVSRLGALFLDTAQ
LPXB_BURCJ      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_XYLFT      LCLFPMEPPIYARYGIDARFVGHPMADQTDRATARTXXXXXXXXXXXXXXXXXRHSEISQLGNTFLEAAG
LPXB_XYLF2      LCLFPMEPPIYARYGIDARFVGHPMADQTDRATARTXXXXXXXXXXXXXXXXXRHSEISQLGNTFLEAAG
LPXB_KLEP3      LAFLPFEKAFYDKFNVPCRFIGHTMADADPDKGAARDRLIPHNVRCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_BURM1      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_YERPS      LAFLPFEKAFYDRFNVPCRFIGHTMADAPDQQAARAELGIAPNATCLALLPGSRHSEVEMLSADFLRTAV
LPXB_YERPE      LAFLPFEKAFYDRFNVPCRFIGHTMADAPDQQAARAELGIAPNATCLALLPGSRHSEVEMLSADFLRTAV
LPXB_PSEMY      LTLFPFEAQFYDAHQVPVRFVGHPLADXXXXXXXXXXXXXXQDGPVVALMPGSRGGEVARLGDLFLDAIR
LPXB_XYLFA      LCLFPMEPPIYARYGIDARFVGHPMADQTDRATARTXXXXXXXXXXXXXXXXXRHSEISQLGSTFLEAAG
LPXB_SERP5      LAFLPFEKAFYDRFNVPCRFIGHTMADQPDKLAARAKLGIAADARCLALLPGSRGAEVEMLSADFLKTAQ
LPXB_AZOVD      LTLFPFEAEFYEARNVPVRFVGHPLADQXXXXXXXXXXXXXXGETIVALLPGSRGGELARLGPLFIEAAE
LPXB_BURCH      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_BURCC      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_BURCA      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_NEIG1      LCLFPMEPQLYLDAGGRAEFVGHPLMPLEDDRETARKTLADVGIPVFALLPGSRVSEIDYMAPVFFTALL
LPXB_CHLTR      XXXXPFEQNLFKDSALRTVYLGHPLSETIKSFSPNLDQLLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQ
LPXB_CHLTA      XXXXPFEQNLFKDSALRTVYLGHPLSETIKSFSPNLDQLLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQ
LPXB_SILPO      LALLPFEPPYMERAGMECDFVGHPVVTEPE----------------------------------------
LPXB_PSE14      LTLLPFEARFYEEKGVPVRFVGHPLADESYXXXXXXXXXXXQEAPVVALMPXXXXXXXXXXXXXFFDAAE
LPXB_BURVG      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_PSEU2      LTLLPFEARFYEEQGVPVRFVGHPLADESDXXXXXXXXXXXQETPVVALMPXXXXXXXXXXXXXFFDTAE
LPXB_BURS3      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIALIGPTFFAAMA
LPXB_PSEF5      LTLFPFEARFYEEKGVPVKFVGHSLXXXXXXXXXXXXXXXXPEGPLVALMPGSRGGEVGRLGALFLDAAQ
LPXB_BURCM      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIGLIGPTFFAAMA
LPXB_BURA4      LCLFPFEPAILDKAGVASTYVGHPLADEPDTHGARIALGLPADGPVIAVLPGSRRSEIGLIGPTFFAAMA
LPXB_CHLMU      XXXXPFEQKLFKDSPLRTVYIGHPLSEPKQNWKERLH--LPTDKPFVAAFPGSRHSDILRNLTIQVQAFQ
LPXB_RALEJ      LCLFPFEPEIYAKAGIPATYVGHPLADVIPMVPDVAGARAALDLRVVAVLPGSRQSEVRNLGATFFAAMA
LPXB_ERWT9      LAFLPFEKAFYDRFNVPCRFIGHPIVPDKQAARRELG--IAPQALCLALLPGSRSAEVEMLSADFLKTAM
LPXB_RALSO      LCLFPFEPEIYARAGIPATYVGHPLADEEPDVEGARSRLLPLGRKVVAVLPGSRNSEVKLLGPTLFAAMA
LPXB_CAMJR      ASILPFDNQFFN----KSTYIGHPLLDKEFKNQEDINHTFSKDEKTIAFLPGSRRSEIRRLMPI---FKE
LPXB_CAMJ8      ASILPFDNQFFN----KSTYIGHPLLDKEFKNQEDINHTFSKDEKTIAFLPGSRRSEIRRLMPI---FKE
LPXB_ALHEH      LALYPFEAEFYRRHGVPVDFVGHPAADRAGAARAALGLVDDGGGPWVALLPGSRLGEVQRHAELYARTVA
LPXB_THIDA      LVVFPFEEAIYRDAGIPVSYVGHPLIPLQAPTGAARATLGLGDGPIVALLPGSRLSEVDRHARLMLEAAM
LPXB_BURPP      LCVFPFETALLEKAGVAASYVGHPLADEIPLVPDTLGARLAQDGPIIAVLPGSRRSEIDLIGPTFFAAME
LPXB_BURXL      LCVFPFETALLEKAGVAASYVGHPLADEIPLVPDTLGARLAEEGPIIAVLPGSRRSEIDLIGPTFFAAIE
LPXB_AQUAE      IVILPFEKKIYRKPNLKVHYVGHPLVDLVKPQKTKEEFMKAFKKEPLPLLLGSREGE---IRRHVXXXXX
LPXB_RALME      LCLFPFEPEIYAKAGIPATYVGHPLIPMVPDVAGARAKLLPEGKRIVAVLPGSRQSEVRNLGATFFAAMD
LPXB_BORPE      LVLFPFEEALYRKEGIPVTYVGHPLAMQPDRAAARARLGIDADARVLAILPGSRSSEIRLLAPRFL----
LPXB_BORPA      LVLFPFEEALYRKEGIPVTYVGHPLAMQPDRAAARARLGIDADARVLAILPGSRSSEIRLLAPRFL----
LPXB_BORBR      LVLFPFEEALYRKEGIPVTYVGHPLAMQPDRAAARARLGIDADARVLAILPGSRSSEIRLLAPRFL----
LPXB_SODGM      LAFLPFEKAFYDCYNVPCQFIGHTLADDPDKAAARQALGIAAEARCLALLPGSRQSEVAMLSADFL----
LPXB_CAMJE      ASILPFDNQFFN----KSTYIGHPLLDKEFKNQEDINHTFSKDEKTIAFLPGSRRSEIRRLMPIFKELSQ
LPXB_BORA1      LVLFPFEEEIYQKEGIPVTYVGHPLAMRPDRAAARLRLNLDVGERVLAILPGSRSSEIRTLAPRFLQAAQ
LPXB_VEREI      LCIFPFEPALLAQHGIAATYVGHPLAAQPXXXXXXXXXXXXXXXEVLAILPGSRASEIEYLARPFFQAAA
LPXB_BORPD      LVLFPFEEELYRKEGIPVTYVGHPLADQPDRAAARQRLGLDADARVLAILPGSRSSEIRI----------
LPXB_BURPS      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPDGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURP6      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURP0      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURMS      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURMA      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURTA      LCXXXXXXXXXXKAGVAATFVGHPLADEPDMHGARIALGLPDSGPVIAVLPGSRRSEIELIGPTFFDAMA
LPXB_RHOFD      LCIFPFEPALLARHGIAATYVGHPLANEPDXXXXXXXXXXXXXXQVVAILPGSRQSEINHLALRFFQAAA
LPXB_BURM9      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURM7      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_BURP1      LCXXXXXXXXXXKAGVAATFVGHPLADEPDTHGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAME
LPXB_SYNY3      LAIFPGEAEFFQKQGLDVTWVGHPLLDRITKEAPSRGSAIDHNETVITLLPASRIQELRYLLPSICGAAQ
LPXB_PROM3      LAIFPVEAEFYAQRGAKVTWVGHPLL---DTVSVLPDRQLAREXXXXXXXPASRQQELRYLMPTLAKAAA
LPXB_HELPH      GAILPFEVGYYQK---KAQYVGHPLLDE--------IKYYKKDIKTLVFMPGSRKSEIAKIFPLFVKAAQ
LPXB_HELPY      GAILPFEVGYYQK---KAQYVGHPLLDEIKHYKKDIKG------ETLVFMPGSRKSEIAKMFPLFVKAAQ
LPXB_HELPG      GAILPFEVGYYQK---KAQYVGHPLLDE--------IKYYKKDIKTLVFMPGSRKSEIAKMFPLFVKVAQ
LPXB_HELP2      GAILPFEVGYYQK---KAQYVGHPLLDE--------IKYYKKDIKTLVFMPGSRKSEIAKMFPLFVKAAQ
LPXB_HELPS      GAILPFEVGYYQK---KAQYVGHPLLDE--------IKYYKKDIKTLVFMPGSRKSEIAKIFPLFVKVAQ
LPXB_HELAH      GAILPFEVSYYQK---KAQYVGHPLLDE--------IKYYKKDIKTLVFMPGSRKSEIAKIFPLFVEVAR
LPXB_HELPJ      GAILPFEVGYYQK---KAQYVGHPLLDE--------IKYYKKDIKTLVFMPGSRKSEIAKMFPLFVKAAQ
LPXB_PROMM      LAIFPVEAEFYSQRGAKVTWVGHPLL---DTVSVLPDRQQAREXXXXXXXXASRQQELRYLMPTLAKAAA
LPXB_PROMI      ----------------------------------------------------------------------
MURG_CLOTH      AISFKEAEKYFKDKS-KVVFTGNPIRSEMLEVSTARKKLIPKDMPLVVIFGGSRGAEN-----INSTVAE
MURG_THEPX      AVSFEESVKYFKNKE-KVVVTGNPIRRELLKVTKELKNLFYSDKPLIVSVGGSRGAEK-------INFTM
MURG_THEP3      AVSFEESVKYFKNKE-KVVVTGNPIRRELLKVTKELKNLFYSDKPLIVSVGGSRGAEK-------INFTM
KDTA_RICCN      IVQSERDLQKFNEVNLGNIKFANEKLPVNQEELSKLS--LHLDNKRVVLFASTHPEDEEVILPI----IK
MURG_BACSU      AICFEEAKSHFPSEKV--VFTGNPRASEVVSIKTSLAEFLSEDKKTVLIFGGSRGA-----APINRAVID
YL271_MIMIV     ----------------------------------------------------------------------
SYW_RICTY       ------------------------------------------DKEILKV-PDILISETGTRIMSLRNGLK
SYW_RICPR       ------------------------------------------DKEILKV-PDILISETGTRIMSLRNGLK


                         .         .         .         +         .         .         .:280
query           LMNKKKLDHLFVFHATDENKEFIINKVKKTNLDNIDIISDEDIKNQVLSNSIFAVSKSGTISLQISSANI
LPXB_RICBR      KVHKKKL--MVIFPLANPDHERIIKPFLEKVRFNY-IFSYERLKSYAVSD--LALAKSGTNTLEIAASGT
LPXB_RICB8      KVHKKKL--MVIFPLANPDHERIIKPFLEKVRFNY-IFSYERLKSYAVSD--LALAKSGTNTLEIAASGT
LPXB_GLUOX      ILRVQYPDICXXXXXXXXXXXTIRQLIRKWPIQP-HIVTDIHDKHDAFAAAQCALTKSGTSTLELAMGNV
LPXB_RICTY      KISKDYKNLRIIFPLVHPDHEAIIKPFLENVQFNYLFLSSERLKAYAVSD--LALAKSGTNTLEISASGT
LPXB_RICCK      EIFESCKNLKVIFTLVNPANEVII----KPFLENVKLFSSERLKTYALSD--LALAKSGTNTLEIAASGT
LPXB_RICFE      EIFKSCNNLKVIFTLANPAHEAIIKPFLEDVKFNY-LFSSERLKTYAVADA--ALAKSGTNTLEIAASGT
LPXB_RICCN      EIFKSCNNLKVIFTLANPAHEAIIKPFLEDVKFNY-LFSSERLKIYAVAD--VALAKSGTNTLEIAASGT
LPXB_COLP3      QLQAQDSELLFVAPMISEQRANQFNALKAELAPDLDIEIVLNQTQQVMAASDCLLTASGTVTLEAALIKR
LPXB_RHOCS      ILASRYPDLQVVVPTVPGVAETVAEAVQSWPVPAITLLGDAD-KYDXXXXXXXXXXXXXXXXXELALARV
LPXB_COXBU      LIQTQIPTVQFILPALDKIRPFLSPEIK---------VIQNDI-SYVLXXXXXXXXXSGTVTLEIALQQV
LPXB_COXBR      LIQTQIPTVQFILPALDKIRPFLSPEIK---------VIQNDI-SYVLXXXXXXXXXSGTVTLEIALQQV
LPXB_ACIAD      ILLKKYPDVEYLIPASDVRKKQIIQSIAPQYAQKLHVLENQDIGRQVMNASDIVALASGTATLEAMLLHR
LPXB_RICPR      EISKDYKNLTIIFPLAHPDHEAII----KPFLDNIQFLSNERLKAYAVSD--LALAKSGTNTLEISASGT
LPXB_SULSY      LLTKTFDDLHFVIPATVNMVDRVLEKVNTSNLSDKNLPKFENPSYEVMKNAVFSIITSGTATLEAAIIGN
LPXB_MAGSM      RLWKRRTNLSFVLIQAETISDQQLYEVWPEALRDLPVIVRHGNAYNWLAASDALLVASGTATLEAALIGI
LPXB_GRABC      LLMQNIPTITPVIPLASSTAHTVRGAVSSWPVQPI-FITXXXXXXXXXXXXXXXLTKSGTSTLELAMGGV
LPXB_PERMH      IIYRKREDLHFVIPSTP-NMEENVKQIAGSKKVPLSVITVKDFRHEVMKHSVFLNVASGTATLETAIFGN
LPXB_RICAH      EIFKSCNNLKVIFTLANPAHEAIIKPFL------------EDVQFHYLFSSXXXXXXSGTNTLEIVASGT
LPXB_COXBN      LIQTQ-----------IPTVQFILPLALNLALDKIRPFLSPEIK--VIQNDXXXXXXXGTVTLEIALQQV
LPXB_COXB2      LIQTQ-----------IPTVQFILPLALNLALDKIRPFLSPEIK--VIQNDXXXXXXXGTVTLEIALQQV
LPXB_COXB1      LIQTQ-----------IPTVQFILPLALNLALDKIRPFLSPEIK--VIQNDXXXXXXXGTVTLEIALQQV
LPXB_GEOMG      LLRDRYPGIQFILPLASSLTDADI--APHLAASGLEVVVARDKVYDVMQVCDAIATVSGTVTLEIALMGV
LPXB_GEOSL      QLRERYPDIQFILPLASSLTDGDIAPLLAAS--GLDVTVTQDRVYDVMQVCDAIITVSGTVTLEIALMGV
LPXB1_LEGPL     LLDSPKLRFVVPIAGTDKVKAYFSNQ-------NLTVTFIQGQAIECMSAADFVIVASGTASLECALLEK
LPXB_IDILO      KLAERYPELRFVAPMISEARAAQFRELVDQYSPELNIVLPVGESRKVMAAANYLLLTSGTVALEALLIKR
LPXB_PSYIN      LISRQYPDYKFIVPMVNGARKKQLLEQQQQYAPDLPLQIFDGQASAVLQSADAVLLASGTAALEAMLAKV
LPXB1_LEGPH     LLDNPKLRFVVPIAGTDKVKAYFSNQ-------NLTVTFIQGQAIECMSAADFVIVASGTASLECALLEK
LPXB_VIBHB      KLHQKFPDIGFVVALVNQKRREQFEQAWKEHAPELDFKLVDDTARNVITASDAVMLASGTVALECMLLKR
LPXB1_LEGPA     LLDNPKLRFVVPIAGTDKVKAYFSNQ-------NLTVTFIQGQAIECMSAADFVIVASGTASLECALLEK
LPXB_DESPS      RLQSEKISFLLPIAATIDREQLLENGLAEQDLLDIHVISEDRYELMACCDAV--VAASGTVTLELAILEV
LPXB_SHEHH      LIKQRYPDIKFVTPLVNQKRRDQFEQALREHAPDLEIDLVEGQSREVMAAADCILLASGTATLEAMLVKR
LPXB_HAHCH      WLHQRRPDVRFVIPAANQARKTQIEQQLQSHGGRLPVTLIDQHSRECMMAADAILLASGTATLEAMLVKR
LPXB_ALCBS      ALNHQDPTLQYVIPAANAARREQIQTLLNTQ-PNLPVSLIDGQSRTVMAAADVVLMASGTATLEGLLLNK
LPXB_VIBPA      LLHQKYPGLGFVVALVNQKRREQFEQAWKEHAPELDFKLVDDTARNVITASDAVMLASGTVALECMLLKR
LPXB_VIBFM      RIHKQHPDMGFVVAAVNEKRREQFETIWKETAPELDFVIIQDTARNVMTAADAVLLASGTVALECMLVKR
LPXB_AERHH      HLTVRYPDLGFIVPLVNQKRREQFLAIKAELAPDLDMVLLEGQGREAMIAADVVMLASGTAALEAMLVKK
LPXB_VIBF1      RIHKQHPNMGFVVAAVNEKRREQFETIWKATAPELDFVIIQDTARNVMTAADAVLLASGTVALECMLVKR
LPXB_PHOPR      LLKQKHPDLGFVVALVNEKRREQFQLAWQETAPELDFVLVNDTARNVMIASDAVLLASGTVALECMLVGR
LPXB_ALTMD      AIHVKRSDIQFLIPAANEHRLAQIKALQEANEERLPIQVTQGTSRDAMIASDVILLASGTATLEAMLCKR
LPXB_ACTP7      ILKQQYPDLQFLVPLVNDKRIAQFEQIKAQVAPELSVHILKGNARQAMIAAEASLLASGTAALEGMLCKS
LPXB_FRAP2      KLQESGYKFKAIMPLAKPSLKPIFDQY-NSQIRSLGIEVLETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_ACTPJ      ILKQQYPDLQFLVPLVNDKRIAQFEQIKAQVAPELSVHILKGNARQAMIAAEASLLASGTAALEGMLCKS
LPXB_MANSM      LLKRKYPDLKFLVPLVNEKRRRQFEQVKAKVAPELDLILLDGHGRQAMIAAQATLLASGTAALECMLCKS
LPXB_THICR      KLHEAYPQMKFVIPCVNQAAKERVALSISLYGKGIDFIXXXXXXXXXXXXXXXXIVTSGTATLEAALMQR
LPXB_SHEPA      LIKLRYPDIKFVTPLVNQKRRDQFEQALREHAPDLEIHLIEGHSREVMAAADCILLASGTATLEAMLVKR
LPXB_HAEI8      LLKEQFPDLQFLVPLVNEKRRIQFEAIKAKIAPNLDLHLIDGNARQAMIAADATLLASGTAALEAMLCKS
LPXB_ACTP2      ILKQQYPDLQFLVPLVNDKRIAQFEQIKAQVAPELSVHILKGNARQAMIAAEASLLASGTAALEGMLCKS
LPXB_HAES1      LIKQRFPDVQFLVPLVNEKRRKQFEQIKAQIAPHLEVVFLDGQARQAMIVAEASLLASGTASLECMLCKS
LPXB_HAEPS      LLKAQYPDVQFLVPLVNEKRREQFEAIKAQVAPELEVITLAGNARAAMMVAEATLLASGTAALEAMLCKS
LPXB2_LEGPA     RIAMERPHVHFIVPIACQDLYPVFFKQLHAEYDYLKIQVIQGNAREAMAISDVVLTKSGTATLEAMLLKR
LPXB_VIBVY      KLQQAFPELGFVVALVNQKRREQFEQAWKEYAPELDFKLVDDTARNVITASDAVMLASGTVALECMLLKR
LPXB_VIBVU      KLQQAFPELGFVVALVNQKRREQFEQAWKEYAPELDFKLVDDTARNVITASDAVMLASGTVALECMLLKR
LPXB_HAEIG      LLKEQFPDLQLLVPLVNEKRRIQFESIKAKIAPNLDLHLIDGNARQAMIAADATLLASGTAALEAMLCKS
LPXB_SHELP      KLRQRYPDLKFVTPLVNAKRRAQFELALKTHAPDLDIHLVEGQSRTVMAAADAILLASGTATLEAMLVKR
LPXB_HAES2      LIKQRFPDVQFLVPLVNEKRRKQFEQIKAQIAPHLEVIFLDGQARQAMIVAEASLLASGTASLECMLCKS
LPXB_ALISL      RIHQKHPNMGFVVAAVNEKRREQFEVIWKETAPELKFIIIQDTARNVMTAADSVLLASGTVALECMLIKR
LPXB_HAEIN      LLKEQFPDLQFLVPLVNEKRRIQFETIKAKITPNLDLHLIDGNARQAMIAADATLLASGTAALEAMLCKS
LPXB_SACD2      QSFAGRPNLRIIIPAANDARHSQISEVLK-RYSELPVTLLHGQSHXXXXXXXXXXXXSGTATLEAMLLKR
LPXB_HAEIE      LLKEQFPDLQFLVPLVNEKRRIQFEAIKAKITPNLDLHLIDGNARQAMIAADATLLASGTAALEAMLCKS
LPXB_HAEDU      LLKQKYPDLQCLVPLVNQQRIQQFEQIKARVAPSLPVKILKGNARQAMIAADATLLASGTAALEAMLCKS
LPXB2_LEGPH     RIAVERPHVHFIVPIACQDLYPVFFKQLHAEYGHLKIQIIQGNAREAMAISDVVLTKSGTATLEAMLLKR
LPXB_SHESM      LIKQQFPDIRFVTPLVNQKRREQFEQALKAHAPDLEIHMVEGKSREVMAAADGILLASGTATLEAMLIKR
LPXB_SHESR      LIKQQFPDIRFVTPLVNQKRREQFEQALKAHAPDLEIHMVEGKSREVMAAADGILLASGTATLEAMLIKR
LPXB_SHESA      LIKQQFPDIRFVTPLVNQKRREQFEQALKAHAPDLEIHMVEGKSREVMAAADGILLASGTATLEAMLIKR
LPXB_PSEHT      QLQAQNPALKIVVPLVNAKRKAQFTEILNATAPTLKISLLDGQSKQAMQAADAILLASGTATLEGMLYKK
LPXB_RHOPB      LLQAQGVAFELILPTMPHLEALIAEALKHWPLQPRVVVGEND-KXXXXXXXXXXXXKSGTVTLELAVAGV
LPXB_CHLCV      SSSLAKSHQLLVSSCNPKYDKKILELLDKEGCHNNKIVPSK-FRYQLMRDCDCALAKCGTIVLEAALNQT
LPXB_SHEB2      LIRQNFPDIRFVTPLVNQKRRDQFEQALKDFAPDLEIHMIEGQSREVMAAADGILLASGTATLEAMLVKR
LPXB_SHEAM      AIKEALPDVRFITPLVNEKRREQFLTALETHAPGLEIQLFDGQSREIMAASDGILLASGTATLEAMLVKR
LPXB_SHEON      LIKQQFPDIRFVTPLVNQKRREQFEQALKDHAPDLEIHMVEGKSREVMAAADGILLASGTATLEAMLIKR
LPXB_SHESH      LIKKRYPDIRFVTPLVNQKRREQFEEALKLHAPDLEITLVEGHSREVMAASDCILLASGTATLEAMLVKR
LPXB_PASMU      LLKQQYPDIQFLVPLINAKRREQFEQIKAQVAPELELILLDGKARQAMIAAEATLLASGTAALEAMLCKS
LPXB_BLOFL      LLQDPNLEILIPLHDTDLINQF----VTLTSFISVKFVLHTLTAWEVMAAADAALLTSGTATLECMLAKC
LPXB_VIBCM      KLQARYPDLGFVVALVNAKRRAQFEQAWQQVAPELNFVLVDDTARNVITAADAVMLASGTVALECMLLKR
LPXB_VIBCH      KLQARYPDLGFVVALVNAKRRAQFEQAWQQVAPELNFVLVDDTARNVITAADAVMLASGTVALECMLLKR
LPXB_VIBC3      KLQARYPDLGFVVALVNAKRRAQFEQAWQQVAPELNFVLVDDTARNVITAADAVMLASGTVALECMLLKR
LPXB_SOLUE      RIYREQAVNVVLPASATTGVAFF-----QERMGNSPIRVIEGESWDAMAHSDLALAASGTVTVEAALLGT
LPXB_MYXXD      RLSAERPGQVVVPLAPTIDREEITSRFEGSGVTPILV---EGRAPEXXXXXXXXXXXXXXXXLEAGLMQR
LPXB_MAGSA      LLARRFPDLAVVVPTVETVADEVSQAVKSWALPSMVVRGPE--KYDXXXXXXXXXXXSGTVALELAMARL
LPXB_CHLPN      LNSSLSQTHQFVVSSSSAKYDEIIEDTLKAEGCQHSQIIPMNFRYELMRSCDCALAKCGTIVLETALNQT
LPXB_SHEWM      IIKQRYPDIHFVTPLVNAKRREQFEEALKLYAPNLEITLVEGQSREVMAAADCILLASGTATLEAMLVKR
LPXB_SHESW      LIKENFPDIRFVTPLVNQKRRDQFEQALKDHAPDLEIHMVEGKSREVMTAADGILLASGTATLEAMLVKR
LPXB_SHEPC      LIKENFPDIRFVTPLVNQKRRDQFEQALKDHAPDLEIHMVEGKSREVMTAADGILLASGTATLEAMLVKR
LPXB_FRATW      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRATT      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRATO      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRATN      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRATM      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRATH      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRATF      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_FRAT1      XXVDAGYKFKAIMPLAKPSLKPLFAKYKE-QIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCKL
LPXB_PSEPK      RLSQQVPGVRFVLPCANATRRAQIEQMLEGRQLPLTLLDGQ--SHQALAACDAVLIASGTATLEALLYKR
LPXB_PHOLL      LLKRNIPDHVFVPLVNAKRRE-QFERIKQEVAPELNVHLVDGKAREIMIASDAALLASGTAALECMLAKC
LPXB_NITWN      MLQQSIPEIEVVLHLVDEITPAVATWPRRPR-----VVIGEDDKXXXXXXXXXXXXKSGTVTLELALAGV
LPXB_NEIMA      LLLKRYPAARFLLAATEATKRRLAEILQRSEFAGLPLTVTDRQSETVCRAADAVLVTSGTATLEVALCKR
LPXB_RHOP2      RLQAEQGDLELILPTVPHLRDAVEAGVRDWPVQP-RIVVGXXXXXXXXXXXXXXXXKSGTVTLELALAHV
LPXB_CHLFF      ASSLAQSHQILVSSCNPKYDKNILDVLEKEGCRG-KIIS-STFRYQLMRDCDCALAKCGTIVLEAALNQT
LPXB_BLOPB      LLKN-----------NFPNLEILVPLTNQTSIKKFISVASTSVKYRVLSNQMMAADASGTATLECMLVKC
LPXB_METFK      LILSERPDARFLVPLITRETRAIFERALYANEGDLPVSIMFGHAHQAMEAANAVIVASGTATLEAALIKR
LPXB_GEOLS      LLQQCLPGLQFVLPASTLSDDDLAPWLEGCEL---PITVTRDRIHDLMRACDAVISVSGTVTLEIALVGT
LPXB_PSEP1      RLCQQVPGVRFVLPCANATRRAQIEQMLEGRQLPLTLLDGQ--SHQALAACDAVLIASGTATLEALLYKR
LPXB_WIGBR      XXXXXXXXXXXXVPMVNSLLKKRFEEIKREVAPDLPITIFDNFSYEVMACSDFSIVTSGTATLECMLSKC
LPXB_RHOPA      RLKHEGVAFEAVLPTTPHLEGLVRAAVASWEVQPRIVVGEQD-KRXXXXXXXXXXXKSGTVTLELAIAGV
LPXB_XANAC      LVSEHLPNHVLVPAANPGCKQLLAEQLSRSSLPVMSHLLDGQARTAMLAADVVLLA-SGTATLEAMLVKR
LPXB_NITHX      TLDAGEMDVVLL------TMPHLIEKVKAAVASQPRIVVGEQGKQAAFRVARAALTKSGTVTLELALAGV
LPXB_SALPK      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALPA      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALAR      LLRQHYPDLEVVVPLVNAKRREQFEKIKAEIAPDLAVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_CHRVO      LLLRQYPEAQFLVRATMDQFEQMLYRFKARDLPIRKLFGHAQM--AMIASDVVLVT-SGTATLEVALTKR
LPXB_SHEFN      LVKQTFPDIKFVTPVVNDARRQQFLAALEEFAPDLEVTIVEGQSREVMAAADCILLASGTATLEAMLVKR
LPXB2_LEGPL     RIAVEMPHVHFIVPIACQELYPVFFKQFQARYSHLKIQIIQGNAREAMAISDVVLTKSGTATLEAMLLKR
LPXB_SALTY      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALTI      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALSV      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALPC      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALPB      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALNS      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALHS      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALG2      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALEP      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALDC      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_SALCH      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_PSEPG      HLCQQVPGVRFVLPCANAARRAQVEHMLEGRQLPLTLLDGQ--SHQALAACDAVLIASGTATLEALLYKR
LPXB_PSEA7      RLLGERPGLRFVLPCASAARREQIERMLQ-GREPLPLTLLDGASHEALAACDAVLIASGTATLEALLYKR
LPXB_NITOC      RIYSEEPEIQYLLPLAATLKEIDLAPYLKGYRLPLRVIPDRSY--XXXXXXXXXXXXSGTVTLEAALMGV
LPXB_SHIDS      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ANADE      RLRAAHPDAQFVVPVAPTLDRAALEPYLAAH-RTLEVRLVDGRTEEVVGASDAALVKSGTSTLEAGLMLR
LPXB_SALA4      LLRQRYPDLEVVVPLVNAKRREQFEKIKAEVAPDLAAHLLDGMAREAMIASDAALLASGTAALECMLAKC
LPXB_XANCP      LVSEHLPNHVLVPAANPGCKQLLAEQLSRSSLPVMSHLLDGQARTAMLAADVVLLA-SGTATLEAMLVKR
LPXB_XANC8      LVSEHLPNHVLVPAANPGCKQLLAEQLSRSSLPVMSHLLDGQARTAMLAADVVLLA-SGTATLEAMLVKR
LPXB_NEIMB      LLERYPAARFLLPAATEATKRRLAEVLQRPEFAGLPLTVIDRQSETVCRAADAVLVTSGTATLEVALCKR
LPXB_BRAJA      LQAEGRAFELML--PTMPHLEATVREGIASWPVKPQIVIGEXXXXXXXXXXXXXXXKSGTVTLELALSGI
LPXB_PSESM      RLLVERPGLRFVLPCASPQRRAQVEQLLQGR--DLPITLLDGRSHVALAACDAVLIASGTATLEALLYKR
LPXB_NEIMF      LLERYPAARFLLPAATEATKRRLAEVLQRPEFAGLPLTVIDRQSETVCRAADAVLVTSGTATLEVALCKR
LPXB_ESCF3      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOUT      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOLU      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHMLDGLGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOL6      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOL5      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOK1      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO81      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO7I      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLAVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO45      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO27      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_XANOR      LVCEHIPNHVLVPAANAGCKQLLAEQLSRSSL---PVMRSHLINGQARTAMLAALLASGTATLEAMLVKR
LPXB_XANOM      LVCEHIPNHVLVPAANAGCKQLLAEQLSRSSL---PVMRSHLINGQARTAMLAALLASGTATLEAMLVKR
LPXB_SHISS      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_SHIFL      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_SHIF8      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOSM      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLAVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOLI      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOLC      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOHS      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECODH      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECOBW      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO8A      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO5E      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO57      LLRQTYPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO24      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ANASK      RLRAAHPDAQFVVPVAPTLDRAALEPYLAAH-RTLEVRLVDGRTEEVVGASDAALVKSGTSTLEAGLMLR
LPXB_XANC5      LVSEHLPNHVLVPAANPGCKQLLAEQLSRSSLPVMSHLLDGQARTAMLAADVVLLA-SGTATLEAMLVKR
LPXB_PSEAB      RLLVERPGLRFVLPCASAARREQIEQMLQ-GREPLPLTLLDGASHEALAACDAVLIASGTATLEALLYKR
LPXB_ECOSE      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ECO55      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_PSEAE      RLLVERPGLRFVLPCASAARREQIEQMLQ-GREPLPLTLLDGASHEALAACDAVLIASGTATLEALLYKR
LPXB_PSEA8      RLLVERPGLRFVLPCASAARREQIEQMLQ-GREPLPLTLLDGASHEALAACDAVLIASGTATLEALLYKR
LPXB_SYNAS      ILTENICPVQFLLMANTLDETWMKDQIAKADPPGVRLI--RGATYXXXXXXXXXXXXSXXXXXXXXXXXX
LPXB_SHIBS      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDFSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_SHIB3      LLRQTYPDLEIVVPLVNAKRREQFERIKAEVAPDFSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_ACIBL      KLGPAN-EYLLPVASTLDAGWMQAQLLAIPQPPRVTLTSD---ARQTLVQSRAAMVASGTATVEASVLGT
LPXB_ANAD2      RLRAAHPDAQFVVPVAPTLDRAALEPYLAAH-RTLEVRLVDGRTEEVVGASDAALVKSGTSTLEAGLMLR
LPXB_PSEFS      RLQALKPGVRFVLPCASPQRRVQIETLLEGR--NLPLTLLDGQSHLALAACDAVLIASGTATLEALLYKR
LPXB_DECAR      IIRERHLPNMFVVPATRETRLQFELAIYNRQAGDVPFRLLFGHAQDALGAADVSLVASGTATLEAALIKR
LPXB_ENT38      ILRQTYPDLEVVVPLVNAKRREQFERIKAAVAPDLHIHLLDGKGREAMVASDAALLASGTAALECMLAKC
LPXB_CHLAB      ASSLAESHQLLVSSYNLKHDQTILDLLEKEGCCGKTV--PAMYRYHLMRDCDCALAKCGTIALEAALNQT
LPXB_PSEPW      RLVELIPGVHFVLPCANGARRAQLEQMLEGRELPLTLLDGQ--SHQALAACDAVLIASGTATLEAMLYKR
LPXB_CHRSD      WLRERVPGLQVVIPAASPARRQELEVLLATHPAREFVHLRDGESRQAMTAADAVLLASGTAALEAMLCHR
LPXB_BURP8      LMLQREPGVRFVMPAATPALRELLKPLVDAHA-NLPLTLTDGNAQRAMTAADAILVKSGTVTLEAALLKK
LPXB_ERWCT      LLRQHFPDLEIVVPLVNSKRREQFERIKSSVAPDLRVHLLDGQAREAMIASDAALLASGTAALECMLAKC
LPXB_XYLFM      QLSEHLPGHVVIPAANTQCKPLLAEQLSRSTLPVMSHLLDSSARTAMLAADVVLVA-SGTATLEAMLLKR
LPXB_AZOSE      LLAERHPDIGFVVPATRETRALFEQALHAADADELPIRLLFGHAVEAMTAADVVLVASGTASLEAALLKR
LPXB_AZOSB      MLAQRHPDVLFLVPATRETRELFSAALARNKGDELPLRMLFGHAVDAMTAADAVLVASGTASLEAALLKR
LPXB_PSEE4      RLRELVPGVRFVLPCANAARRAQVEQMLEGR--DLPLTLLDGRSHQALAACDAVLIASGTATLEAMLYKR
LPXB_CELJU      FCIEQDPSLHFVVPAANSDRYRQLH-IELNDFVDFPIHLVNGHSQXXXXXXXXXXXXSGTVTLEALLLKK
LPXB_PECCP      LLREHFPDLEIVVPLVNSKRREQFEQIKSSVAPDLRVHLLDGQAREAMIASDAALLASGTAALECMLAKC
LPXB_KLEP7      LLRATYPDLQVVVPLVNAKRREQFERIKETAPDMIVHMLDGQARDAMIASDA-ALLASGTAALECMLAKC
LPXB_ACIC5      QLGH---EHEYVLPLAPTLTEAQRGHVRQXQAPRITVVAD---ARATLHHARASIVASGTATVEAALIGN
LPXB_PELCD      KLREKHPDAQFLLPVASSFRRQDIEALVAPYGLPVTVV-DEPIYD-VINACDAVISVSGTVTLQVALVGT
LPXB_CYAP7      QIQEKLPDVQFLIPALEDYRSTISAMMEEYGLQGTIL---DGKSXXXXXXXXXXXXKSGTVNLELALLNV
LPXB_CITK8      LLRQTYPDLEVVVPLVNAKRREQFERIKAEVAPELSVHLLDGMGREAMVASDAALLASGTAALECMLAKC
LPXB_PSEPF      RLRAMRPGVRFVIPCANPERRAQLEELLAGRDLPVTLLDGKSHLALAACNAVLIA--SGTATLEALLYKR
LPXB_BURCJ      LMQQREPGVRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_XYLFT      QLSEHLPGHVVIPAANTQCKPLLAEQLSRSTLPVMSHLLDSSARTAMLAADVVLVA-SGTATLEAMLLKR
LPXB_XYLF2      QLSEHLPGHVVIPAANTQCKPLLAEQLSRSTLPVMSHLLDSSARTAMLAADVVLVA-SGTATLEAMLLKR
LPXB_KLEP3      LLRVTYPDLQVVVPLVNAKRREQFERIKETAPDMIVHMLDGQARDAMIASDA-ALLASGTAALECMLAKC
LPXB_BURM1      LMQQREPGLRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_YERPS      ILRDKXXXXXXXXXXXXSKRREQFERIKAEIAPDLSVHLLDGKARVAMIASDAALLASGTAALECMLAKC
LPXB_YERPE      ILRDKXXXXXXXXXXXXSKRREQFERIKAEIAPDLSVHLLDGKARVAMIASDAALLASGTAALECMLAKC
LPXB_PSEMY      LRALRPGVRFLLPCATPERRAQLEQMLASRDL---PLTLLDGRSHEALAACDAVLIASGTATLEALLYKR
LPXB_XYLFA      QLSEHLPGHVVIPAANTQCKPLLAEQLSRSTLPVMSHLLDNSARTAMLAADVVLVA-SGTATLEAMLLKR
LPXB_SERP5      LLRTRYPELELVVPLVNAKRREQFERIKAEVAPELRVHLLNGQGREAMIASDAALLASGTAALECMLAKC
LPXB_AZOVD      RLLALHAGPLFVVPCASPERRRQLEEMLSHTRRDLPVMLLDGRSHEALAACDAVLIASGTATLEALLYKR
LPXB_BURCH      LMQQREPGVRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_BURCC      LMQQREPGVRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_BURCA      LMQQREPGVRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_NEIG1      LLERYPAARFLLPAATEATKRRLAEVLQRPEFAGLALTVTDRQSETVCRAADAVLVTSGTATLEVALCKR
LPXB_CHLTR      ASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ-FRYELMRECDFALAKCGTIVLETALNLT
LPXB_CHLTA      ASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ-FRYELMRECDFALAKCGTIVLETALNLT
LPXB_SILPO      ---------------------------------------------------------SGTVSLELAAAGT
LPXB_PSE14      LLLAQRPGLRFVLPCASPQRRAQVEQLLQGR--NLPVTLLDGQSHVALAACDAVLIASGTATLEALLYKR
LPXB_BURVG      LMQEREPGVRFVMPAATPALRELLQPLVAAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_PSEU2      RLLARCPELRFVLPCASPQRRAQVEQLLQGRDLPVTLLDGQ--SHVALAACDAVLIASGTATLEALLYKR
LPXB_BURS3      LMQQREPGVRFVMPAATPALRALLQPLVDAHPKLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_PSEF5      RLRAMRPGVRFIMPCASPERRVQLEQLLANRDLPLTLLDGQSHKALAACDAVLIA--SGTATLEALLYKR
LPXB_BURCM      LMQQREPGVRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_BURA4      LMQQREPGVRFVMPAATPALRELLQPLVDAHPQLALTITDG--RSQVAMTAADAIVKSGTVTLEAALLKK
LPXB_CHLMU      ASDFASTHHLLVSSANPAYDHLILEILQQNRCLHSNIVPSQ-FRYELMRECDCALAKCGTIVLETALNLT
LPXB_RALEJ      RMHRMDPNLAFVLPAASAPLRAIVEELHQ-QYPELRLTIVDGNSHQAMEAADVVLLASGTATLEAALYKK
LPXB_ERWT9      LLREKYPQLEIVVPLVNPRRRAQFEAIKAEVAADLPMHLLDGKGREXXXXXXXXXXXXXXXXXECMLAKC
LPXB_RALSO      RMQAVEPDLAFVLPAANAMLRERIDAMRAEH-PGLHLWVVDGQSHAAMEAADVILLASGTATLEAALYKK
LPXB_CAMJR      LSQKFKGEKILC--------------VPSFNLEKLEVYGDESNTPKVLKKADFAFICSGTATLEAALVGT
LPXB_CAMJ8      LSQKFKGEKILC--------------VPSFNLEKLEVYGDESNTPKVLKKADFAFICSGTATLEAALVGT
LPXB_ALHEH      RLRERQPDVRFIAPLAWPGLRAVFYEVQQGVSDAVQLF--EGRADEVMAAADVVLTASGTATLEAMLLKR
LPXB_THIDA      QVRAKEMDVRFVLPXXXXXXXXXXXXXXQGLDLPLTVLAGR--SHQALAACDVAVVASGTATLEAALFKK
LPXB_BURPP      MMQHQEPNLRFVMPAATPALREMLRPLVDSHPGLALTITDGQAQLAMTAADAILV-KSGTVTLEAALLKK
LPXB_BURXL      MMQHQEPALRFVMPAATPALREMLRPLVDSHPGLALTITDGQSQLAMTAADAILV-KSGTVTLEAALLKK
LPXB_AQUAE      XXXXXXXSFDVISPTFREFSKFIERELK------VKTLTYEGASYDCFFYSKASLIASGTASLEAGIAGN
LPXB_RALME      RMHRMDGNLAFVLPVASAPLREIVAGL-HAQYPDIDLTVVDGQSHLAMESADVVLLASGTATLEAALYKK
LPXB_BORPE      ----------------------------------------------------------------------
LPXB_BORPA      ----------------------------------------------------------------------
LPXB_BORBR      ----------------------------------------------------------------------
LPXB_SODGM      ----RAAERLYECFPGLEIVVPLVNPARRAQFEHILVAVAPALPVRLLDNQXXXXXXXXXXSLECMLAKC
LPXB_CAMJE      KFKGKK-----------------ILCVPSFNLEKLEVYGDESNTPKVLKKADFAFICSGTATLEAALVGT
LPXB_BORA1      LLQARDPALCCVVPMVNPQRRAEFEQIAQYPVQGLRCITAEDVQGSVMEAADAVLVASGTATLETALYKR
LPXB_VEREI      LLRQTRXXXXXXXXXXXXXRERIVQAAQAAGMEQVQIIAGQ--SHTVLAACDATLIASGTATLEAALFKR
LPXB_BORPD      ----------------------------------------------------------------------
LPXB_BURPS      LMQQREPGVRFVVPAATPVLRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURP6      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURP0      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURMS      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURMA      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURTA      LMQQREPGVRFVVAATPALRELLQPLVDAHPLLSVTLTEGRAQVAMTAADAILV--KSGTVTLEAALLKK
LPXB_RHOFD      LINKAHPAIKFIVPAIPALRAGIEHAARASGMQHLQIIAGQ--SHTVLAACDVTLIASGTATLEAALFKR
LPXB_BURM9      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURM7      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_BURP1      LMQQREPGVRFVVPAATPALRALLQPLVDAH-PSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKK
LPXB_SYNY3      LQSQLPNVKLLLPVSLKDYQPQIEQTLKEFNL-TVQLLEGKE-XXXXXXXXXXXXXKSGTVNLEIALLNV
LPXB_PROM3      LLQQRDPSLEVIVPAGLASFETSLQKALEAAAVRGRVLSADELKPMLYAAADLALGKSGTVNMELALRGV
LPXB_HELPH      ILEQNEGFKRRVLVVPSFFKGLDLKALYGEDIELFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_HELPY      MLEQNEGFKRRVLVVPSFFKGLDLKALYGEDIQLFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_HELPG      ILEQNEGFKRRVLVVPSFFKGLDLKALYGEDIQLFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_HELP2      ILEQNEGFKRRVLVVPSFFKGLDLKALYGEDIKLFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_HELPS      ILEQNEGFKRRVLVVPSFFKGLDLKALYGEDIKLFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_HELAH      ILEQNEGFKRRVLVVPSFFKGLDLKALYGEGIEWFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_HELPJ      ILEQNEGFKRRVLVVPSFFKGLDLKALYGEDIKLFEISYD---AHKSLFEAEFAFICSGTATLEAALIGT
LPXB_PROMM      LLQQRDQSLEVIVPAGLASFEKSLQEALEAAAVRGRVLSADELKPMLYAAADLALGKSGTVNMEMALRGV
LPXB_PROMI      ----------------------------------------------------------------------
MURG_CLOTH      LIKRHKSDGFYLIYATGEAQDGIMKKIGEVKSPNINILPYIFDMANAMAAADLVVCRAGAITVELTALGV
MURG_THEPX      VEFLKQKDNLQVLIITGANQEKVLEKVKTETIDTVKIIPYCHNMQDVYAAADIIICRAGAITLEITAKGV
MURG_THEP3      VEFLKQKDNLQVLIITGANQEKVLEKVKTETIDTVKIIPYCHNMQDVYAAADIIICRAGAITLEITAKGV
KDTA_RICCN      NLKEQFLDYIILIPRHPERVKSIIDNCKSHNL-SATAKSQNDL--PVLSDDLYIVDRFGEMGLFFSVATI
MURG_BACSU      MQDVLKTRDYQVLYITGEHYEKVMNELKKGAADNMVTKPFLHQMPEYLKAIDVIVARAGATTIEITALGI
YL271_MIMIV     -MSSAKEQALNVYKEIENMENFILNKINITKKKALDKIKEENIENTVITKSNVSITNTDTITQAIISENL
SYW_RICTY       KMSKSDIADFSRINLKDSN-DLIYQKIKKAKTDHLSFISYDKKTRPEISNLL-------DIYKSLSKESM
SYW_RICPR       KMSKSDISDFSRINLKDSN-DLIHQKIKKAKTDHLSFISYNKKTRPEISNLL-------DIYKSFSKESI


                         .         *         .         .         .         .         +:350
query           PSIIIYKLGFINFMIFKLLVNVRFANIINIINDKEVIPELLQKECNAEEIYKTVTYFLKNPELIEKQLVD
LPXB_RICBR      PMIVAYKVNIFSFIIIRLLIKIKYVTLINIIGNREIIPEFIQFNCEANLISDKLKELLLNPQEVDKQITE
LPXB_RICB8      PMIVAYKVNIFSFIIIRLLIKIKYVTLINIIGNREIIPEFIQFNCEANLISDKLKELLLNPQEVDKQITE
LPXB_GLUOX      PMAVTYRVNPVTATIARRLIKVPHVAMVNLLAGREVVPELLQENCTPKKLAETVSKLLSDPQMVEKQRMA
LPXB_RICTY      PMVVAYKVNIISFFIIMFLIKIKYVSLINIMAGSAIIPEFIQFNCRANLISNKLKELLSNSQKRDNQVVE
LPXB_RICCK      PMIVAYKVNILSFLIIRALIKIKYVTLINIIAGSEIIPEFIQHNCRATLISNKLQELLFSSKKAYKQVIE
LPXB_RICFE      PMIVAYKVNLISFFIIRLLIKIKYVTLINIIAGSEIIPEFIQFNCRASLISNKLQELLFNSKKAYEQVIE
LPXB_RICCN      PMIVAYKVNLISFFIIRLLIKIKYVTLINIIADKEIIPEFIQFNCRANLISNKLQELLFNSKKAYEQVIE
LPXB_COLP3      PMVICYKFSPITFFLGRRFVKLKWFSLPNLLTNKSLVPELLQKDVCPENIVPLV----------------
LPXB_RHOCS      PAVIAYRIHPVSHALYRRFIRVRYVNLVNIMLDRPLVPELLQQDCTPDRLALAVDRLLNEPSARQEQI--
LPXB_COXBU      PLVIIYKVAPLTFWLGKKLIRLSFIGLCNLVSPEPVAVELLQQDATPQAIADEVFQLLNN----------
LPXB_COXBR      PLVIIYKVAPLTFWLGKKLIRLSFIGLCNLVSPEPVAVELLQQDATPQAIADEVFQLLNN----------
LPXB_ACIAD      PMVSFYKLNTLTYIIAKLLVKIQYYSLPNIIAGKKVIEELIQKDANPERLAHEIEKLMNN----------
LPXB_RICPR      PMVVAYKVNXXXXXXXXXXXXXXYVSLINIIAGSEIIPEFIQFNCKANLISNKLKELLSNSQKRYNQVVK
LPXB_SULSY      PFIIVYKVSPITYFIGKKLVKINYLGLPNIIAGNEIVPELLQDRCNPLDIANKTLEFLTDKNLYKTQ---
LPXB_MAGSM      PMVVAYKVNPLTYQIGKQLIKSKFISLPNLIAQSAIVEERIQQDANPEQLSEDLIQLLNRPQ--------
LPXB_GRABC      PMAVTYRVNRITAMMARRLIRVPYVAMVNLLAGREIVPELLQENCTPTKIAAVLTSLMNN----------
LPXB_PERMH      PFLLVYKVSPVTFFIGKMLVSIDYLGLPNIIAGREIIKELLQKECNPESIARWSLRYLEDPEVYERTKND
LPXB_RICAH      PMVVAYQVNLISFFIIRLLIKIKYVTLINIIAGSEIIPEFIQFNCRASLISNTLQELLFNSKKAYKQVIE
LPXB_COXBN      PLVIIYKVAPLTFWLGKKLIRLSFIGLCNLVSPEPVAVELLQQDATPQAIADEVFQLLNN----------
LPXB_COXB2      PLVIIYKVAPLTFWLGKKLIRLSFIGLCNLVSPEPVAVELLQQDATPQAIADEVFQLLNN----------
LPXB_COXB1      PLVIIYKVAPLTFWLGKKLIRLSFIGLCNLVSPEPVAVELLQQDATPQAIADEVFQLLNN----------
LPXB_GEOMG      PMVIIYTVSPLTYEVGKRLIRVDHIGICNIVAGERVVPELIQDEATAERIAAEIGRYLDDPVHTEKTRAG
LPXB_GEOSL      PMVIIYKVSPLTYQVGKRLIRVDHIGICNIVAGERVVPELIQDDASADRIAAEIGRYLDDPAYAEK----
LPXB1_LEGPL     PMCIIYKSSFLTYVAAMYFIKVKFLGLCNLLANKMMVPEFLQYDCNAIELSRYISNFHNNPNQPESMINQ
LPXB_IDILO      PMVVAYRFHWLSYQIIKRLFHAPFFSLPNLLAGKEIVPELAQSDASEEAIEQALVQLIENEPLLEQ----
LPXB_PSYIN      PMVVAYKVNLLTYVIAKALVKVKYTSLPNLIADKEIVKELSQYNCTVENI--------------------
LPXB1_LEGPH     PMCIIYKSSFLTYVAAMYFIKVKFLGLCNLLANKMMVPEFLQYDCNAIELSRYISNFHNDPNQAKSMINQ
LPXB_VIBHB      PMVVGYRVNAVTAFLAKRLLKTKYVSLPNILADTELVKEYLQDDCTPDNLFDEVSRLLENREMLDK----
LPXB1_LEGPA     PMCIIYKSSFLTYVAAMYFIKVKFLGLCNLLANKMMVPEFLQYDCNEIELSRYISNFHSDPNQPKSMINQ
LPXB_DESPS      PMLVVYRTSPISYWVGRKLVKIEFFSLVNLIAGREVVTELLQDEVTPERI--------------------
LPXB_SHEHH      PMVVAYRVSPITYRIAKGMMLTKRYSLPNLLADDDVVEELIQADCTPEKIATAVATQLDN----------
LPXB_HAHCH      PMVVAYKLATLSYWIMRRLLKAKYISLPNLLADKALVPELIQNDATPAKL--------------------
LPXB_ALCBS      PMVVGYRVGAVTYAIVSRLIKSEFFSLPNLLCRQEMVPELLQSQLTTEAIVAAVRRWFDQPE--------
LPXB_VIBPA      PMVVGYRVNTFTAFLAKRLLKTKYVSLPNILADDELVKEYLQDDCTPDNLFNEVSRLLENKPMLDK----
LPXB_VIBFM      PMVVGYQVNKLTGWIAQKLSITEFVSLPNVLAGKELVQEFIQEECHPDFLYPAMEKVLDNSELIEK----
LPXB_AERHH      PMVVGYKLKPFSYWLAQRLVKTEFVSLPNLLAGRMLVPELIQHECTPENLVVEVSKFFEH----------
LPXB_VIBF1      PMVVGYQVNKLTGWIAQKLSITEFVSLPNVLAGKELVQEFIQEECHPDFLYPAMEKVLNNDELIEK----
LPXB_PHOPR      PMVVGYKVKPLTAWIIRRLVKTKYVSLANILADKPLVTELLQEDCVPEKLSAEVDRILSNTELLSE----
LPXB_ALTMD      PMVAAYLLSPLTYKIMQRLYKAPFFTLPNLLANEAIIPELLQEEVNAENMSNQLLNFFES----------
LPXB_ACTP7      PMVVGYKMKAMTYWLAKRLVKTKYISLPNLLADEMLVPELIQDECNPENL--------------------
LPXB_FRAP2      PMVVGYKLSKLSAFIGRILIRGHYWAFPNILHKSEIIKELIQEDCTVDNLF-------------------
LPXB_ACTPJ      PMVVGYKMKAMTYWLAKRLVKTKYISLPNLLADEMLVPELIQDECNPENL--------------------
LPXB_MANSM      PMVVGYRMKAATYWLAKRLVKTAYISLPNLLADEMLVPEMIQDECTPEKLVEKLSVYLDETE--------
LPXB_THICR      PLILAIKLHPISYWIMKRLATTKWVGLPNVLAGKCIVPELIQENATVDKIAQTLDKLITDKEMREVQLTE
LPXB_SHEPA      PMVVAYRVSPITYRIAKGMMLTKRYSLPNLLADDDVVEELIQADCTPEKIAAAVATQLDN----------
LPXB_HAEI8      PMVVGYRMKPLTYFLAKRLVKTDYISLPNLLANEMLVPEMIQEECTPELLAEKLSAYLSDDE--------
LPXB_ACTP2      PMVVGYKMKAMTYWLAKRLVKTKYISLPNLLADEMLVPELIQDECNPENL--------------------
LPXB_HAES1      PMVVGYKMKPFTYFLAKRLVKTKYISLPNLLADDMLVPEMIQEDCTAEKLAEKLSVYLEQTE--------
LPXB_HAEPS      PMVVGYKMKPLTYWLAKRLVKTDYISLPNLLANEPLVPELIQADCSPENLAKHLSLYLSQPEDVAKK---
LPXB2_LEGPA     PMVVAFKWGILTHAIIAPQVKVPYIALPNLLAGKKLIPEFVQEKANVDSITESVLNLLSNQNELIKQFTD
LPXB_VIBVY      PMVVGYRVNAVTAFLAKRLLKTQYVSLPNILADTELVKEYLQDDCTPDNLFGEVSRLLENHQMLDK----
LPXB_VIBVU      PMVVGYRVNAVTAFLAKRLLKTQYVSLPNILADTELVKEYLQDDCTPDNLFGEVSRLLENHQMLDK----
LPXB_HAEIG      PMVVGYRMKPLTYFLAKRLVKTDYISLPNLLANEMLVPEMIQEECTPELLAEKLSAYLSDDE--------
LPXB_SHELP      PMVVAYRVSPITYRIAKGMMQISHYSLPNLLAGREIIPELIQADCTPDKIVDAVS---------------
LPXB_HAES2      PMVVGYKMKPFTYFLAKRLVKTKYISLPNLLADDMLVPEMIQEDCTAEKLAEKLSVYLEQTE--------
LPXB_ALISL      PMVVGYQVNKLTGWIAQKLSITEFVSLPNVLAGKELVQEFIQEECHPDFLYPAMEKVLSNSELIDR----
LPXB_HAEIN      PMVVGYRMKPLTYFLAKRLVKTDYISLPNLLANEMLVPEMIQEECTPELLAEKLSVYLSDDE--------
LPXB_SACD2      PMVIAYHMAAFSYWLLSKLVKSKFVGLPNLLADKELVPELLQHNATPSQLSAALNVYL-DSEKTTQQLIE
LPXB_HAEIE      PMVVGYRMKPLTYFLAKRLVKTDYISLPNLLANEMLVPEMIQEECTPELLAEKLSVYLSDDE--------
LPXB_HAEDU      PMVVGYKLKPTSYWLAKRLIKTKYISLPNLLADDMLVPELIQDECNPENL--------------------
LPXB2_LEGPH     PMVVAFKWGILTHAIIAPQVKVPYIALPNLLAGKKLIPEFVQEKANVDSITESVLNLLSNQNELIKQFTD
LPXB_SHESM      PMVVAYRVSPLTYQIAKTMMQVNRFSLPNLLAGRDVVPELIQHDCTPEKIAAAV----------------
LPXB_SHESR      PMVVAYRVSPLTYEIAKTMMQVNRFSLPNLLAGRDVVPELIQHDCTPEKIAAAV----------------
LPXB_SHESA      PMVVAYRVSPLTYQIAKTMMQVNRFSLPNLLAGRDVVPELIQHDCTPEKIAEAV----------------
LPXB_PSEHT      PMVVGYKIKPLSYWIFKTLFNIKYFSLPNLLADEELVPEFLQSECNVANLTQALTPML------------
LPXB_RHOPB      PMVTAYRAGQLEAWIVRRRITSASVILANLVVGENVAPEYLQEECTAPTLAAALRDVLADSPLRQRQL--
LPXB_CHLCV      PTIVTCLLTFLAKYIFKIFIPA--YSLPNIITGSVIFPEFIKHDFSPEEVAAAID-ILANPIGKEKQKYA
LPXB_SHEB2      PMVVAYRVSPITYRIAKRMMQVERFSLPNLLAGKDLVPELIQEDCTPEKIAAAVT---------------
LPXB_SHEAM      PMVVAYRVAPLTYSIASRMMLIKRYSLPNLLSGKDLVPELIQADCTPQKIASEV----------------
LPXB_SHEON      PMVVAYRVSPLTYSIAKRMMQVNRFSLPNLLAGCDVVPELIQHDCTPEKIAAAV----------------
LPXB_SHESH      PMVVAYRVSPITYKIAKGMMQIDQYSLPNLLSGETLVTELIQENCTESLIADAIS---------------
LPXB_PASMU      PMVVGYRMKATTYFLAKRLVKTEYVSLPNLLANEMLVPELIQEQCTAENLAEKLALYLSQEE--------
LPXB_BLOFL      PMVVAYRMNPVIFMLIRHLIKVKWISLPNLLAGKPIVQEFIQKKCDPQRLASSLFYLL------------
LPXB_VIBCM      PMVVGYRVNAFTAFLAKRLLKTPYVSLPNILAGEELVKELLQDHCTVDNLYHEVSRLLENQALMDK----
LPXB_VIBCH      PMVVGYRVNAFTAFLAKRLLKTPYVSLPNILAGEELVKELLQDHCTVDNLYHEVSRLLENQALMDK----
LPXB_VIBC3      PMVVGYRVNAFTAFLAKRLLKTPYVSLPNILAGEELVKELLQDHCTVDNLYHEVSRLLENQALMDK----
LPXB_SOLUE      PMVTFYKVTGVSWLAGKFLVDIPFYSMVNLIAGRAVVPELMQSQMTGENLAREALRLLRDREEMKAGLAQ
LPXB_MYXXD      PLVVVYRVSLITYWVGRLMLKVAFVSLINLLAGRRVVPELLQGEMTPERIAEEV----------------
LPXB_MAGSA      PAVITYKVSPVSAFIATLGLSLKFVTLVNILVDEAVMPELLQDDCRPDKLAAAVEHLL------------
LPXB_CHLPN      PTIVMCRLTFLAKYIFKILLPA--YSLPNIIMNSVIFPEFIKKDFHPEEI-ATALDLLNQHGSKEKQKED
LPXB_SHEWM      PMVVAYRVNAMTYSIAKRMMQIDKYSLPNLLAGEDLVTELIQENCTPELIASSV----------------
LPXB_SHESW      PMVVAYRVSPLTYRIAKSMMQVNRFSLPNLLAGKDVVPELIQDDCTPEKIAAAVT---------------
LPXB_SHEPC      PMVVAYRVSPLTYRIAKSMMQVNRFSLPNLLAGKDVVPELIQDDCTPEKIAAAVT---------------
LPXB_FRATW      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRATT      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRATO      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRATN      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKSEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRATM      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRATH      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRATF      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_FRAT1      PMVVGYKLSWLSALIGRMLINHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELDYIVEEFEKIHKEMV-
LPXB_PSEPK      PMVVAYRLAPLTFWILKRLVKSPYVSLPNLLAQRELVPELLQDDATSEALANTLAPLVRDGSQQTERFDE
LPXB_PHOLL      PMVVGYRMKPLTFWLAKRLVKTPYVSLPNLLSGEELVKELLQEKCQPQKLADELLPLLQGSEKV------
LPXB_NITWN      PMVAAYKAGSVEAWIARRVIRVSSVILANLVIRENVIPEFLQEDCVPGKLAPALQEILTDSPMRRRQL--
LPXB_NEIMA      PMVISYKISPLTYAYVKRKIKVPHVGLPNILLGKEAVPELLQHDAVPEKLAAALADWYEHPDKV------
LPXB_RHOP2      PMVAVYKAGAMEAWIGKRVIRSASVILANLVVGENVIPEFIQEDCVPDRLVPALREVLADTPMRARQL--
LPXB_CHLFF      PTIVTCLLGFLAKYIFKILMPA--YSLPNIITGSIIFPEFIKHDFNPEEVAAAID-ILAKPKSKEKQKLA
LPXB_BLOPB      PMVVAYRMHPLTFMLAKHFINIPWISLPNLLAGHELVKEFIQNNCRPE----------------------
LPXB_METFK      PMIITYRMPNLSWQILKRMKYLPYVGLPNVLAGRFIVPELLQHDAVPDKLAATLLQMLSDKSQI------
LPXB_GEOLS      PLVIIYKLSPLTFQLAKRLVKVEHIGLCNIVAGETVARELIQEEASPEQIAGEIGRLLRDAE--------
LPXB_PSEP1      PMVVAYRLAPLTFWILKRLVKSPYVSLPNLLAQRELVPELLQDDATSEALANTLAPLVRDGSQQTERFDE
LPXB_WIGBR      PMVVGYCMXXXXXXXXXXXXXXXYISLPNLIAGKKIVPEKIQNECNPEVLAKEI----------------
LPXB_RHOPA      PMVTAYRAGSVEIWIARRVVRPGTVILANLVMGDDVIPEFIQEDCVPDKLVPAVRDLLGNTPARRRQLAG
LPXB_XANAC      PMVVGYKVAPLTYRIVKLLLKVNRYALPNILANDDLAPELMQDDCTPERLCVALLDWFKHPDKV------
LPXB_NITHX      PMVTAYRGGAVEAWIAQRVIRTSSVILANLVIGENVIPEFLQENCTPENLAPALREILTDSPLRRRQL--
LPXB_SALPK      PMVVGYRMKSFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALPA      PMVVGYRMKSFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALAR      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_CHRVO      PMVISYKLSALTYRLVKRKIKLPYVGLPNILCGRFVVPELLQKQATPQKL--------------------
LPXB_SHEFN      PMVVSYRVSPITYAIAIKMMKIKNYSLPNLLANDTIVPELMQANCQPQLI--------------------
LPXB2_LEGPL     PMVVAFKWSKFTHAIIAPQVKIPYVALPNLLANKKLVPEFVQEKATANSITESVLNLLACPSQLNKQFTA
LPXB_SALTY      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALTI      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALSV      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALPC      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALPB      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALNS      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALHS      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALG2      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALEP      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALDC      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_SALCH      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_PSEPG      PMVVAYRLAPLTYWILKRLVKSPYVSLPNLLAQRELVPELLQDQATSQALANTLAPLVRDGSQQTERFDE
LPXB_PSEA7      PMVVAYRVAGLTYRILKRLVKSPYISLPNLLAGRLLVPELIQDAATPRALATTLSPLL------------
LPXB_NITOC      PLVVIYKMNSLSYWMGRLLIKVDHIALCNIIAGEGVAPELIQQDASPERIALEALNLLRDKE--------
LPXB_SHIDS      PMVVGYRMKPFTFWLAKLLVKTDYVSLPNLLAGRELVKELLQEECEPQK---------------------
LPXB_ANADE      PMVVVYKLSWLSYAVARMLVKIAHVALVNILAGRGIVPELLQRDASPERMAAEVERLLGDRAAREAQI--
LPXB_SALA4      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEALLPLLAN----------
LPXB_XANCP      PMVVGYKVAPLTYRIVKTLLKVNRYALPNILANEDLAPELMQDDCTPERLCEALLDWFKHPEKV------
LPXB_XANC8      PMVVGYKVAPLTYRIVKTLLKVNRYALPNILANEDLAPELMQDDCTPERLCEALLDWFKHPEKV------
LPXB_NEIMB      PMVISYKISPLTYAYVKRKIKVPHVGLPNILLGKEAVPELLQ----------------------------
LPXB_BRAJA      PMVTAYRVGAIEAFILRRAIRVSSVILANLVIGEDVIPEFLQEDCTPEKLAPALSEVLTDSDMRRRQV--
LPXB_PSESM      PMVVAYRMAPLTFWVLKRLVKSPYVSLPNLLAQRLLVPELLQDDATPEALARTL----------------
LPXB_NEIMF      PMVISYKISPLTYAYVKRKIKVPHVGLPNILLGKEAVPELLQ----------------------------
LPXB_ESCF3      PMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQK---------------------
LPXB_ECOUT      PMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQK---------------------
LPXB_ECOLU      PMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQK---------------------
LPXB_ECOL6      PMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQK---------------------
LPXB_ECOL5      PMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQK---------------------
LPXB_ECOK1