[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21850.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
    9::380     1e-63  41%  406 aa  RIBBA_AQUAE RecName: Full=Riboflavin biosynthesis protein
    4::360     6e-63  38%  364 aa  RIBB_PHOLE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::369     2e-61  39%  397 aa  RIBBA_BACSK RecName: Full=Riboflavin biosynthesis protein
    5::370     2e-60  40%  398 aa  RIBBA_BACSU RecName: Full=Riboflavin biosynthesis protein
    2::372     2e-59  37%  398 aa  RIBBA_SYNWW RecName: Full=Riboflavin biosynthesis protein
    1::374     7e-59  38%  403 aa  RIBBA_UNCTG RecName: Full=Riboflavin biosynthesis protein
    4::337     1e-58  42%  363 aa  RIBB_PHOPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::369     1e-58  39%  397 aa  RIBBA_BACCR RecName: Full=Riboflavin biosynthesis protein
    6::361     2e-58  37%  369 aa  RIBB_PSESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::369     2e-58  39%  397 aa  RIBBA_BACC4 RecName: Full=Riboflavin biosynthesis protein
    5::369     3e-58  38%  397 aa  RIBBA_BACWK RecName: Full=Riboflavin biosynthesis protein
    5::369     7e-58  38%  397 aa  RIBBA_BACC2 RecName: Full=Riboflavin biosynthesis protein
    5::367     1e-57  39%  396 aa  RIBBA_THEPX RecName: Full=Riboflavin biosynthesis protein
    5::370     1e-57  38%  398 aa  RIBBA_BACA2 RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-57  38%  397 aa  RIBBA_BACHK RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-57  38%  397 aa  RIBBA_BACC3 RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-57  38%  397 aa  RIBBA_BACAN RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-57  38%  397 aa  RIBBA_BACAH RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-57  38%  397 aa  RIBBA_BACAC RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-57  38%  397 aa  RIBBA_BACAA RecName: Full=Riboflavin biosynthesis protein
    5::367     3e-57  39%  396 aa  RIBBA_THEP3 RecName: Full=Riboflavin biosynthesis protein
    5::369     3e-57  38%  397 aa  RIBBA_BACC0 RecName: Full=Riboflavin biosynthesis protein
    5::368     3e-57  38%  398 aa  RIBBA_BACAM RecName: Full=Riboflavin biosynthesis protein
    5::369     4e-57  38%  397 aa  RIBBA_BACCQ RecName: Full=Riboflavin biosynthesis protein
    5::369     4e-57  38%  397 aa  RIBBA_BACC7 RecName: Full=Riboflavin biosynthesis protein
    2::355     5e-57  37%  363 aa  RIBB_NEIMB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::375     5e-57  36%  410 aa  RIBBA_PROVI RecName: Full=Riboflavin biosynthesis protein
    5::369     5e-57  38%  397 aa  RIBBA_BACCZ RecName: Full=Riboflavin biosynthesis protein
    5::369     6e-57  38%  397 aa  RIBBA_BACC1 RecName: Full=Riboflavin biosynthesis protein
    2::355     8e-57  38%  363 aa  RIBB_NEIMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::369     4e-56  37%  399 aa  RIBBA_BREBN RecName: Full=Riboflavin biosynthesis protein
    5::369     1e-54  40%  397 aa  RIBBA_GEOSW RecName: Full=Riboflavin biosynthesis protein
   24::374     2e-54  39%  556 aa  RIBBA_SYNY3 RecName: Full=Riboflavin biosynthesis protein
   17::347     3e-54  39%  356 aa  RIBB_DEHMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   12::382     5e-54  34%  418 aa  RIBBA_CHLPN RecName: Full=Riboflavin biosynthesis protein
    6::375     2e-53  35%  409 aa  RIBBA_PELLD RecName: Full=Riboflavin biosynthesis protein
    9::380     2e-53  34%  424 aa  RIBBA_CHLMU RecName: Full=Riboflavin biosynthesis protein
    1::366     3e-53  37%  414 aa  RIBBA_CLONN RecName: Full=Riboflavin biosynthesis protein
    6::340     9e-53  36%  347 aa  RIBB_WOLSU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::374     6e-52  37%  405 aa  RIBBA_CYTH3 RecName: Full=Riboflavin biosynthesis protein
    9::380     6e-52  32%  424 aa  RIBBA_CHLTR RecName: Full=Riboflavin biosynthesis protein
    5::369     6e-52  37%  397 aa  RIBBA_BACCN RecName: Full=Riboflavin biosynthesis protein
   14::340     1e-51  42%  344 aa  RIBB_HELPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::373     3e-51  32%  400 aa  RIBBA_SALTO RecName: Full=Riboflavin biosynthesis protein
   14::340     4e-51  41%  344 aa  RIBB_HELPJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::364     4e-51  36%  393 aa  RIBBA_STAES RecName: Full=Riboflavin biosynthesis protein
    3::364     7e-51  35%  393 aa  RIBBA_STAEQ RecName: Full=Riboflavin biosynthesis protein
    8::373     7e-51  35%  404 aa  RIBBA_BACFR RecName: Full=Riboflavin biosynthesis protein
    8::373     7e-51  35%  404 aa  RIBBA_BACFN RecName: Full=Riboflavin biosynthesis protein
    6::376     7e-51  34%  401 aa  RIBBA_ACTPJ RecName: Full=Riboflavin biosynthesis protein
    6::376     7e-51  34%  401 aa  RIBBA_ACTP7 RecName: Full=Riboflavin biosynthesis protein
    3::333     9e-51  38%  339 aa  RIBB_CAMJE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::360     1e-50  37%  365 aa  RIBB_PSEAE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::352     1e-50  41%  355 aa  RIBB_HELHP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::376     2e-50  34%  401 aa  RIBBA_ACTPL RecName: Full=Riboflavin biosynthesis protein
    6::376     2e-50  34%  401 aa  RIBBA_ACTP2 RecName: Full=Riboflavin biosynthesis protein
    4::370     3e-50  32%  420 aa  RIBBA_SALAI RecName: Full=Riboflavin biosynthesis protein
    1::375     3e-50  33%  419 aa  RIBBA_PELPB RecName: Full=Riboflavin biosynthesis protein
    6::379     6e-50  33%  425 aa  RIBBA_MYCUA RecName: Full=Riboflavin biosynthesis protein
    1::377     1e-49  33%  421 aa  RIBBA_PROA2 RecName: Full=Riboflavin biosynthesis protein
    3::364     3e-49  35%  393 aa  RIBBA_STAHJ RecName: Full=Riboflavin biosynthesis protein
    6::379     3e-49  33%  425 aa  RIBBA_MYCMM RecName: Full=Riboflavin biosynthesis protein
    1::373     4e-49  33%  404 aa  RIBBA_BACV8 RecName: Full=Riboflavin biosynthesis protein
    6::379     5e-49  33%  425 aa  RIBBA_MYCTU RecName: Full=Riboflavin biosynthesis protein
    6::379     5e-49  33%  425 aa  RIBBA_MYCTA RecName: Full=Riboflavin biosynthesis protein
    6::379     5e-49  33%  425 aa  RIBBA_MYCBT RecName: Full=Riboflavin biosynthesis protein
    6::379     5e-49  33%  425 aa  RIBBA_MYCBP RecName: Full=Riboflavin biosynthesis protein
    6::379     5e-49  33%  425 aa  RIBBA_MYCBO RecName: Full=Riboflavin biosynthesis protein
    6::379     8e-49  33%  423 aa  RIBBA_MYCVP RecName: Full=Riboflavin biosynthesis protein
    6::379     8e-49  33%  425 aa  RIBBA_MYCPA RecName: Full=Riboflavin biosynthesis protein
    6::379     8e-49  33%  425 aa  RIBBA_MYCA1 RecName: Full=Riboflavin biosynthesis protein
    6::379     4e-48  33%  423 aa  RIBBA_MYCGI RecName: Full=Riboflavin biosynthesis protein
    3::367     5e-48  35%  393 aa  RIBBA_STAAN RecName: Full=Riboflavin biosynthesis protein
    3::367     5e-48  35%  393 aa  RIBBA_STAAM RecName: Full=Riboflavin biosynthesis protein
    1::374     5e-48  34%  405 aa  RIBBA_PORGI RecName: Full=Riboflavin biosynthesis protein
    1::374     5e-48  34%  405 aa  RIBBA_PORG3 RecName: Full=Riboflavin biosynthesis protein
    9::371     5e-48  34%  404 aa  RIBBA_BACTN RecName: Full=Riboflavin biosynthesis protein
    5::367     9e-48  35%  393 aa  RIBBA_STAS1 RecName: Full=Riboflavin biosynthesis protein
    3::367     9e-48  35%  393 aa  RIBBA_STAAW RecName: Full=Riboflavin biosynthesis protein
    3::367     9e-48  35%  393 aa  RIBBA_STAAS RecName: Full=Riboflavin biosynthesis protein
    3::367     9e-48  35%  393 aa  RIBBA_STAAR RecName: Full=Riboflavin biosynthesis protein
    3::367     1e-47  35%  393 aa  RIBBA_STAAC RecName: Full=Riboflavin biosynthesis protein
  128::496     2e-47  33%  543 aa  RIBBA_ARATH RecName: Full=Riboflavin biosynthesis protein ribBA,
   11::208     2e-44  42%  217 aa  RIBB_TOLAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::212     2e-44  44%  217 aa  RIBB_VIBFI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     2e-44  45%  215 aa  RIBB_HAEIE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     3e-44  44%  230 aa  RIBB_VIBHA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   34::379     4e-44  34%  417 aa  RIBBA_MYCA9 RecName: Full=Riboflavin biosynthesis protein
   21::210     5e-44  45%  215 aa  RIBB_HAEIG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   20::209     6e-44  45%  214 aa  RIBB_PASMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     8e-44  45%  215 aa  RIBB_HAEIN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-43  45%  215 aa  RIBB_HAEI8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     1e-43  41%  213 aa  RIBB_WIGBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     1e-43  43%  213 aa  RIBB_CLOBL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   34::377     1e-43  34%  424 aa  RIBBA_RHOE4 RecName: Full=Riboflavin biosynthesis protein
   34::375     1e-43  36%  414 aa  RIBBA_NOCFA RecName: Full=Riboflavin biosynthesis protein
   17::210     3e-43  42%  218 aa  RIBB_VIBPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-43  44%  217 aa  RIBB_PSEHT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     3e-43  43%  213 aa  RIBB_CLOBH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     3e-43  43%  213 aa  RIBB_CLOB1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   20::209     4e-43  43%  213 aa  RIBB_BLOFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     5e-43  40%  217 aa  RIBB_SODGM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_SHISS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_SHIFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_SHIF8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_SHIDS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_SHIBS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_SHIB3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOUT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOSE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOLU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOLI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOLC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOL6 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOL5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOK1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECODH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECOBW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO8A RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO81 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO7I RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO5E RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO57 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO55 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO45 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO27 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     7e-43  40%  217 aa  RIBB_ECO24 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     9e-43  40%  217 aa  RIBB_ESCF3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     1e-42  42%  218 aa  RIBB_VIBVY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     1e-42  42%  218 aa  RIBB_VIBVU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     1e-42  42%  218 aa  RIBB_VIBSL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-42  43%  214 aa  RIBB_DESPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-42  40%  217 aa  RIBB_CITK8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-42  40%  211 aa  RIBB_BAUCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-42  41%  217 aa  RIBB_PECCP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     3e-42  40%  217 aa  RIBB_KLEP7 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     3e-42  40%  217 aa  RIBB_KLEP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::374     3e-42  31%  405 aa  RIBBA_PARD8 RecName: Full=Riboflavin biosynthesis protein
   16::209     4e-42  41%  217 aa  RIBB_ERWCT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     6e-42  42%  218 aa  RIBB_SHEFN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   26::219     6e-42  42%  223 aa  RIBB_RALEJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     6e-42  42%  212 aa  RIBB_HAES1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   24::209     1e-41  44%  214 aa  RIBB_MANSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-41  39%  219 aa  RIBB_EDWI9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::210     2e-41  44%  215 aa  RIBB_DESAA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::198     2e-41  44%  213 aa  RIBB_AGRT5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALTY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALTI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALSV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALNS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALG2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALEP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALDC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-41  39%  217 aa  RIBB_SALA4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-41  41%  214 aa  RIBB_HAES2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   34::379     3e-41  33%  417 aa  RIBBA_RHOSR RecName: Full=Riboflavin biosynthesis protein
   13::209     4e-41  39%  217 aa  RIBB_SALPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     4e-41  39%  217 aa  RIBB_SALPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-41  39%  217 aa  RIBB_PROMH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     4e-41  41%  215 aa  RIBB_BUCAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     4e-41  41%  215 aa  RIBB_BUCAI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     4e-41  41%  215 aa  RIBB_BUCA5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     5e-41  42%  217 aa  RIBB_SHESH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     6e-41  39%  218 aa  RIBB_HAMD5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     8e-41  39%  217 aa  RIBB_SALAR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   20::205     1e-40  44%  217 aa  RIBB_PELCD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-40  39%  217 aa  RIBB_ENT38 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-40  40%  217 aa  RIBB_DESAD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-40  39%  217 aa  RIBB_SERP5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-40  38%  217 aa  RIBB_YERE8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-40  41%  217 aa  RIBB_SHEWM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-40  40%  219 aa  RIBB_DESDG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     4e-40  42%  217 aa  RIBB_DESRM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     5e-40  40%  217 aa  RIBB_SHESW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     5e-40  40%  217 aa  RIBB_SHEPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   31::380     5e-40  33%  423 aa  RIBBA_CORAM RecName: Full=Riboflavin biosynthesis protein
   18::211     9e-40  40%  234 aa  RIBB_PELPD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-39  40%  217 aa  RIBB_SHELP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     1e-39  44%  217 aa  RIBB_PHOLL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     1e-39  44%  217 aa  RIBB_ENTS8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     2e-39  40%  212 aa  RIBB_SHEPW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     2e-39  46%  212 aa  RIBB_SHEPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-39  40%  217 aa  RIBB_SHESA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     2e-39  40%  217 aa  RIBB_SHEON RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::199     2e-39  43%  219 aa  RIBB_METLZ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     2e-39  42%  217 aa  RIBB_DESAH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     3e-39  38%  217 aa  RIBB_YERP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-39  40%  217 aa  RIBB_SHESR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-39  40%  217 aa  RIBB_SHESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     3e-39  39%  212 aa  RIBB_SHEHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   20::209     3e-39  39%  218 aa  RIBB_ERWT9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-39  40%  217 aa  RIBB_SHEB9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-39  40%  217 aa  RIBB_SHEB2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-39  40%  217 aa  RIBB_SHEB8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     4e-39  40%  217 aa  RIBB_SHEB5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   19::210     4e-39  42%  214 aa  RIBB_RHORT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     4e-39  40%  228 aa  RIBB_PHOPR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::208     2e-38  39%  213 aa  RIBB_BUCAP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::213     2e-38  42%  230 aa  RIBB_BORPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::213     2e-38  42%  230 aa  RIBB_BORPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::213     2e-38  42%  230 aa  RIBB_BORBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-38  42%  214 aa  RIBB_DESVV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::209     3e-38  42%  214 aa  RIBB_DESVH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   38::217     4e-38  43%  227 aa  RIBB_RALSO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     1e-37  39%  218 aa  RIBB_VIBC3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     2e-37  38%  218 aa  RIBB_VIBCM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     2e-37  38%  218 aa  RIBB_VIBCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::199     2e-37  41%  207 aa  RIBB_OCEIH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   41::383     2e-37  31%  422 aa  RIBBA_CORGL RecName: Full=Riboflavin biosynthesis protein
   41::383     2e-37  31%  422 aa  RIBBA_CORGB RecName: Full=Riboflavin biosynthesis protein
   33::209     1e-36  49%  217 aa  RIBB_AERHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     2e-36  38%  228 aa  RIBB_CHLT3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     5e-36  38%  211 aa  RIBB_BUCBP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   33::209     6e-36  47%  217 aa  RIBB_AERS4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::209     1e-35  37%  222 aa  RIBB_CHLL2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   60::205     3e-35  47%  216 aa  RIBB_PSEPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::199     2e-33  37%  204 aa  RIB3_SCHPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   12::193     8e-33  42%  210 aa  RIBB_CHRVO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::211     2e-32  36%  223 aa  RIBB_DESDA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::205     9e-32  37%  208 aa  RIB3_YEAST RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::201     8e-30  35%  204 aa  RIB3_CANAL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::219     4e-27  36%  233 aa  RIB3_MAGGR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::352     2e-22  28%  388 aa  RIBBA_THEMA RecName: Full=Riboflavin biosynthesis protein
    3::219     2e-18  32%  227 aa  RIBB_METJA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::351     1e-17  29%  378 aa  RIBA_ARCFU RecName: Full=GTP cyclohydrolase-2;       
    7::212     7e-16  30%  229 aa  RIBB_METTH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::227     3e-13  28%  247 aa  RIBB_METAC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::227     2e-12  27%  247 aa  RIBB_METMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::214     1e-08  27%  238 aa  RIBB_ARCFU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
  864::997     5e-06  33% 1219 aa  RSE1_CANAL RecName: Full=Pre-mRNA-splicing factor RSE1;
   17::169     1e-04  26%  200 aa  RIBA_PHOPO RecName: Full=GTP cyclohydrolase-2;       
  128::170     5e-04  40%  192 aa  RIBA_HELAH RecName: Full=GTP cyclohydrolase-2;       
   22::95      6e-04  35%  282 aa  ISPH_CLOPE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKR
RIBBA_AQUAE     -----FNTVEEAIEDIRQGKMVIVVDDPDRENEGDLVMAAEKVTPEAINFMAKYGRGLICLSLTPERCEQ
RIBB_PHOLE      ------SSAKEIIDDIRQGRMVILMDDESRENEGDLIIASEMVTPEAINFMATHGRGLICLTLSKARCKT
RIBBA_BACSK     -----FESIDEAITQLKAGGMILVVDDEDRENEGDFLALAETASPETINFMATHGRGLICVPLTEEQAER
RIBBA_BACSU     --------IEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLSEEIADR
RIBBA_SYNWW     -----FSSIEEVIQDIKEGKMIVLVDDEDRENEGDVIIAAEKAGPEAINFMATHAKGLICMPIIGERLDE
RIBBA_UNCTG     MKNKVFASIGDAVKDIKVGRMVIVVDDPGRENEGDLICAAEKASPEVINFMTKYARGLICVPMKHERLKE
RIBB_PHOPO      ------STAQEIIEDIHQGKMVILMDDEDRENEGDLIIASDKVTPEAINFMATYGRGLICLTLNKERCLQ
RIBBA_BACCR     --------IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBB_PSESM      --------IEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCTAQAISFMAREARGLICLTLTDEHCKS
RIBBA_BACC4     --------IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACWK     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEEYAER
RIBBA_BACC2     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_THEPX     --------IEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTEKRLNE
RIBBA_BACA2     --------IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIAGR
RIBBA_BACHK     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC3     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAN     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAH     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAC     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAA     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_THEP3     --------IEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTEKRLNE
RIBBA_BACC0     --------IEEALEDLKQGKVVIVCDDENRENEGDFMALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACAM     --------IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIAGR
RIBBA_BACCQ     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC7     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBB_NEIMB      ---SHISPIPEILADIKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDGEMVEK
RIBBA_PROVI     MENKRIDTIESALEDIGQGKLVIVIDDEERENEGDFIAAADKVTTEMINFITKEARGLLCVAVTMDRAKE
RIBBA_BACCZ     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBBA_BACC1     --------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYAER
RIBB_NEIMA      ---SHISPIPEILADIKVGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDGEMVEK
RIBBA_BREBN     -----FHSIEEALEDLRQGKAVIVVDDEDRENEGDFVCMAEAATPEMINFMVTHGRGLVCVPVTEEHATR
RIBBA_GEOSW     --------IEEAIYELMQGKVIIVCDDEDRENEGDFVALAEKATPEVINFMIKYGRGLVCVPITEELADK
RIBBA_SYNY3     ---------------------------ENRENEGDLICAAQFATPALVNFMAVEARGLICLAMTGDRLDE
RIBB_DEHMU      --------VNQAIEDIRQGKMVVMVDDEDRENEGDLVYAASFSTPQKVNFMASHAKGLICVAISKKIANR
RIBBA_CHLPN     ----NFVSLERAIEDLRAGKFVIVVDEASREDEGDLIIAGEKITVEKMTFLLQHTTGVVCAALSQERLLS
RIBBA_PELLD     -----FDTIESAVEDIRQGKLVIVIDDEDRENEGDFIAAADHVTTEMINFITREARGLLCVAVTMERARE
RIBBA_CHLMU     ------ASVQQAIKDIADGNFVIVIDRESRENEGDLILAGEKVSAEKMAFLLSHTTGIVCASVTREQARV
RIBBA_CLONN     MEQFKFNTIEEAIEDIKNGKMXXXXXXXXXXXXXXLLMAAEKVTPEAINFMAKYARGLICMPMTEEKLKE
RIBB_WOLSU      --------VREAIEAIKKGEMIIMMDDEDRENEGDLVYAAAFSTPEKVNFMVSEAKGLVCVCVTSTCSDR
RIBBA_CYTH3     MEQIKLDSIADAIEAIRKGEVIIVVDDEDRENEGDFICAAECVTPEIINFMSKEGRGLICAPISEARCTE
RIBBA_CHLTR     ------ASVQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKMSFLLSHTTGIVCASLSREQAKS
RIBBA_BACCN     --------IEEALEDLKQGKVIIVCDDKNRENEGDFLALAEYITPETINFMITHGRGLVCVPLPEHYAKR
RIBB_HELPY      ----------------KNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKDLAKK
RIBBA_SALTO     -----FGTIEQAMAEILAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICASLTEDDCDR
RIBB_HELPJ      ----------------KNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKDLANK
RIBBA_STAES     -----FDTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAKEGRGLICAPIDKSIAER
RIBBA_STAEQ     -----FDTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAREGRGLICAPIDKSIAER
RIBBA_BACFR     -------TIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEERCAE
RIBBA_BACFN     -------TIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEERCAE
RIBBA_ACTPJ     -----FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_ACTP7     -----FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBB_CAMJE      -----FVSVEQAIKDLQAGKMLVMVDAEDRENEGDLIFPAQFSTQEKVNFMIKEARGVVCVALDETLAKK
RIBB_PSEAE      -------TIDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVRTEDINFMVKHARGLVCMPMTRERCER
RIBB_HELHP      --------IKEAIEAIKQGEMIIIMDDEDRENEGDLVMAGIFSSPQKINFMAQEARGLICVSITQELAQK
RIBBA_ACTPL     -----FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_ACTP2     -----FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPISTEIAKK
RIBBA_SALAI     -----FGTIEQAMAEIVAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICAPLTEDECDR
RIBBA_PELPB     MDKKNFDTIDAALEDIRQGKLVIVIXXXXXXXXXXFIGAADKVTNEMVNFITREARGLLCVAVTMDRAKE
RIBBA_MYCUA     -------SVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAVCDR
RIBBA_PROA2     MSEKKIDSIESAIEDLKNGKLIIVIXXXXXXXXXXFIAAADKVTPEMVNFITKEARGLLCVAVTMDRAKE
RIBBA_STAHJ     -----FDEIKDALNALKRGESIIVVDDEDRENEGDLVAITQWMNDNTINFMAKEGRGLICAPISKDLALK
RIBBA_MYCMM     -------SVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAVCDR
RIBBA_BACV8     MEELKLNTIEEAIADFREGKFVIVVDDEDRENEGDLIVAAEKITPEQVNFMLKHARGVLCAPITISRCKE
RIBBA_MYCTU     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCTA     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCBT     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCBP     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCBO     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCVP     -------SVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGDICDR
RIBBA_MYCPA     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCA1     -------SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDR
RIBBA_MYCGI     -------SVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGEICDR
RIBBA_STAAN     -----FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAM     -----FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_PORGI     MEEIKLNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISEERAHE
RIBBA_PORG3     MEEIKLNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISEERAHE
RIBBA_BACTN     --------IEDAIADFKEGKFVIVVDDEDRENEGDLIIAAEKITPEKVNFMLKHARGVLCAPITVSRCKE
RIBBA_STAS1     -------SIDTALQALKKGESIIVVDDENRENEGDLVAVTEWMNDNTVNFMATYGKGLICAPISNAIAEK
RIBBA_STAAW     -----FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAS     -----FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAR     -----FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_STAAC     -----FDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSKDIAQR
RIBBA_ARATH     -----FSSIPEAIEDIRQGKLXXXXXXXXXXXXXXLVMAAQLATPEAMAFIVRHGTGIVCVSMKEDDLER
RIBB_TOLAT      ---NPFQRVEQALSALQQGNGVLVVDDEDRENEGDLIFSAEKMTPQQMALMIRECSGIVCLCLTEERIRQ
RIBB_VIBFI      --------VEQAIKSVQQGNGVLLLDDESRENEGDLIYSVDHLTSEQMALMIRSCSGIVCLCLTEDKADY
RIBB_HAEIE      ------------INAFKNGNGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_VIBHA      --------VERAIEALKNGLGVLLMDDEDRENEGDLIFSAQHLTEAQMALMIREGSGIVCLCLTEERANW
RIBBA_MYCA9     -----------------------------------LIFAAEKATPELVAFMVRYTSGYLCVPLAGEDCDR
RIBB_HAEIG      ------------INAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_PASMU      ------------INAFKQGNGVLVLDDEDRENEGDLIFPAETITVEQMTMLIRYGSGIVCLCLSDEICQQ
RIBB_HAEIN      ------------INAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_HAEI8      ------------INAFKHGTGVLVLDDEDRENEGDLIFPAETITSEQMAKLIRYGSGIVCLCITDERCQQ
RIBB_WIGBR      --------VKNALQSLKRGNGILVLDDENRENEGDMIFAAENMTVNQMALAIRFGSGIVCICLTKEKCKI
RIBB_CLOBL      ---NSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMAMLIRECSGIVCLCLTDEKVKK
RIBBA_RHOE4     -----------------------------------LIFAAEKATPELVAFMVRYTSGYLCVPLDGDDCDR
RIBBA_NOCFA     -----------------------------------LIFAAEKATPELVAFMIRYTSGYICVPLTGEDCDR
RIBB_VIBPA      --------VENALIALKEGRGVLLLDDEDRENEGDIIYSVEHLTNEQMALMIRECSGIVCLCLTDAQADK
RIBB_PSEHT      --------VENAITALQQGQGVLVVDDENRENEGDFVFSAEHLTTAQMAEMIREGSGIVCLCMGEERIKQ
RIBB_CLOBH      ---NSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTDKKVKK
RIBB_CLOB1      ---NSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTDKKVKK
RIBB_BLOFL      ------------LDALSNGRGILVVDDENRENEGDMIFAAENMTVKQMALAIRYGSGIVCLCLTEEKCRQ
RIBB_SODGM      --------VENALESLRNGRGVLVLDDEDRENEGDMIFAAQNMTVEQMALTIRYGSGIVCLCLTEERRQQ
RIBB_SHISS      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIFL      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIF8      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIDS      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIBS      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SHIB3      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOUT      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECOSM      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOSE      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOLU      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOLI      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOLC      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOL6      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECOL5      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOK1      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECOHS      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECODH      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECOBW      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO8A      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO81      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECO7I      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO5E      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO57      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO55      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ECO45      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECO27      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITDDRRKQ
RIBB_ECO24      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_ESCF3      -----FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTIEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_VIBVY      --------VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHANK
RIBB_VIBVU      --------VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHANK
RIBB_VIBSL      --------VENALQALREGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEQANQ
RIBB_DESPS      --------VEKSLQALRQGEGVLLVDDEDRENEGDLIYSAEHLTAKQMALMIREGSGIVCLCLTGEKVDE
RIBB_CITK8      -----FERVEHALSALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_BAUCH      --------VEIALQALRHGRGVLVLDNEDRENEGDMIFAAEKMTIEQMALAIRYGSGIICLCLTEERRQQ
RIBB_PECCP      --------VERALDALRHGRGVLVLDDEDRENEGDMIFSAENMTVEQMALTIRHGSGIVCLCLTEERRQQ
RIBB_KLEP7      -----FERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRKQ
RIBB_KLEP3      -----FERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEDRRKQ
RIBBA_PARD8     -------TIEEAIEDFREGKFLIVVDDEDRENEGDFIIAAEKVTPEKINFMLKNGRGVLCAPITEERCQE
RIBB_ERWCT      --------VERALDALRHGRGVLVLDDEDRENEGDMIFSAESMTVEQMALTIRHGSGIVCLCLTEERRQQ
RIBB_SHEFN      --------VENALAALREGRGVLLLDDEDRENEGDIIYSVEHLTTAQMALMIRECSGIVCLCLTDEHANK
RIBB_RALEJ      --------IAQALDAMREGRPVVLLDDDDRENEADLILAAECLTPSNMAMMIRECSGIVCLCLTTDKVRQ
RIBB_HAES1      --------VKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQ
RIBB_MANSM      ----------------KQGNGVLVLDDENRENEGDLIFPAETITTEQMAKLIRYGSGIVCLCITDELCQK
RIBB_EDWI9      --------VERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRHGSGIVCLCITEARRQQ
RIBB_DESAA      --------VEKGLQALRDGQGVLVADDENRENEGDLIFSAESLTEAQMAMLIRECSGIVCLCMPDEKIRS
RIBB_AGRT5      ------AKIEDAIEAISRGEMVIVVDDEDRENEGDIIAASDSITPQQIAFMMNHARGLVCVAMPGERLDA
RIBB_SALTY      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALTI      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALSV      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALPC      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALPB      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALNS      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALHS      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALG2      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALEP      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALDC      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALCH      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALA4      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_HAES2      --------VKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQ
RIBBA_RHOSR     -----------------------------------LIFAAEKATPELVAFMVRYTSGYLCVPLDGADCDR
RIBB_SALPK      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_SALPA      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_PROMH      --------VERALEALRAGKGVMVLDDENRENEGDMVFVAETMTTEQMAMSIRHGSGIVCVCITEERRQQ
RIBB_BUCAT      --------IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQ
RIBB_BUCAI      --------IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQ
RIBB_BUCA5      --------IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKRKQ
RIBB_SHESH      --------VETALISLKQGRGVLVVDDEDRENEGDLIYSAETLTNEQMALLIREGSGIVCLCLPDERVKH
RIBB_HAMD5      ---NSVARVKKALENLKNGHGVMVLDDENRENEGDFVFAAETMTVEQMALTIRHGSGIVCLCLTEERCQQ
RIBB_SALAR      -----FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQ
RIBB_PELCD      ------------IDRLRQGRGVLLVDDENRENEGDLIFPAETITPAQMAMMIRECSGIVCLCLTEDKLKQ
RIBB_ENT38      --------VEHALDALREGRGVMVLDDEHRENEGDMIFAAENMTVEQMALTIRHGSGIVCLCINEERRKQ
RIBB_DESAD      --------VEKGLQALREGRGILVTDNESRENEGDLIFSAEKLSDEQMAMMIRECSGIVCLCLTDEKTEQ
RIBB_SERP5      --------VERALEALRNGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRQQ
RIBB_YERE8      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTVEQMALTIRHGSGIVCLCITDERRQQ
RIBB_SHEWM      --------VEAALTSLRQGQGVLVVDDEDRENEGDLIYSAQSLTNEQMALLIRECSGIVCLCLTDERIKQ
RIBB_DESDG      --------VEAALDALRRGHGVLVTDDEDRENEGDLIFAAETLSDSQMAMLIRECSGIVCLCLTDEKVRA
RIBB_DESRM      -----FERVERALRSLRNGNGVLVTDDENRENEGDLIFPAQTLNEVQMAMLIRECSGIVCLCLTDEKVRS
RIBB_SHESW      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEPC      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNTQMAMLIRECSGIVCLCLPDEKVKA
RIBBA_CORAM     -------------------------DNEDRENEGDLIFAAELATPELVAFMVRYSSGYICVPLLPEDCKR
RIBB_PELPD      --------VEAALDALRAGQGVLVTDDEQRENEGDLIFAAQSLTREQVAMLIRECSGIVCLCLTDEAVRR
RIBB_SHELP      --------VEAALTALRAGQGVLVVDDEDRENEGDLIYSAEHLTQEQMALLIRECSGIVCLCLTDERVKQ
RIBB_PHOLL      --------VEHAINALRDGKGVMVLDNEDRENEGDIIFAAETMTVEQMALTIRYGSGIVCLCLTEERRQQ
RIBB_ENTS8      -----FERVENAIAALREGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERRKQ
RIBB_SHEPW      ---NAIERVNAALTALREGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTDERITQ
RIBB_SHEPA      ---NPIERVNAALSALRQGKGVLVVDDEDRENEGDLIYSAETLTNQQMALLIRECSGIVCLCLTDERIKQ
RIBB_SHESA      --------VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEON      --------VEAGLNALRQGLGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_METLZ      -----FNTIEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMPMGRSLVEK
RIBB_DESAH      ---NPIERVDRAIDALVSGRGVLLVDDEDRENEGDLIFPAGNITAEQVALLIRECSGIICLCLPPERIEQ
RIBB_YERPY      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPS      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPP      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPN      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPG      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPE      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPB      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERPA      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_YERP3      --------VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQ
RIBB_SHESR      --------VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHESM      --------VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEHH      ---NAIERVNAALTALRQGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTDERIEQ
RIBB_ERWT9      ------------IEALRAGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLNEERLEQ
RIBB_SHEB9      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEB2      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKVKA
RIBB_SHEB8      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKIKA
RIBB_SHEB5      --------VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKIKA
RIBB_RHORT      --------VSRAVDSLRQGQGVIVVDDEDRENEGDLIFAAETLTAEQMSRMIRDGSGIVCLILTDPDLDR
RIBB_PHOPR      -----FERVEAGLTAIREGRGVLVVDDEDRENEGDIIFAAETLTSEQMALMIRECSGIVCLCLTDERVKQ
RIBB_BUCAP      ---NPIERVKKAISALQLGEGIIILDDEKRENEGDLVFSSETMTVEQMALTIRYGSGIVCLCITESKRKK
RIBB_BORPE      --------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDR
RIBB_BORPA      --------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDR
RIBB_BORBR      --------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDR
RIBB_DESVV      --------VERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERVSR
RIBB_DESVH      --------VERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERVSR
RIBB_RALSO      ----------------------VVLDDADRENEADLIIAADRLTHAGMAMLIRECSGIVCLCLTAEKAAV
RIBB_VIBC3      --------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTVQMALMIRECSGIVCLCLTEAQADR
RIBB_VIBCM      --------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADR
RIBB_VIBCH      --------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADR
RIBB_OCEIH      ---NELSKIEQAIEDLRNGKLIIVADDADREAEGDLVGLSEFVTPEKVNFMTKYGRGLICVPITEERALE
RIBBA_CORGL     -----------------------------------IIFAAELATPELVAFMVRYSSGYICAPLTAKDADR
RIBBA_CORGB     -----------------------------------IIFAAELATPELVAFMVRYSSGYICAPLTAKDADR
RIBB_AERHH      -------------------------DDEDRENEGDLIFAAESMTNEQMAMMIRECSGIVCLCLTDERVRQ
RIBB_CHLT3      ---DEFTRVENALTALRSGKGILVSDSPDRENEADLIFSAEFLTETQMAMLIRECSGIVCLCLTTEKVQA
RIBB_BUCBP      --------VKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITESKRKQ
RIBB_AERS4      -------------------------DDEDRENEGDLIFAAQTMTNEQMAMMIRECSGIVCLCLTDERVRQ
RIBB_CHLL2      ---NQLNLVEKALAALRNGQGVLVADDPGRENEADLIFPAESVTIPQMALLIRECSGIVCLCMTDGKIRS
RIBB_PSEPK      --------------------------------------------------------GIVCLCLDEATVDE
RIB3_SCHPO      ------ASIEEAVNDFRDGKFLIVLDDETRENEGDLIIAGCKVTTEQMAFLVRHSSGYVCVPMTGERLDS
RIBB_CHRVO      --------VHAALDALRRGLPVIVADDADRENEADLILAADTLTVPEMARMIRDGSGIVCLCLTPERAER
RIBB_DESDA      --------VQKALASLRAGGGVLVVDDEDRENEGDLIFPAQTITVPQMAMLIRHCSGIVCLCLTDEYTRR
RIB3_YEAST      -----FTPIDQAIEHFKQNKFVIVMDDAGRENEGDLICAAENVSTEQMAFLVRHSSGYVCAPMTNAIADK
RIB3_CANAL      ---NIFTPIEEALEAYKNGEFLIVMDDEDRENEGDLIMAAELITQEKMAFLVRYSSGYVCVPLSEERANQ
RIB3_MAGGR      --KSNFDAIPDVIQAFKNGEFVVVLDDPSRENEADLIIAAESVTTEQMAFMVRHSSGLICAPLTPERTTA
RIBBA_THEMA     -------------------GKPVILIDRNRENEADFVFPAQLITEDVVSFFVTYGKGLFCVTADEEDLLK
RIBB_METJA      -------NVEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDICNK
RIBA_ARCFU      --------MEEVSSHVKSGKPVMILDSEKSA----ICIPAEVVSGEILNFMMK-NCDEIRLALTWKQI--
RIBB_METTH      --------IQEALKALRRGEIVLVFDADNRERETDMIVAAEKIKPEHIRIMRNDAGGLICVPVSWENSEK
RIBB_METAC      -------NINRALEVLRAGKMIQIYDSDSREGETDLVIPAKAVTYKDVKWMRKDAGGLICVAVDPVASKQ
RIBB_METMA      --KYSNENINRALEALRAGKMIQIYDSDSREGETDLVIPAKAVTYTDVKWMRKDAGGLICVAVDPVASKQ
RIBB_ARCFU      ---------EESLRAFRKGSPVLIYDFEDREGETDIAIPAIHVGKDEVAMMRIDGGGLICVAIHPVAAEK
RSE1_CANAL      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
ISPH_CLOPE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGV
RIBBA_AQUAE     LDLHPMTPMNTDPKGTYFCVSIDAKHGTTTGISAYDRALTIKLAISPDAKPSDFVRPGHVFPLKARPGGV
RIBB_PHOLE      LNLPLMVQGNNDNFSTPFTISIEAAKYVTTGISASDRAKTVLAAVAPNAKSTDIVMPGHIFPLMAQDGGV
RIBBA_BACSK     LQLGQMVSHSTDPHGTAFTVSVDHSH-TTTGISAFERAETVRALADANAQPSDFKRPGHVFPLVAKNGGV
RIBBA_BACSU     LDLHPMVEHNTDSHHTAFTVSIDHRE-TKTGISAQERSFTVQALLDSKSVPSDFQRPGHIFPLIAKKGGV
RIBBA_SYNWW     LEIHDMVTENTDNHETAFTVTVDYR-GTTTGISAFERAATVKALIDSVSKPSDFRKPGHIFPLRYREGGV
RIBBA_UNCTG     LEIENMVEKPTEKKGCSFTVSVDYKIGTTTGISAYDRSVTVRKLIDKTAKHEDFARPGHIFPLRCKEGGV
RIBB_PHOPO      LELPMMVKSNTDKFATPFTISIEAASGVTTGISVNDRXXXXXXXXXXXXXXKDIVMPGHIFPLMAQDGGV
RIBBA_BACCR     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGADFNRPGHIFPLIAKEGGV
RIBB_PSESM      LGLEQMVPSNGSVFATAFTVSIEATTGVTTGISAADRARTVQAAVNPGAVPDDLVQPGHIFPLRARDGGV
RIBBA_BACC4     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACWK     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGSDFNRPGHIFPLIAKEGGV
RIBBA_BACC2     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGTDFNRPGHIFPLIAKEGGV
RIBBA_THEPX     LGIYQMVENNTDHKETAFTVSVDYKE-CTTGISAFERALTVKKLVDDNSKPEDFTKPGHIFPLRAKDGGV
RIBBA_BACA2     LDLHPMVDHNTDSHETAFTVSIDHRL-TKTGISAQERSFTIQALLNEESVSDDFQRPGHIFPLIAKKGGV
RIBBA_BACHK     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACC3     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACAN     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACAH     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACAC     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACAA     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_THEP3     LGIYQMVENNTDHKETAFTVSVDYKE-CTTGISAFERALTVKKLVDDNSKPEDFTKPGHIFPLRAKDGGV
RIBBA_BACC0     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACAM     LDLHPMVDHNTDSHETAFTVSIDHKL-TKTGISAQERSFTIQALLDEESVPGDFQRPGHIFPLIAKKGGV
RIBBA_BACCQ     LQLEPMVAHNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACC7     LQLEPMVAHNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAKEGGV
RIBB_NEIMB      LGLPMMTQKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQKGGV
RIBBA_PROVI     LQLEPMVQRNTSQHETNFTVSVDAAEGVTTGISVYDRAMTIKMLGDETSHADSFSRPGHIFPLRAMDGGV
RIBBA_BACCZ     LQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAKEGGV
RIBBA_BACC1     LQLEPMVAHNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAKEGGV
RIBB_NEIMA      LGLPMMTQKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQKGGV
RIBBA_BREBN     LQLAPMVNANTDKQGTAFTVSID-EGSTNTGISAHERSQTVLAMLDEQKDADDFRRPGHIFPLIAKAGGV
RIBBA_GEOSW     LDLAPMVNHNTDSHGTAFTVSIDYKS-TTTGISAYERSMTIQALLDPNAKASDFKRPGHVFPLVAKKGGV
RIBBA_SYNY3     LDLPLMVSKNTDSNQTAFTVSIDAAPGVTTGISAEDRARTIQIAINPVTRPEDLSRPGHIFPLRAKTGGV
RIBB_DEHMU      LQLEPMVKKNDSSYETAFTITVDARTA-ATGISAGERDMTIKILADGGSHESELVRPGHIFPLIAKEGGA
RIBBA_CHLPN     LDLPPMVKDNRCRFKTPFTVSVDAAHGVTTGVSAADRTKVVQLLADPKSKPEDFISPGHFFPLASSPGGV
RIBBA_PELLD     LQLDPMVQRNTSQHETNFTVSVDAAEGVTTGISVYDRATTIKMLGDPASHADSFSRPGHIFPLRAMDGGV
RIBBA_CHLMU     LDLPAMVQENQCAFKTAFTVSVDASSGITTGVSAADRTRTVQLLSDPTSISQSFVRPGHVFPLVSQPGGV
RIBBA_CLONN     LDLYQMVINNTDTKETAFTVSIDSVE-TTTGISAFERALTITKAVEKGAKAKDFQRPGHIFPLRARKGGV
RIBB_WOLSU      LGLAPMVRENNSQHETAFTVSIDARE-CSTGISAFERDLTIRKMVDGTSKPEDFVRPGHIFPLIAKEGGV
RIBBA_CYTH3     LKLDLMVGSNTATHETPFTVSVDLLNGCTTGISASDRSKTIRALVDPDTKPEDLGRPGHIFPLKAKDEGV
RIBBA_CHLTR     LDLPAMVQDNQCAFKTAFTVSVDASSGVTTGVSASDRTRTVQLLADPAATAESFVRPGHVFPLISQPGGA
RIBBA_BACCN     LQLEPMVSQNTDSHHTAFTVSID-HISTTTGISAHERATTVRELLNPSSKGSDFNRPGHIFPLIAKDGGV
RIBB_HELPY      FELPPMVSVNDSNHETAFTVSIDAKEA-RTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAKDGGV
RIBBA_SALTO     LDLPPMHHTNQDRRGTAYMVTVDARKGVSTGISAADRARVIRLLADPSTTPDDLARPGHVVPLRAREGGV
RIBB_HELPJ      FELPPMVSVNDSNHETAFTVSIDAKEA-KTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAKDGGV
RIBBA_STAES     LKLQSMEQNNTDIYGTHFTVSIDHYK-TTTGISAHERTQTARALIDENTNPEDFHRPGHLFPLIAKENGV
RIBBA_STAEQ     LKLQSMEQNNTDIYGTHFTVSIDHYK-TTTGISAHERTQTARALIDENTNPEDFHRPGHLFPLIAKENGV
RIBBA_BACFR     LELDMQVSSNTSIYETPFTVTVDLLEGCTTGVSMHDRAMTIRALADPKTKPADLGRPGHINPLRARSRGV
RIBBA_BACFN     LELDMQVSSNTSIYETPFTVTVDLLEGCTTGVSMHDRAMTIRALADPKTKPADLGRPGHINPLRARSRGV
RIBBA_ACTPJ     LNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFRCPGHMFPLIAKDGGV
RIBBA_ACTP7     LNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAKDGGV
RIBB_CAMJE      FELPLMVPKNTSNHETAFTITVDAKDA-TTGVSAYERNMTIQIFADDNAKASDFVRPGHINPLIAKKGGV
RIBB_PSEAE      LGLPLMVQRNGSGFGTKFTVSIEAAEGVTTGISXXXXXXXXXXXXXXXXXXXXIVSPGHIFPLMAQPGGT
RIBB_HELHP      LDLPPMVQKNDSNHETAFTISIDAKEA-KTGISAFERDMTIRLMCESNTKPSDFVRPGHIFPLIAKEGGV
RIBBA_ACTPL     LNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAKEGGV
RIBBA_ACTP2     LNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAKEGGV
RIBBA_SALAI     LDLPPMHHTNQDRRGTAYTVTVDAREGVSTGISAADRAHTIRLLADPRTGPADLARPGHVVPLRARQGGV
RIBBA_PELPB     LQLDPMVQRNTSQHETNFTVSVDAAEGVTTGISVYDRAMTIKMLGDLSSTADDFSRPGHIFPLRAMDGGV
RIBBA_MYCUA     LGLLPMYAVNQDKHGTAYTVTVDAKNGVGTGISASDRATTMRLLADPASVAEDFTRPGHVVPLRAKDGGV
RIBBA_PROA2     LQLDPMVQRNTSQHETNFTVSVDAAEGVTTGISAFDRYMTIKMLADPVSHADNFSRPGHIFPLRAMDGGV
RIBBA_STAHJ     FNLMPMVEHNTDGFGTNFTVSIDHAT-TSTGISAFDRMATARALINPESTPEDFHKPGHLFPLIAKENGV
RIBBA_MYCMM     LGLLPMYAVNQDKHGTAYTVTVDAKNGVGTGISASDRATTMRLLADPASVAEDFTRPGHVVPLRAKDGGV
RIBBA_BACV8     LELPHQVDTNTSVLGTPFTVTVDKLEGCSTGVSIHDRAATIRALADPTSTPETFGRPGHVNPLYAQDKGV
RIBBA_MYCTU     LGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGV
RIBBA_MYCTA     LGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGV
RIBBA_MYCBT     LGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGV
RIBBA_MYCBP     LGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGV
RIBBA_MYCBO     LGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAKDGGV
RIBBA_MYCVP     LGLLPMYAVNQDKHGTAYTVTVDAKKGVGTGISAMDRATTMRLLADPDAVADDFTKPGHVVPLRAKDGGV
RIBBA_MYCPA     LGLLPMYAVNQDKHGTAYTVTVDARNGVGTGISASDRATTMRLLADPTSIAEDFTRPGHVVPLRAKDGGV
RIBBA_MYCA1     LGLLPMYAVNQDKHGTAYTVTVDARNGVGTGISASDRATTMRLLADPTSIAEDFTRPGHVVPLRAKDGGV
RIBBA_MYCGI     LGLLPMYAVNQDKHGTAYTVTVDAKVGVGTGISASDRATTMRLLADPDSVADDFTKPGHVVPLRAKDGGV
RIBBA_STAAN     LDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDKGV
RIBBA_STAAM     LDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDKGV
RIBBA_PORGI     LELEMQVPDNTSVHETPFTVTVDRLNGCTTGVSMYDRAQTILALADPNTRPSDLGRPGHICPLRARSRGV
RIBBA_PORG3     LELEMQVPDNTSVHETPFTVTVDRLNGCTTGVSMYDRAQTILALADPNTRPSDLGRPGHICPLRARSRGV
RIBBA_BACTN     LDLPHQVSDNTSVLGTPFTVTIDKLEGCSTGVSASDRAATIQALADPASTPATFGRPGHINPLYAQEKGV
RIBBA_STAS1     LDLNPMVTHNSDVYGTQFTVSVDHIQ-TTTGISADERTMTARALIDEQATGSDFNKPGHLFPLIAQDNGV
RIBBA_STAAW     LDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDKGV
RIBBA_STAAS     LDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDKGV
RIBBA_STAAR     LDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDKGV
RIBBA_STAAC     LDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQDKGV
RIBBA_ARATH     LHLPLM--VNQKENETAFTVTVDAKHGTTTGVSARDRATTILSLASRDSKPEDFNRPGHIFPLKYREGGV
RIBB_TOLAT      LALPMMVEHNTSANQTGFTVTIEAARGVTTGVSAQDRITTIRTAIADGAVASDLNRPGHVFPLRARAGGV
RIBB_VIBFI      LELSPMVEHNESVNQTAFTISIEAKKGVTTGVSATDRVTTIKTACKNGALPHELAKPGHVFPLRAKDGGV
RIBB_HAEIE      LDLPSMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAANGGV
RIBB_VIBHA      LDLPPMVKDNCSKNQTAFTVSIEAKEGVTTGVSAKDRVTTVKTATYFDAQPEDLARPGHVFPLVAKTNGV
RIBBA_MYCA9     LGLLPQYAVNQDKHGTAYTVTVDAKNGIGTGISASDRAATMRLLADAASTADDFTKPGHVVPLRAKDGGV
RIBB_HAEIG      LDLPSMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAVNGGV
RIBB_PASMU      LDLPPMVTENTSVNKTAFTVTIEAAKGVSTGVSATDRVTTIRAAVADNAKPSDLSRPGHIFPLRAMTGGV
RIBB_HAEIN      LDLPPMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVLTDLHRPGHVFPLRAANGGV
RIBB_HAEI8      LDLPPMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAANGGV
RIBB_WIGBR      LNLPMMVKKNNSKYKTAFTVSIESAYGITTGVSAYDRIITIKTAIKDNAKPDDLNRPGHVFPLQAHPGGI
RIBB_CLOBL      LGLTQMVSNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRARAGGV
RIBBA_RHOE4     LGLPPMYATNQDKHGTAYTVTVDAREGIGTGISASDRAATMRLLANPESGANDFTRPGHVVPLRAKEGGV
RIBBA_NOCFA     LGLPPMYATNQDKHGTAYTVSVDAREGITTGISAADRATTMRXXXXXXXXXXXXTRPGHVVPLRAKDGGV
RIBB_VIBPA      LELPPMVVNNNSANQTAFTVSIEAKVGVTTGVSAADRVTTIKTAANPHAKPEDLARPGHVFPLRARPGGV
RIBB_PSEHT      LDLPQMVTHNTSQNNTAYTITIEAKEGVTTGVSAADRVTTIKAATADNAKPEDLSRPGHVFGLKAKTGGV
RIBB_CLOBH      LGLTQMVHNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRARAGGV
RIBB_CLOB1      LGLTQMVHNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRARAGGV
RIBB_BLOFL      LKLPMMVKNNSNHYKTAFTVTIEASKGITTGVSAKDRLTTIKTSIEDYAKPSDLNRPGHVFPLRAHNGGV
RIBB_SODGM      LALPMMVERNSSHYQTAFTVTIEAAEGVSTGVSAADRLTTIRAAIKDNAKPTDLNRPGHVFPLCAQPGGV
RIBB_SHISS      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SHIFL      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SHIF8      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SHIDS      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SHIBS      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SHIB3      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOUT      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOSM      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADDAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOSE      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOLU      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADDAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOLI      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOLC      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOL6      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOL5      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOK1      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOHS      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECODH      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECOBW      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO8A      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO81      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO7I      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO5E      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO57      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO55      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO45      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO27      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ECO24      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_ESCF3      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_VIBVY      LELPPMVVNNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAKADDLARPGHVFPLRARPGGV
RIBB_VIBVU      LELPPMVVNNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAKADDLARPGHVFPLRARPGGV
RIBB_VIBSL      LELPPMVVDNNSANQTAFTVTIEAKVGVTTGVSAADRVTTIKTAANPTAKPTDLARPGHVFPLRARKGGV
RIBB_DESPS      LKLPQMVTNNNSRHGTGFTISIEARDGVTTGVSAADRTQTVKAAIAEGAVAEDLCQPGHVFPLRARDNGV
RIBB_CITK8      LDLPMMVENNTSAYGTGFTVTIEAAKGVTTGVSAADRVTTVRAAIADGAKPADLHRPGHVFPLRAQPGGV
RIBB_BAUCH      LELPMMVEHNTSHYQTAFTVTIEAAEGVTTGVSAADRITTIRTAIKNDAIPEDLNRPGHVFPLLAQPGGV
RIBB_PECCP      LELPMMVEKNSSHYQTAFTVTIEAAEGVTTGVSAADRLTTIRAAIADNAKPSDLNRPGHVFPLRAQPGGV
RIBB_KLEP7      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQPGGV
RIBB_KLEP3      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQPGGV
RIBBA_PARD8     LELDMQVANNTSLLGTPFTITVDKLGGCTTGVSMYDRAETILALADPKTKPSDLGRPGHINPLRARSRGV
RIBB_ERWCT      LELPMMVEKNSSHYQTAFTVTIEAAEGVTTGVSAADRLTTIRAAIADNARPSDLNRPGHVFPLRAQPGGV
RIBB_SHEFN      LQLPPMVINNNSANQTAFTISIEAKHGVTTGVSAQDRVTTIKTAANRDAKASDLAHPGHVFPLRARAGGV
RIBB_RALEJ      LGLRPMVENNRSQYGTAFTVSIEAREGVTTGVSAVDRITTIRAAIAKDAGTDAVVSPGHVFPLVAVDGGV
RIBB_HAES1      LDLSPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQAAIADNAKPQDLSRPGHVFPLRAKKGGV
RIBB_MANSM      LELPPMVAANTSVNKTAFTVTIEAAEGVSTGVSAADRVTTVKVAVADNAKPSDLHHPGHVFPLRAAENGV
RIBB_EDWI9      LDLPMMVSNNTSHYGTAFTVTIEAAEGVTTGVSAQDRLTTVRAAIADDAKPGDLHRPGHVFPLRARPGGV
RIBB_DESAA      LELPMMVEDNSSRYGTAFTVSIEAAQGVTTGVSAKDRVTTVKTAAADGAKPADLSKPGHVFPLRARPGGV
RIBB_AGRT5      LDIPLMVSRNTESLKTAFTVSVDYIPGTTTGISAADRAKTVRALVSEGSRPEDFARPGHIFPLRANPEGV
RIBB_SALTY      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALTI      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALSV      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALPC      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALPB      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALNS      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALHS      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALG2      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALEP      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALDC      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALCH      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALA4      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_HAES2      LDLPPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQVAIADNAKPQDLSRPGHVFPLRAKKGGV
RIBBA_RHOSR     LGLPPMYATNQDKHGTAYTVTVDAREGIGTGISASDRAATMRLLADPSSGAQDFTRPGHVVPLRAKEGGV
RIBB_SALPK      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_SALPA      LDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQAGGV
RIBB_PROMH      LDLPMMVENNTSHFHTAFTVTIEAAQGVTTGVSAADRLTTVRAAAADNAKPSDLNRPGHVFPLRAQPGGV
RIBB_BUCAT      LNLPMMVKKNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKGGV
RIBB_BUCAI      LNLPMMVKKNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKGGV
RIBB_BUCA5      LNLPMMVKKNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKGGV
RIBB_SHESH      LALPPMVENNSSQYGTAFTVSIEAKEGVTTGVSAADRVTTIKTAIADDAQPDDLARPGHVYPLRAQPGGV
RIBB_HAMD5      LELPMMVEKNSSTFQTPFTVSIEAAKGVTTGVSASDRITTIKAAISQTAKPADLHRPGHVFPLKGHPKGV
RIBB_SALAR      LDLPMMVQNNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQAGGV
RIBB_PELCD      LELPQMVSDNTSANQTAFTLSIEARQGVTTGVSAADRVTTIRTAVADDCRPDDLARPGHVFPLRARPGGV
RIBB_ENT38      LDLPMMVENNTSAFGTGFTVTIEAAHGVTTGVSAADRLTTVRAAIADGAKPSDLHRPGHVFPLRAQAGGV
RIBB_DESAD      LGLPMMVESNSSRYQTGFTVTIEAAEGVTTGVSAADRVTTVKAAIADGAKPADLHRPGHVFPLRAREGGV
RIBB_SERP5      LELPMMVTNNSSQFQTAFTVTIEAAQGVTTGVSASDRLTTIRAAVADNAKPSDLNRPGHVFPLRAQPGGV
RIBB_YERE8      LDLPMMVANNSSQFQTAFTVTIEAAKGVTTGVSAADRLTTIRAAIADNAKPTDLNRPGHVFPLRGQPGGV
RIBB_SHEWM      LDLPPMVEDNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAVPEDLARPGHVYPLRAQSGGV
RIBB_DESDG      LGLPMMVENNSSQYQTAFTVSIEASCGVSTGVSAADRVCTIQAAIADDACPSDLCRPGHVFPLRARPGGV
RIBB_DESRM      LGLPMMVENNSSRFKTAFTVTIEAAHGVTTGVSAADRVKTVKTAVAENAKPEDLNRPGHVFPLRACPGGV
RIBB_SHESW      LELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQPGGV
RIBB_SHEPC      LELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQPGGV
RIBBA_CORAM     LNLPPMMGRNEDVRGTAYTVTVDANTG-TTGISATSRAETMLRLADPMSVVDDFTRPGHVVPLAARPNGV
RIBB_PELPD      LDLPLMVSDNSSRYQTAFTVSIEAAEGVTTGVSAADRLTTIRAAIADDAGPLCLSRPGHVFPLRARPGGV
RIBB_SHELP      LELPPMVEDNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADDAKPSDLARPGHVYPLRAQPGGV
RIBB_PHOLL      LQLPMMVENNSSPFQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXNAKPSDLNRPGHVFPLRAQPGGV
RIBB_ENTS8      LDLPMMVENNTSAFGTGFTVTIEAAHGVTTGVSXXXXXXXXXXXXXXXXKPSDLHRPGHVFPLRAQPGGV
RIBB_SHEPW      LELPPMVVDNNSQYGTAFTVSIEAKEGVTTGVSAADRVTTVKAAIADGAKPGDLARPGHVYPLRARPGGV
RIBB_SHEPA      LQLPPMVSDNNSQYGTAFTVSIEAKQGVTTGVSAADRVTTXXXXXXXXXXXXXLARPGHVYPLRARPGGV
RIBB_SHESA      LELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKTAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_SHEON      LALPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKTAIADHAKPSDLARPGHVYPLRAQPGGV
RIBB_METLZ      LCLPPMVLKNTDNHETAFTVSID-HVDTTTGISAVERGITARKCIDPNARPEDFRRPGHMFPLQAKDNGV
RIBB_DESAH      LGLPQMVTCNTSAYQTAFTISIEAAEGVTTGVSAADRATTIRCAAALDARPEDIHSPGHVFPLRAVEQGV
RIBB_YERPY      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPS      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPP      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPN      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPG      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPE      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPB      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERPA      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_YERP3      LDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGV
RIBB_SHESR      LELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_SHESM      LELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_SHEHH      LQLPPMVSDNNSQYGTAFTVSIEAKQGVTTGVSAADRVTTIKTAIADNAKPDDLARPGHVYPLRARPGGV
RIBB_ERWT9      LDLPMMVQNNTSAYGTGFTVTIEAAEGVTTGVSATDRLTTIRAAIADDARPSDLNRPGHVFPLRARSGGV
RIBB_SHEB9      LELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_SHEB2      LELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_SHEB8      LELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_SHEB5      LELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQPGGV
RIBB_RHORT      LALPPMVAHNTSRNGTGFTVSIEAREGVTTGVSAADRVTTIRAAIDPASTADDLARPGHVFPLRAHADGL
RIBB_PHOPR      LELPMMVENNTSANETGFTVTIEAAKGVTTGVSAADRVTTIKTAIADGAVPADLNHPGHVFPLKANADGV
RIBB_BUCAP      LNLPMMVKHNTSTYRTGFTVTIEASKGVSTGVSAKDRLTTIKTATADDAQPSDLNRPGHVFPLRANGGGI
RIBB_BORPE      LELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPGGV
RIBB_BORPA      LELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPGGV
RIBB_BORBR      LELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPGGV
RIBB_DESVV      LGLPMMVAHNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVQAAIDDAACPGCLRSPGHVFPLRASPGGV
RIBB_DESVH      LGLPMMVAHNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVKAAIDDAACPGCLRSPGHVFPLRASPGGV
RIBB_RALSO      LGLRPMVEHNRSQYGTAFTVSIEARVGVSTGVSAADRITTIRAAVAPDADAQSVVSPGHVFPLVAQAGGV
RIBB_VIBC3      LALPLMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXXXXXX
RIBB_VIBCM      LALPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXXXXXX
RIBB_VIBCH      LALPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXXXXXX
RIBB_OCEIH      LDLHAMATNNTDTYGTQFTVSVDYYTN-STGISTADRADTIRALAEPLSKAADFKRPGHMFPLIAKNAGV
RIBBA_CORGL     LDLPPMTAHNQDARGTAYTVTVDANTG-TTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGV
RIBBA_CORGB     LDLPPMTAHNQDARGTAYTVTVDANTG-TTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGV
RIBB_AERHH      LELPMMVEANSSHYQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXXXXPSDLHRPGHVFPLRARTGGV
RIBB_CHLT3      LALPMMVSENTSGFQTAFTVSIEAKTGVKTGVSAADRVRTVKTAIAADAKPEELARPGHVFPLRARTGGV
RIBB_BUCBP      LKLPMMVQNNTSKFGTNFTVTIEAAEGISTGVSAKDRLTTIRAAINDNAKPSDLNRPGHIFPLQAHKNGI
RIBB_AERS4      LALPMMVEANSSHYQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXGAKPSDLHRPGHVFPLRARTGGV
RIBB_CHLL2      LELPMMVENNTSGFQTAFTVSIEAAEGVTTGVSAADRVKTVRTAVSENARPSDLRHPGHIFPLRARPGGV
RIBB_PSEPK      LQLAPMVQNNQARHGTGFTVTIEAAEGITTGVSAQDRITTIDAALRSSAEQRHIVSPGHVFPLRARNGGV
RIB3_SCHPO      LEIPMMVDNNEDRMRTAYAVTLDYANGTTTGISAHDRLTTRQLANPEVTSPREFNRPGHIVPLRARDGGV
RIBB_CHRVO      LQLPPMAAENGSRYGTAFTVAIEAAQGVTTGVSXXXXXXXXXXXXHPDAKPGDLVRPGHVYPIXXXXXXX
RIBB_DESDA      LDLPMMTERNTNTQQTAFTISIEXXXXXXXXXXXXDRVATIQAAVAENASPENLRRPGHVFPLRAKPGGV
RIB3_YEAST      LDLPLLESNDDDRHGTAYTITVDVAQGTTTGISAHDRSMTCRALADSSSTPKSFLKPGHICPLRAADGGV
RIB3_CANAL      LELPPMLANRSDRHGTAYTITCDFAEGTTTGISAHDRALTTRSLANPNSKPQDFIKPGHILPLRAVPGLL
RIB3_MAGGR      LDLPQMVTHNADPRGTAYTVSVDAEPSTTTGISAHDRALACRMLAAPDAQPSHFRRPGHVFPLXXXXXXX
RIBBA_THEMA     RGFVKLSS-NYGAN-----YFVPVDWGTGTGISALERAETCRKLAEGRYFH-EFRYPGHVTVI----GGI
RIBB_METJA      LGIPFMVDILEFASKSSFSITINHRKTFT-GITDNDRAFTIKKLAELVKEGREFRSPGHVTLLRAAEGLV
RIBA_ARCFU      LNLGL----NRFRFQNGNLIPIDPN---LEKISAEERAKFIRELVSGNAG--DIKYPGRIFVEETKEMGV
RIBB_METTH      LGIPYMTDIMEEASKSAFSITVNHRKTFT-GITDNDRALTIGELAGICRDDRHFRSPGHVTLLRAADGHV
RIBB_METAC      LKLPFMADLVREASRTSESLGEVVEKDTRTGIPDLERITEKSLSGNGIRFGNEFRTPGHVALLRAAEGLL
RIBB_METMA      LKLPFMADLVREASKTSDSLGEVVEKDTRTGIPDIERITEESLSGNGVRFGNEFRTPGHVALLRAAEGLL
RIBB_ARCFU      LGLPFMHDVLRIASEDADDIKYDSRSSFSTGITDVDRVVDEVMMGKKVDFGREFRSPGHVALLRAADKLT
RSE1_CANAL      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
ISPH_CLOPE      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXX
RIBBA_AQUAE     LERAGHTEASVDLARLAGLYPAGVICEIMKDDGTMARVPDLMEFAKKHNLKIITIADLIKYRLRRETLVE
RIBB_PHOLE      LIRAGHTEAGCDVARLAGLEPSSVIVEILNEDGSMARRPQLEIFAEKHGLKLGTIADLIEYRTQQESHIE
RIBBA_BACSK     LRRAGHTEAAVDFAKLCGAKPAGVICEVMNEDGSMARVPELRIIADQHNLPLVTIKDLIAYRRKTEKVVT
RIBBA_BACSU     LKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGTMARVPELIEIAKKHQLKMITIKDLIQYRYNLTTLVE
RIBBA_SYNWW     LRRAGHTEGSIDLTRLAGLYPAAVICEVMNEDGTMARLPQLLEFARQHNLKLASIADLIEYRRRKEKLVV
RIBBA_UNCTG     LARTGHTEAAVDLVRLAGFYPAGIICEIMNNDGTMARMSDLIKFAKKHDLHIITIGELVNYRRRTEKFIS
RIBB_PHOPO      LARAGHTEAGCDVARLAGLEPSSVIVEILNDDGTMARRPQLEVFAKKHGLKLGTVADLIEYRNKYETMIE
RIBBA_BACCR     LRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMITIEDLIAYRRHHETLVT
RIBB_PSESM      LTRAGHTEAGCDLARMAGFTPASVIVEVMNDDGTMARRPDLELFAEKHGIRIGTIADLIHYRLSTEHTIV
RIBBA_BACC4     LRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACWK     LRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLLECAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACC2     LRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_THEPX     LVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEILVR
RIBBA_BACA2     LKRAGHTEAAVDLAKACGSQGAGVICEIMNEDGTMARVPELAEIAERHQLKMITIKDLIEYRYNITTLVN
RIBBA_BACHK     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACC3     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACAN     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACAH     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACAC     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACAA     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_THEP3     LVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEILVR
RIBBA_BACC0     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACAM     LKRAGHTEAAVDLAKACGSQGADVICEIMNEDGTMARVPEISEIAKSHQLKMITIKDLIEYRYNITTLVN
RIBBA_BACCQ     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACC7     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBB_NEIMB      LVRAGHTEAGVDLAQMNGLIPASVICEIINDDGTMARMPELMKFAEEHKLKIGTIADLIEYRSRTESLLE
RIBBA_PROVI     LRRVGHTEAAVDLARLAGCSPVGLLCEILHEDGSMARLADLMTIKEKFGLKLITIKDLVAFQMRRSKLVQ
RIBBA_BACCZ     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGAMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBBA_BACC1     LRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQFDIKMITIEDLIAYRRHHETLVT
RIBB_NEIMA      LVRAGHTEAGVDLAQMNGLIPAAVICEIINDDGTMARMPELMKFAEEHKLKIGTITDLIEYRSRTESLLE
RIBBA_BREBN     LRRAGHTEAAVDLARLAGGIPAGVICEIMNEDGSMARLPQLVEIARRFDLKLITIADLIAYRMRTESMVK
RIBBA_GEOSW     LRRAGHTEAAVDLARLCGAKPAGVICEIIKEDGTMARVSDLRKIADEFDLKMITIKDLIEYXXXXXXXXX
RIBBA_SYNY3     LKRAGHTEAAVDLSRLAGLYPAGVICEIQNADGSMARLPELVEYARKYDLKLISIADLISYRLQHDRFVQ
RIBB_DEHMU      LVRIGHTEGSVDLCRLAGQGDSAVICEIMKEDGTMARRPDLDIFCAKHELNIVYISDIVEYRMMNESLIR
RIBBA_CHLPN     LKRAGHTESTVDLMELAGLQPCGVLAELVNEDYSMMRLPQILEFARKHNIAVIPVTSIIAHRMLSDRLVS
RIBBA_PELLD     LRRVGHTEAAVDLARLAGCSPVGLLCEILHDDGSMARLPXXXXXXXXXXXXXITIKDLVAYRMQRNKLVE
RIBBA_CHLMU     VKRPGHTEASMDLMRLAGMYPCGIFAELVNADHSMMRQQQILDFAEQHGFTVITVDDLITYRWTFDSLVE
RIBBA_CLONN     LKRAGHTEAAVDLATLAGLTPAGTICEIMNEDGTMARVPDLMKYVKVHNLKIVTIADLIEYRRKTESFIE
RIBB_WOLSU      LVRTGHTEGSVDICKLAGVAPVAVICEIIKKDGHMARRDDLMEFAKEHHLKIVYISDLIEYRMQNEMLIL
RIBBA_CYTH3     LRRVGHTEAAVDLARLAGFKPAGVLIEIMSEDGSMARLPELKQIATKFNLKLISIKDLIEYRLTHESLVK
RIBBA_CHLTR     VQRPGHTEAAMDLMRLAGMQPCGIFAELVNPDHSMMRQQQVLAFAEQHDLTVITVDDLITYRYTYDSLVT
RIBBA_BACCN     LRRAGHTEAAVDLAKLCGTEPVGVICEIIKEDGTMARVPDLIQVAKQFDIKMITIEDLIAYRRHHETFVT
RIBB_HELPY      LARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFDFALKHNLKTLYVSDLISYRLENESLLK
RIBBA_SALTO     LRRTGHTEAATDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFCAEHSLVLVTIADLVMYRRRTEKQVE
RIBB_HELPJ      LARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFDFAIKHNLKTLYVSDLISYRLENESLLK
RIBBA_STAES     LTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFKERHHLKMITIKSLVAFRKAVELNVN
RIBBA_STAEQ     LTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFKERHHLKMITIKSLVAFRKAVELNVN
RIBBA_BACFR     LRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARRFGLKIISIKDLIAYRLQMESIVD
RIBBA_BACFN     LRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARRFGLKIISIKDLIAYRLQMESIVD
RIBBA_ACTPJ     LVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSLVK
RIBBA_ACTP7     LVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSLVK
RIBB_CAMJE      LERTGHTEGTVDLCKLAGLKGACVICEIVKDNGDMARREDLEIFCQKHDLNMIAVSDLIEYRLKHESLIK
RIBB_PSEAE      LARAGHTEAACDLARMAGFEPSGVICEVMNDDGSMARRPELEAFAAEHGIKIGTIADLIHYRLIHERTVE
RIBB_HELHP      LVRTGHTEASVDICRLAGVAPISVICEIMKKDGTMAGRGDLLDFASQHHLKILYVSDIIQYRNFENLLRE
RIBBA_ACTPL     LVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSLVK
RIBBA_ACTP2     LVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSLVK
RIBBA_SALAI     LRRPGHTEAAIDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFCAEHSLVLITIADLVAYRRRTEKQVE
RIBBA_PELPB     LRRVGHTEAAVDLARLAGCSPTGLLCEILNDDGSMARLPQLIKLKAKFGLKLITIKELVAYQMQRNKLVQ
RIBBA_MYCUA     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_PROA2     LRRVGHTEAAVDLAELAGSTPVGLLCEILHDDGSMARLPELLKIKEKFDLKLITIKDLVAYQMKRKKLVA
RIBBA_STAHJ     LERTGHTEAAVDLAKLTKAAPAGVICEIMNEDGTMAKGEQLEAFKHQHGLKMITIESLVNYQKDKDTSVE
RIBBA_MYCMM     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_BACV8     LRRAGHTEACIDMARLAGLYPAAALMEIMSEDGTMARLPELRKMADEWGLKLISIRDLIAYRLKQESLVE
RIBBA_MYCTU     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_MYCTA     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_MYCBT     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_MYCBP     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_MYCBO     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAHTDELRVFADEHGLALITIADLIEWRRKHEKHIE
RIBBA_MYCVP     LRRPGHTEAAVDLARLAGLQPAGAICEIVSDEGAMAQTDELRIFADEHDLALISIADLIEWRRKHEKHIA
RIBBA_MYCPA     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHDLAMITIADLIEWRRKHEKHIE
RIBBA_MYCA1     LRRPGHTEAAVDLARMAGLQPAGAICEIVSDEGSMAQTDELRVFADEHDLAMITIADLIEWRRKHEKHIE
RIBBA_MYCGI     LRRPGHTEAAVDLARLAGLQAAGTICEIVSDEGAMAQTDELRIFADEHDLALISIADLIEWRRKHEKHIA
RIBBA_STAAN     LARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFKEKHQLKMITIDDLIEYRKKLEPEIE
RIBBA_STAAM     LARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFKEKHQLKMITIDDLIEYRKKLEPEIE
RIBBA_PORGI     LRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLPQLWEVSKRFGLKIIAIKDLIAYRLKQESIVE
RIBBA_PORG3     LRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLPQLWEVSKRFGLKIIAIKDLIAYRLKQESIVE
RIBBA_BACTN     LRRAGHTEATIDMARLAGLYPAGALMEIMSDDGTMARLPELRAMADEHGLKLISIHDLIAYRLKQESIVE
RIBBA_STAS1     LSRRGHTEASVDLAKLTGAKPAALICEIMDEDGTMAKGASLEAFKETHGLVMISIEDLEKYR--KSSISK
RIBBA_STAAW     LARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMITIDDLIEYRKKLEPEIE
RIBBA_STAAS     LARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMITIDDLIEYRKKLEPEIE
RIBBA_STAAR     LARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHKLKMITIDDLIEYRKKLEPEIE
RIBBA_STAAC     LARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFKEKHQLKMITIDDLIEYRKKLEPEIE
RIBBA_ARATH     LKRAGHTEASVDLTVLAGLDPVGVLCEIVDDDGSMARLPKLREFAAENNLKVVSIADLIRYRRKRDKLVE
RIBB_TOLAT      LTRRGHTEATIDLMKLAGLKPYGVLCEVQNEDGSMARLPGIVEFANKHNMPVLCIEDLVAY---------
RIBB_VIBFI      LTRRGHTEGTVDLMRLAELTPAGVLCEVTNSDGSMAKTPEIIIFAEQHHLPVLTVNDIALYR--------
RIBB_HAEIE      LTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYR--------
RIBB_VIBHA      LARRGHTEGTIDLMYLANLVPSGILCELTNPDGTMAKLPETIEFARRHGMPVLTIEDIVDYR--------
RIBBA_MYCA9     LRRPGHTEASVDLAKLAGLRPAAVICEIVSDEGAMAQTEELRVFADEHNLALVSIADLIEWRRKHEKHVQ
RIBB_HAEIG      LTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYR--------
RIBB_PASMU      LKRRGHTEASVDLARLAGYKAAGVICEITNDDGSMARAPEIVTFAQKFGFPVVTIEDLVAYR--------
RIBB_HAEIN      LTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARAPEIVEFAKKFGYSVLTIEDLVEYR--------
RIBB_HAEI8      LTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPEIVEFAKKFGYSVLTIEDLVEYR--------
RIBB_WIGBR      LSRAGHTEAAVDLTKLAGLKPAGVICEVMNDDGSMARMPEIINFSKKYNMPVLIIKDIIEY---------
RIBB_CLOBL      LTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIINFAKKHNLTILSIEDIIKYK--------
RIBBA_RHOE4     LRRPGHTEAAVDLARMADLRPAGVICEIVSDEGAMAQTDELRVFADEHNLALISIADLIAWRRKHEKHVL
RIBBA_NOCFA     LRRPGHTEAAVDLARMAGLRPAGVICEIVSDEGHMARTEELRVFADDHDLALISIADMIAWRRKHEKQVV
RIBB_VIBPA      MTRRGHTEGTIDLMQMAGLQPAGVLCEVTNPDGTMAKAPEIVAFGHLHNMPVLTIEDMVAYR--------
RIBB_PSEHT      LVRRGHTEASVDLMQLAGLKPFGVICELTNPDGSMARLPEVSGYANKHNMPVVSIEDLVQY---------
RIBB_CLOBH      LTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIINFAKKHNLAVLSIEDIIKYK--------
RIBB_CLOB1      LTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIINFAKKHNLAVLSIEDIIKYK--------
RIBB_BLOFL      LSRSGHTEAAVDLTTLAGLKPFGVICEVTNEDGSMARTTEIIKFSKQYDMPVLTISDVIAYR--------
RIBB_SODGM      LVRGGHTEAAVDLTTLAGLKPAGVLCEVTNDDGSMAHAPEIIAFGRRHNMPVLTIEDLVAYR--------
RIBB_SHISS      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_SHIFL      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_SHIF8      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_SHIDS      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_SHIBS      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_SHIB3      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOUT      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOSM      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOSE      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOLU      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOLI      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOLC      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOL6      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOL5      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOK1      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOHS      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECODH      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECOBW      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO8A      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO81      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO7I      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO5E      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO57      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO55      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO45      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO27      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ECO24      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_ESCF3      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFANKHNMALVTIEDLVAYR--------
RIBB_VIBVY      LARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQHNMPVLTIEDMVMYR--------
RIBB_VIBVU      LARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQHNMPVLTIEDMVMYR--------
RIBB_VIBSL      LARRGHTEGTVDLMQMAGLQSAGVLCEVTNPDGTMAKAPEIVAFGKMHNMPVLTIEDMVMYR--------
RIBB_DESPS      LDRRGHTEGTVDLMKLSGLAPAGLLCELTNVDGTMARLPEIVDFARKRDMQVLSIEDIAQYR--------
RIBB_CITK8      LTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIAFAGKHNMAVVTIEDLVAYR--------
RIBB_BAUCH      LNRGGHTEAAIDLTLLAGLKPAGVLCEVTNEDGSMARALEIIAFSNQHNMPVLTINDLVAYR--------
RIBB_PECCP      LTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQHDMPVLTIEDLVAYR--------
RIBB_KLEP7      LTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFAQQHNMAVVTIEDLVAYR--------
RIBB_KLEP3      LTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFAQQHNMAIVTIEDLVAYR--------
RIBBA_PARD8     LRRAGHTEAAVDLARLAGLYPAGALIEIINEDGTMARLPQLIEVAXXXXXXXXXXXXXXAYRLRTESIVE
RIBB_ERWCT      LTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQHDMLVLTIEDLVAYR--------
RIBB_SHEFN      MSRRGHTEGTVDLMQMAGLMPAGVLCELANEDGSMAKTPEIIAFGLKHNMPVLTIEDMVMYR--------
RIBB_RALEJ      LVRRGHTEGSVELARMAGLSPAAVLCELMNPDGTMARRPEALSFAEMYRLPILTIADLVAWR--------
RIBB_HAES1      LARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTPEIVEFGKKFNYPVVTIEDLVRY---------
RIBB_MANSM      LARPGHTEAAVDLARLCGYKPAGVICEITNDDGTMARTPELVAFAQKFGYAVVTIEDLIAYR--------
RIBB_EDWI9      LARRGHTEATIDLVSLAGFRPAGVLCELTNDDGTMARAPQVMAFARQHEMPVVTIEDLVAYR--------
RIBB_DESAA      LERRGHTEATVDMMRLALKNPCGVLCELTNPDGTMARLPQLADFAKKHGMVLLTVEDLAAYR--------
RIBB_AGRT5      LGRTGHTEAAVDLCRLAGKFPSGTICEVANDDGTMARLPQLEIFAERHGLLVVTIKDLVSY---------
RIBB_SALTY      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALTI      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALSV      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALPC      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALPB      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALNS      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALHS      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALG2      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALEP      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALDC      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALCH      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALA4      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_HAES2      LARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTLEIVEFGKKFNYPVVTIEDLVRY---------
RIBBA_RHOSR     LRRPGHTEAAVDLARMADLRPAGVICEIVSDEGHMAQTDELRVFADDHNLALISIADLIAWRRKHEKHVE
RIBB_SALPK      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_SALPA      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_PROMH      LTRGGHTEASIDLATLAGFKPVAVLCELTNDDGTMARAPEVVTFAKQHDMPVLTIEDLVAYR--------
RIBB_BUCAT      LSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFY---------
RIBB_BUCAI      LSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFY---------
RIBB_BUCA5      LSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFY---------
RIBB_SHESH      MTRRGHTEGTIDLMILAGLKPAGVLCEITNPDGTMARLAEIISFGAKHDLPVLTIEDIVEYR--------
RIBB_HAMD5      LGRSGHTEAAIDLARLAGLKPAGVLCELTNDNGTMARAPEVIAFAKKHKMTVLSIEDLIEYR--------
RIBB_SALAR      LTRGGHTEATIDLMTLAGFKPAGVLCELTNDNGTMARAPECIAFAGQHNMAVVTIEDLVAYR--------
RIBB_PELCD      LTRRGHTEGTVDLMRMAGYKPAGVLCELTNEDGTMARLPEIITFAERHYLSVVSIEDL------------
RIBB_ENT38      LTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGTMARAPECVTFARLHNMPVVTIEDLVEYR--------
RIBB_DESAD      LEREGHTEATVDMMTLAGLNPCGVLCELTNPDGTMARLPEIVEFGQKHDMPVLTVDDIINYR--------
RIBB_SERP5      LSRRGHTEATIDLVSMAGFKPAGVLCELTNDDGSMAHAPEVILFAKQHDMTVLTIEDLVAYR--------
RIBB_YERE8      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIEFAKLHDMPVVTIDDLAEYR--------
RIBB_SHEWM      FSRRGHTEGTIDLMLLAGLKPAGVLCEITNPDGTMARLPEIIQFGQQHNLPVLTIEDIVEYR--------
RIBB_DESDG      LERRGHTEATVDLMRLAGLKPCGVLCEVTNPDGTMARLPQIVDFGRKHDMVVLTVDDLVRYR--------
RIBB_DESRM      LERQGHTEATVDLMKLAGLQPYGVLCELTNIDGTMARLPEVVTFANKNNIPVVTIDDLIMYR--------
RIBB_SHESW      LTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDIVLYR--------
RIBB_SHEPC      LTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDIVLYR--------
RIBBA_CORAM     LERDGHTEAAIDLARLAGLRPAGVLCEIVSEEDTMARSEELRRFSDEHDLKMISIEQLIEWRRHNETQVR
RIBB_PELPD      LERRGHTEATVDLMRLAGLKPCGVLCELTNPDGSMARMPEIVAFSRKHGFPLITVEELVQYR--------
RIBB_SHELP      LTRRGHTEGTIDLMKLAGLKPAGVLCEVTNVNGTMARLPEIIAFGEQHKMPVLTIEDIVCYR--------
RIBB_PHOLL      LVRQGHTEAAIDLVSLAGFKPAGVLCELTNDDGSMARTLEVVQFAKLHNMPVVTIEDLVIYR--------
RIBB_ENTS8      LTRGGHTEATIDLVSLAGFKPAGVLCELTNDDGTMARAPECIAFAREHNMPVVTIEDLVSYR--------
RIBB_SHEPW      LERRGHTEGTVDLMKLAGLKPFGVLCEVTLPDGTMARLPEIVEFGQQHNMPVLTIEDIVAYR--------
RIBB_SHEPA      LERRGHTEGTVDLMKLAGLQPFGVLCEVTLPDGTMARLPEIVEFAQQHDMPVLTIEDIVAYR--------
RIBB_SHESA      LTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAEHNMPVLTIEDIVIYR--------
RIBB_SHEON      LTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR--------
RIBB_METLZ      FEREGHTEATVDLMKLAGLREAGLCCEIMADNGEMMRTPELISMAKQYNLTFVTIKDLQAYR--------
RIBB_DESAH      LGRRGHTEGTVDLMRLAGLAPAGVLCELTNVDGTMARLPQIITFADEHGFPVLSIEDIAAYR--------
RIBB_YERPY      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPS      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPP      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPN      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPG      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPE      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPB      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERPA      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_YERP3      LSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAY---------
RIBB_SHESR      LTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDIVVYR--------
RIBB_SHESM      LTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAHNMPVLTIEDIVVYR--------
RIBB_SHEHH      LERRGHTEGTVDLMKLAGLKPYGVLCEVTLVDGTMARLPEIIEFGQQHDMPVLTIEDIVAYR--------
RIBB_ERWT9      LTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGSMAHAPEVIVFARQHDMPVVTIEDLVSYR--------
RIBB_SHEB9      LTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR--------
RIBB_SHEB2      LTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR--------
RIBB_SHEB8      LTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR--------
RIBB_SHEB5      LTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALHNMPVLTIEDIVVYR--------
RIBB_RHORT      SARRGHTEATIALMRLAGLRPAGVLCEVMNPDGTMARLPTLIGYGQAHGLPIVSIEDLVA----------
RIBB_PHOPR      LGRRGHTEATIDLMRLSGLKPYGVLCELTNIDGTMARLPEVIVFGKKFNMPVLTIEDLAAYR--------
RIBB_BUCAP      LARAGHTEAAIEIVSLAGFKPYGVICELTNKDGSMSRTPEXXXXXXXXXXXXLTIKDLILY---------
RIBB_BORPE      LTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDELAAH---------
RIBB_BORPA      LTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDELAAH---------
RIBB_BORBR      LTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDELAAH---------
RIBB_DESVV      LERRGHTEATVDLMRLAGLKPYGVLCELTNPDGTMARLPQLVDFAQRNRMTVLTVEDLVAYR--------
RIBB_DESVH      LERRGHTEATVDLMRLAGLKPYGVLCELTNPDGTMARLPQLVDFAQRNRMTVLTVEDLVAYR--------
RIBB_RALSO      LARRGHTEGSVDLARLAGLSPAGVLCELMLPDGTMARRDDAVRFADQHGLPVLTIEDIARYR--------
RIBB_VIBC3      XXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIAFGKLHNMPVLTIEDMVQYR--------
RIBB_VIBCM      XXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYR--------
RIBB_VIBCH      XXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYR--------
RIBB_OCEIH      LERRGHTEAAVDLARLSNSIPSAYICEILNDDGTMARYPALETLAKDWDLTLITVEDLVQYR--------
RIBBA_CORGL     LVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPMARVPELRRFCDEHDLKLISIEQLIEWRRKNEILVE
RIBBA_CORGB     LVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPMARVPELRRFCDEHDLKLISIEQLIEWRRKNEILVE
RIBB_AERHH      LTRRGHTEATVDLMQLAGLKPFGVLCELTKEDGSMARLPDLVAFGRQHQMPVLTIEDLVQYR--------
RIBB_CHLT3      LERPGHTEATVDLMRLAGLSPYGVLCELTNPDGTMANLDEAIAFAEKHDFPVLTVEDVINYR--------
RIBB_BUCBP      LGRIGHTEAAIEFVTLAGFKPAGIICELTNRNGTMSKVPDIIKFSKLKKMTIVTIRDLIQY---------
RIBB_AERS4      LTRRGHTEATVDLMQLAGLKPFGVLCELTKEDGSMARLPDLVAFGRLHQMPVLTIEDLVQYR--------
RIBB_CHLL2      LERPGHTEATVDLMRLAGLSPAGVLCELTNPDGSMAGIEETFAFSVQHGFPVLSIGDIVAYR--------
RIBB_PSEPK      LTRRGHTEGSVDLARLAGLRPAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEELARYR--------
RIB3_SCHPO      LERDGHTEAAVDLCKLAGLPPVGAICELVEEDGLMSRFDDCISFGKKWGIKVITIESLKSY---------
RIBB_CHRVO      XXXXXHTEASVELARLAGFSPAGVLCELMNPDGTMMRGQQVQDYAERHDL--------------------
RIBB_DESDA      LERRGHTEATVDLMRLAGHAPCGVLCELTLDDGSMARLPQVAAFAVAHAIPLCSVEDLVAWR--------
RIB3_YEAST      LQRRGHTEAGVDLCKLSGLSPVAVIGELVNDDGTMMRLNDCQAFGKKHGIPLISIEELAQY---------
RIB3_CANAL      KKRRGHTEAAVQLSTLAGLQPAGVICELVDEDGLMMRLDDCIQFXXXXXXXXXXXXQLVEY---------
RIB3_MAGGR      XXXXXHTEAGVELCRLAGKRPVAVISEIV-DDGQMLRGDECVAFARRWGLKVCTIEDMIAH---------
RIBBA_THEMA     GFRKGHTEASLEISELAGFSRHAVIVEILDEKGNSHNLDYVLKLSEKFSLPVLEMDDVWREFVKRKLLMK
RIBB_METJA      KNRQGHTEMTVALAELANLVPITTICEMMGDDGNAMSKNETKRYAEKHNLIYLSGEEIINY---------
RIBA_ARCFU      LERPGIAEACVDLARMAGFAPSAVYAPLMTAEGGVAGEDYALKFAKEHSMPVFRIKDMIEFRIKSEKIVE
RIBB_METTH      LRRGGHTEMSIALMEMAGLTGVAVCCEMMDDTGNSLSTEDAMKYAREHDL--------------------
RIBB_METAC      DERMGQTELSVALARMAGITPAMVVCEMLDESGRALSKENSKDYGKDHGL--------------------
RIBB_METMA      DERMGQTELSVALARMAGITPAMVVCEMLDDDSGKALSKEKSEYGKEHGL--------------------
RIBB_ARCFU      YERVGQTELSVALAEMAGIAPAVAICEMLDETGKALTKEKAMEYAEEKGI--------------------
RSE1_CANAL      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
ISPH_CLOPE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLN
RIBBA_AQUAE     KVASAHLPTPWGVFKIHAYRHKLTGEEQVALTMGEWKEDEPVLVRVLTGDVFRSFRCDCR--PQLEKALE
RIBB_PHOLE      RISEYELNTEYGIFTLVTYRDTIDNQAHFALCKGEIQAKAATLVRVHVKDTLKDILQVGLSQWSLEAAMQ
RIBBA_BACSK     REVAISLPTEYGDFKAVGYTNTIDGKESVALVKGDVGNGEPVLVRVHSECLTGDVFGSKRCDPQLHAALK
RIBBA_BACSU     REVDITLPTDFGTFKVYGYTNEVDGKEHVAFVMGDVPFGEEPLVRVHSECLTGDVFGSHRCDPQLHAALN
RIBBA_SYNWW     RVTDAQLPTMYGDFVAVAYESLLDNKGHIALVKGEWEEDEPILVRVHSECLTGDVFGSRRCDEQLETAMS
RIBBA_UNCTG     EIVNVDLPTRYGDFKLVLFEDLITKDSHIAVVKGVVKNRQNVLVRVHSSCETGDHSLRCDCGDQLETALK
RIBB_PHOPO      RISECKLNTEFGEFDMITYRDKINHQIHYALQKGNIEPNSQTLVRVHLQDTFKDILQTGSTRWTLPAAME
RIBBA_BACCR     REAEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFGSHRCDPQLHAALA
RIBB_PSESM      RIGERELPTVHGTFRLFSYEDRIEGGVHMAMVMGDIRREDPTLVRVHVVDPLRD-LVGAEYTGPANWTLR
RIBBA_BACC4     REVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFGSHRCDPQLHAALA
RIBBA_BACWK     REVEITLPTDFGTFHAIGYSNSLDMKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACC2     REVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDISIGEPVLVRVHSECLTGDVFGSHRCDPQLHAALA
RIBBA_THEPX     RVAQAKLPTKYGNFEIVGYEEILTGKQHVALIKGDVNKEPV-LVRIHSECLTGDILCGDQLHAAMERILV
RIBBA_BACA2     REVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGDVPFNSEPLVRVHSECLTGDVFASHRCDPQLHAALA
RIBBA_BACHK     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACC3     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACAN     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACAH     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACAC     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACAA     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_THEP3     RVAQAKLPTKYGNFEIVGYEEILTRKQHVALIKGDINKEPV-LVRIHSECLTGDILCGDQLHAAMERVLV
RIBBA_BACC0     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACAM     REVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGDVPFNSGPLVRVHSECLTGDVFASHRCDPQLHAALR
RIBBA_BACCQ     REVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGDISTGDPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACC7     REVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGDISTGDPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBB_NEIMB      DMGNAPVQTPWGEFQQHVYVDKLSGETHLALVKGTPAADTETLVRVHEPFSVMDFIANPRHSWSLPKALE
RIBBA_PROVI     RAVESNIPTAYGEFRLMAYESFTDQQNHMAFVKGDVSTDEPVLVRVHSQCATGDTFASLRCDNQLASALR
RIBBA_BACCZ     REVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBBA_BACC1     REVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDISTGEPVLVRVHSECLTGDVFCRCDCGPQLHAALA
RIBB_NEIMA      DMGNAPVQTPWGEFQQHVYVDKLSGETHLALVKGTPSADTETLVRVHEPFSVMDFIANPRHSWSLPKALE
RIBBA_BREBN     KEIEVQLPTAYGDFRIAAYTNELDGKEHVALIKGEIDEPILVRVECLTGDIFGSYRCD--CGPQLHAALE
RIBBA_GEOSW     XXXXXMLPTEFGKFKAIGYTNIVDGKEHVALVKGEIIPDEPTLVRVHSECLTGDVFCRCDCGPQLHAALR
RIBBA_SYNY3     RETICEFPSQFGEFKLYAYRNLLDQTEHIAIVKGDPSEGQQPMVRMHSECLTGDALLRCDCRMQLQAALK
RIBB_DEHMU      VIAESTTQFLGKDARRYDFVDHND-NHHIAYAFGNIKNRSAVKFHSIMPD--NELLADTKKYNSLIQAIH
RIBBA_CHLPN     KISSARLPTIYGDFTIHVYESLLEGMQHLALVKGNVAGKSNVLVRVHSECVTGDILGSKRCDEQLSSAMS
RIBBA_PELLD     RAVESKLPTAYGEFGLIAYESFIDHHNHMAFVKGDVSSGEPVLVRVHSQCATGDTFASLRCDNQLASALR
RIBBA_CHLMU     HVSSARIPTKYGEFFIHVYKSIIDGTEHFALVKGDIREQESVPVRVHSECLTGDVLCRCDCGAQLDMAMR
RIBBA_CLONN     RQGSASLPTKYGEFEIIGYEDKLTGKEHVALVKGDIKNGEPVLIRVHSECLTGDVLLRCDCGDQLAQALR
RIBB_WOLSU      IKERSEVEFLGKRAERYVFQD-HHRREHTLYAFGKIIDNSLVKYHTVGKDL--SLLESEKKYSTLMQAIK
RIBBA_CYTH3     REIGVDMPTNLGDFDLIAFRQISTGEVHLALIKGTWEKDEPVMVRVHSSCVTGDIFCRCDCGPQLHKAME
RIBBA_CHLTR     KISSARLPTKYGDFSIHVYESIIDGTQHFALVKGDIHEQEAVPVRVHSECLTGDILCRCDCGAQLDMAMR
RIBBA_BACCN     KEVEITLPTEFGTFHAIGYTNSLDQKEHIALIKGDVSTDEPVLVRVHSECLTGDVFCRCDCGPQLHAALT
RIBB_HELPY      MFCQEELKHQTQCYTFLDHQQ----KNHYAFFKGAKTHDLAPLVRFHPIKEDFDFLTTDAF-EVFFKALE
RIBBA_SALTO     LVAEARLPTRHGDFRVAGYRGDYDSAEHVALVMGDLGDGRDVLVRAHSECLTGDVFLRCDCGLQLDTAME
RIBB_HELPJ      MFCQEELKHQTQCYTFLDHQQ----KNHYAFFKGAKTHDLAPLVRFHPIKEDFDFLTTGAF-EAFFKALE
RIBBA_STAES     LKAKVKMPTDFGHFDMYGFTTDYSDEEIVAIVKGDLKSN--PNVRMHSACLTGDIFHSQRCDAQLEASMK
RIBBA_STAEQ     LKAKVKMPTDFGHFDMYGFTTNYSDEEIVAIVKGDLKSN--PNVRMHSACLTGDIFHSQRCDAQLEASMK
RIBBA_BACFR     RGVEVDMPTQFGHFRLIPFRQKSNGMEHIALIKGTWDTDEPILVRVHSSCMTGDIFCRCECGEQLHKAME
RIBBA_BACFN     RGVEVDMPTQFGHFRLIPFRQKSNGMEHIALIKGTWDTDEPILVRVHSSCMTGDIFCRCECGEQLHKAME
RIBBA_ACTPJ     QISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGDLTDGEQVLARIHSECLTGDAFGSQRCDQQFAAAMT
RIBBA_ACTP7     QISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGDLTDGEQVLARIHSECLTGDAFGSQRCDQQFAAAMT
RIBB_CAMJE      LEEKSQSVLAGFKAEKFIFSD-HNQTQHIAFCFKDIKKCENVKFHISGSD------FELLTSDKFSKLLE
RIBB_PSEAE      RIAEQPLDSELGHFNLITYRDSVEGDVHLALTLGKVCAEEPTLVRVHNMDPLRDLLVNQPGRWSLRAAMT
RIBB_HELHP      ITRESAVFMGVECEKITFIDHL--EREHIVFHKGSSSNEPKPLIRFHNVRSDLELLQNAQEWNALLKSIE
RIBBA_ACTPL     QISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGDLTDGEQVLARIHSECLTGDAFGSQRCDQQFAAAMT
RIBBA_ACTP2     QISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGDLTDGEQVLARIHSECLTGDAFGSQRCDQQFAAAMT
RIBBA_SALAI     LVAEARMPTRHGVFRAFGYRSDYDSAEHVALVMGDLGDGRDVLVRVHSECLTGDVLLRCDCGPQLNAALD
RIBBA_PELPB     RAVESRLPTIYGEFRLIAYESFTDQHNHMAFVKGDVTTDEPVLVRVHSQCATGDTFASLRCDNQLASALT
RIBBA_MYCUA     RVAEARIPTRRGEFRAIGYTSIYENVEHVALVRGEISDGDDVLVRVHSECLTGDVFGSRRCDSQLDAAMA
RIBBA_PROA2     RAVETSLPTRHGDFRLIAYEACCDSQQHLAFVKGDFSTDEPVLVRVHSQCATGDIFASLRCDNQLASAMQ
RIBBA_STAHJ     LKAKVNMPTDHGAFEMYGFESSLTKEEIVVLAKGEPR--VTENVRIHSACLTGDIFHSQRCDAQLESAMK
RIBBA_MYCMM     RVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEISDGDDVLVRVHSECLTGDVFGSRRCDPQLDAAMA
RIBBA_BACV8     KGVEVDMPTEYGHFRLIPFRQKSNGLEHIAIIKGDIKEGEPVLVRVHSSCATGDIFGSMRCDEQLHKALQ
RIBBA_MYCTU     RVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIADGDDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_MYCTA     RVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIADGDDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_MYCBT     RVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIADGDDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_MYCBP     RVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIADGDDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_MYCBO     RVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIADGDDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_MYCVP     RVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGEISDGHDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_MYCPA     RIAEARIPTRHGEFRAIGYTSIYEEVEHVALVRGEISDGDDVLVRVHSECLTGDVFGSRRCDPQLDAAMA
RIBBA_MYCA1     RIAEARIPTRHGEFRAIGYTSIYEEVEHVALVRGEISDGDDVLVRVHSECLTGDVFGSRRCDPQLDAAMA
RIBBA_MYCGI     RVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGDIADGHDVLVRVHSECLTGDVFGSRRCDPQLDAALA
RIBBA_STAAN     FKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGAIRQH--ENVRLHSACLTGDIFHSQRCDAQLESSMK
RIBBA_STAAM     FKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGAIRQH--ENVRLHSACLTGDIFHSQRCDAQLESSMK
RIBBA_PORGI     KGVEVDMPTEYGHFRLIPFRQKSNGLEHIALFKGTWDENEPILVRMHSSCATGDIFCGGQLLQAMEK---
RIBBA_PORG3     KGVEVDMPTEYGHFRLIPFRQKSNGLEHIALFKGTWDENEPILVRMHSSCATGDIFCGGQLLQAMEK---
RIBBA_BACTN     KGVEVNMPTEHGMFRLIPFRQKSNGLEHMAIFKGTWNEDEPILVRVHSSCATGDILGSHRCDEQLHKAME
RIBBA_STAS1     LDAKAKVKMPTEYGNFDMYGFTTDNSEEDIVVIANGDINKTENVRIHSACLTGDIFHSQRCDEQLAASMK
RIBBA_STAAW     FKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGAIRQH--ENVRLHSACLTGDIFHSQRCDAQLESSMK
RIBBA_STAAS     FKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGAIRQH--ENVRLHSACLTGDIFHSQRCDAQLESSMK
RIBBA_STAAR     FKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGAIRQH--ENVRLHSACLTGDIFHSQRCDAQLESSMK
RIBBA_STAAC     FKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGAIRQH--ENVRLHSACLTGDIFHSQRCDAQLESSMK
RIBBA_ARATH     RASAARIPTMWGPFTAYCYRSILDGIEHIAMVKGEIGDGQDILVRVHSECLTGDIFGSARCDNQLALSMQ
RIBB_TOLAT      ----------------------------------------------------------------------
RIBB_VIBFI      ----------------------------------------------------------------------
RIBB_HAEIE      ----------------------------------------------------------------------
RIBB_VIBHA      ----------------------------------------------------------------------
RIBBA_MYCA9     RIAEARIPTQHGEFRAVGYTSIYDDVEHVALVLGDISDGNDVLVRVHSECLTGDVFGSRRCDPQLDAAME
RIBB_HAEIG      ----------------------------------------------------------------------
RIBB_PASMU      ----------------------------------------------------------------------
RIBB_HAEIN      ----------------------------------------------------------------------
RIBB_HAEI8      ----------------------------------------------------------------------
RIBB_WIGBR      ----------------------------------------------------------------------
RIBB_CLOBL      ----------------------------------------------------------------------
RIBBA_RHOE4     RIAEARIPTRHGEFTAVGYTSIYDEVEHVALVRGDIADGSDVLVRVHSECLTGDVFLRCDCGPQLDAALD
RIBBA_NOCFA     RVAEARIPTAHGAFTAVGYQSIYDDVEHVALVRGDIGDGEDVLVRVHSECLTGDVFLRCDCGPQLDAALE
RIBB_VIBPA      ----------------------------------------------------------------------
RIBB_PSEHT      ----------------------------------------------------------------------
RIBB_CLOBH      ----------------------------------------------------------------------
RIBB_CLOB1      ----------------------------------------------------------------------
RIBB_BLOFL      ----------------------------------------------------------------------
RIBB_SODGM      ----------------------------------------------------------------------
RIBB_SHISS      ----------------------------------------------------------------------
RIBB_SHIFL      ----------------------------------------------------------------------
RIBB_SHIF8      ----------------------------------------------------------------------
RIBB_SHIDS      ----------------------------------------------------------------------
RIBB_SHIBS      ----------------------------------------------------------------------
RIBB_SHIB3      ----------------------------------------------------------------------
RIBB_ECOUT      ----------------------------------------------------------------------
RIBB_ECOSM      ----------------------------------------------------------------------
RIBB_ECOSE      ----------------------------------------------------------------------
RIBB_ECOLU      ----------------------------------------------------------------------
RIBB_ECOLI      ----------------------------------------------------------------------
RIBB_ECOLC      ----------------------------------------------------------------------
RIBB_ECOL6      ----------------------------------------------------------------------
RIBB_ECOL5      ----------------------------------------------------------------------
RIBB_ECOK1      ----------------------------------------------------------------------
RIBB_ECOHS      ----------------------------------------------------------------------
RIBB_ECODH      ----------------------------------------------------------------------
RIBB_ECOBW      ----------------------------------------------------------------------
RIBB_ECO8A      ----------------------------------------------------------------------
RIBB_ECO81      ----------------------------------------------------------------------
RIBB_ECO7I      ----------------------------------------------------------------------
RIBB_ECO5E      ----------------------------------------------------------------------
RIBB_ECO57      ----------------------------------------------------------------------
RIBB_ECO55      ----------------------------------------------------------------------
RIBB_ECO45      ----------------------------------------------------------------------
RIBB_ECO27      ----------------------------------------------------------------------
RIBB_ECO24      ----------------------------------------------------------------------
RIBB_ESCF3      ----------------------------------------------------------------------
RIBB_VIBVY      ----------------------------------------------------------------------
RIBB_VIBVU      ----------------------------------------------------------------------
RIBB_VIBSL      ----------------------------------------------------------------------
RIBB_DESPS      ----------------------------------------------------------------------
RIBB_CITK8      ----------------------------------------------------------------------
RIBB_BAUCH      ----------------------------------------------------------------------
RIBB_PECCP      ----------------------------------------------------------------------
RIBB_KLEP7      ----------------------------------------------------------------------
RIBB_KLEP3      ----------------------------------------------------------------------
RIBBA_PARD8     NGVEVDLPTEYGHFRLIPFRQKSNGLEHIALIKGKFEKDEPILVRVHSSCATGDIFMRCECGEQLHEAMR
RIBB_ERWCT      ----------------------------------------------------------------------
RIBB_SHEFN      ----------------------------------------------------------------------
RIBB_RALEJ      ----------------------------------------------------------------------
RIBB_HAES1      ----------------------------------------------------------------------
RIBB_MANSM      ----------------------------------------------------------------------
RIBB_EDWI9      ----------------------------------------------------------------------
RIBB_DESAA      ----------------------------------------------------------------------
RIBB_AGRT5      ----------------------------------------------------------------------
RIBB_SALTY      ----------------------------------------------------------------------
RIBB_SALTI      ----------------------------------------------------------------------
RIBB_SALSV      ----------------------------------------------------------------------
RIBB_SALPC      ----------------------------------------------------------------------
RIBB_SALPB      ----------------------------------------------------------------------
RIBB_SALNS      ----------------------------------------------------------------------
RIBB_SALHS      ----------------------------------------------------------------------
RIBB_SALG2      ----------------------------------------------------------------------
RIBB_SALEP      ----------------------------------------------------------------------
RIBB_SALDC      ----------------------------------------------------------------------
RIBB_SALCH      ----------------------------------------------------------------------
RIBB_SALA4      ----------------------------------------------------------------------
RIBB_HAES2      ----------------------------------------------------------------------
RIBBA_RHOSR     RVASARIPTRHGEFTAVGYRSIYDDVEHVALVRXXXXXXXXXXXRVHSECLTGDVFLRCDCGPQLDAALD
RIBB_SALPK      ----------------------------------------------------------------------
RIBB_SALPA      ----------------------------------------------------------------------
RIBB_PROMH      ----------------------------------------------------------------------
RIBB_BUCAT      ----------------------------------------------------------------------
RIBB_BUCAI      ----------------------------------------------------------------------
RIBB_BUCA5      ----------------------------------------------------------------------
RIBB_SHESH      ----------------------------------------------------------------------
RIBB_HAMD5      ----------------------------------------------------------------------
RIBB_SALAR      ----------------------------------------------------------------------
RIBB_PELCD      ----------------------------------------------------------------------
RIBB_ENT38      ----------------------------------------------------------------------
RIBB_DESAD      ----------------------------------------------------------------------
RIBB_SERP5      ----------------------------------------------------------------------
RIBB_YERE8      ----------------------------------------------------------------------
RIBB_SHEWM      ----------------------------------------------------------------------
RIBB_DESDG      ----------------------------------------------------------------------
RIBB_DESRM      ----------------------------------------------------------------------
RIBB_SHESW      ----------------------------------------------------------------------
RIBB_SHEPC      ----------------------------------------------------------------------
RIBBA_CORAM     RTVETQLPTDFGSFTALGYKHEIDGQEHVALIAGGVEEDVFVRVECLTGDVFHSRRCDQQLHQSMXXXXX
RIBB_PELPD      ----------------------------------------------------------------------
RIBB_SHELP      ----------------------------------------------------------------------
RIBB_PHOLL      ----------------------------------------------------------------------
RIBB_ENTS8      ----------------------------------------------------------------------
RIBB_SHEPW      ----------------------------------------------------------------------
RIBB_SHEPA      ----------------------------------------------------------------------
RIBB_SHESA      ----------------------------------------------------------------------
RIBB_SHEON      ----------------------------------------------------------------------
RIBB_METLZ      ----------------------------------------------------------------------
RIBB_DESAH      ----------------------------------------------------------------------
RIBB_YERPY      ----------------------------------------------------------------------
RIBB_YERPS      ----------------------------------------------------------------------
RIBB_YERPP      ----------------------------------------------------------------------
RIBB_YERPN      ----------------------------------------------------------------------
RIBB_YERPG      ----------------------------------------------------------------------
RIBB_YERPE      ----------------------------------------------------------------------
RIBB_YERPB      ----------------------------------------------------------------------
RIBB_YERPA      ----------------------------------------------------------------------
RIBB_YERP3      ----------------------------------------------------------------------
RIBB_SHESR      ----------------------------------------------------------------------
RIBB_SHESM      ----------------------------------------------------------------------
RIBB_SHEHH      ----------------------------------------------------------------------
RIBB_ERWT9      ----------------------------------------------------------------------
RIBB_SHEB9      ----------------------------------------------------------------------
RIBB_SHEB2      ----------------------------------------------------------------------
RIBB_SHEB8      ----------------------------------------------------------------------
RIBB_SHEB5      ----------------------------------------------------------------------
RIBB_RHORT      ----------------------------------------------------------------------
RIBB_PHOPR      ----------------------------------------------------------------------
RIBB_BUCAP      ----------------------------------------------------------------------
RIBB_BORPE      ----------------------------------------------------------------------
RIBB_BORPA      ----------------------------------------------------------------------
RIBB_BORBR      ----------------------------------------------------------------------
RIBB_DESVV      ----------------------------------------------------------------------
RIBB_DESVH      ----------------------------------------------------------------------
RIBB_RALSO      ----------------------------------------------------------------------
RIBB_VIBC3      ----------------------------------------------------------------------
RIBB_VIBCM      ----------------------------------------------------------------------
RIBB_VIBCH      ----------------------------------------------------------------------
RIBB_OCEIH      ----------------------------------------------------------------------
RIBBA_CORGL     RQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASGENVLVRVHSECLTGDVFGSRRCDQQLHESLR
RIBBA_CORGB     RQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASGENVLVRVHSECLTGDVFGSRRCDQQLHESLR
RIBB_AERHH      ----------------------------------------------------------------------
RIBB_CHLT3      ----------------------------------------------------------------------
RIBB_BUCBP      ----------------------------------------------------------------------
RIBB_AERS4      ----------------------------------------------------------------------
RIBB_CHLL2      ----------------------------------------------------------------------
RIBB_PSEPK      ----------------------------------------------------------------------
RIB3_SCHPO      ----------------------------------------------------------------------
RIBB_CHRVO      ----------------------------------------------------------------------
RIBB_DESDA      ----------------------------------------------------------------------
RIB3_YEAST      ----------------------------------------------------------------------
RIB3_CANAL      ----------------------------------------------------------------------
RIB3_MAGGR      ----------------------------------------------------------------------
RIBBA_THEMA     KKAEATLPTDFGVFKVVSFENHLDGKEHFAIVKEPLEDPVAVRIECVTGDVLSSLRCDSQLAN----FLR
RIBB_METJA      ----------------------------------------------------------------------
RIBA_ARCFU      RVIEATLPTKYGTFRAVGYKTPL--GEIVALVKGRVDEGDV-LVRIHSECLTGDHSLRCDCGDQLENALK
RIBB_METTH      ----------------------------------------------------------------------
RIBB_METAC      ----------------------------------------------------------------------
RIBB_METMA      ----------------------------------------------------------------------
RIBB_ARCFU      ----------------------------------------------------------------------
RSE1_CANAL      ----SCIQVVDSKSNQVIQSLQLDGNESIVSMSASFNKTSTPSVP--ASHLVVGVCTNQTLPNSYDKSYL
RIBA_PHOPO      ----------NAPAELLSFNGLESGKEHIALIFKDAYKAFVPLVRMHSECLTGDGFHSTRCDEQLDETIE
RIBA_HELAH      ----------------------------------------------------------------------
ISPH_CLOPE      -----------------------------------------------------------------DEAIK


                         .         *         .         .         .         .         +:350
query           YFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKV
RIBBA_AQUAE     MIAKEGKGVLVYILGHEGRGIANKIKAYQEKGYTVEANEKLLRDYGIGAQILRDLGVRKMKLMTNNPRKI
RIBB_PHOLE      RIQTEDGVLVIISQQESPKTLFEKLDMYKEQPNSPHSGIVQSRNIGLGSQILADLGVKKIRLLSNSNQGY
RIBBA_BACSK     QIEAEGRGVLLYMKQEGRGGLINKFRAYKQEEGYDEANERLLREYGIGAQILRDLGIRDMRLLTNNPRKI
RIBBA_BACSU     QIAAEGRGVLLYLRQEGRGGLINKLKAYK---LQEQGYDTVLRNYGIGAQILRDLGVRNMKLLTNNPRKI
RIBBA_SYNWW     MIASEGKGVLLYMRQEGRGGLLNKIKAYKLQD---NGRDTVLRDYGIGAQILVDLGVRKMRLMTNNPKKI
RIBBA_UNCTG     AVGEAEQGVVLYIQEGRGIGLANKLKAYR---LQEKGMDTVLRDYGIGAQMLSELGIKSINLMTNNPGKI
RIBB_PHOPO      RISSENGVLVIVTKQEDPEMVISKIQNLALENKETPVVNSQSRQVGLGSQILSDLGIRKM----------
RIBBA_BACCR     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQSLRLLTNNPRKI
RIBB_PSESM      VAEEGCGVVVVLANHESSQALLERIPQLQPPRQYTRSQSRIYSEVGTGAQILQDLGIGKLRHLGPPL-KY
RIBBA_BACC4     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQSLRLLTNNPRKI
RIBBA_BACWK     QIEREGKGVLLYMRQEGRGGLLNKLRAYKLQEDTVEANEKLLRDYGIGAQILKDLGLQSLRLLTNNPRKI
RIBBA_BACC2     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQSLRLLTNNPRKI
RIBBA_THEPX     YLRQLNKIKAYHLQDQGLDTVEANI---------KLGFPPDLREYNIAAQILKDIGVKKIRIMTNNPQKI
RIBBA_BACA2     QIAEEGRGVLLYLRQEGRGGLINKLKAYR---LQEQGYDTVLRNYGIGAQILRDLGVQHMKLLTNNPRKI
RIBBA_BACHK     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACC3     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACAN     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACAH     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACAC     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACAA     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_THEP3     YLRQLNKIKAYHLQDQGLDTVEANI---------KLGFPPDLREYSIAAQILKDIGVKKIRIMTNNPQKI
RIBBA_BACC0     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACAM     QIAEEGRGVLLYLRQEGRGGLINKLKAYR---LQEQGYDTVLRNYGIGAQILRDLGVQHMKLLTNNPRKI
RIBBA_BACCQ     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACC7     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBB_NEIMB      HIQQAESGVVILLHRTGASLLDRTLP--KGANQAYKWDSK---SYGIGAQILAGLNVKKLRVLGQP-SSF
RIBBA_PROVI     MIEKEGRGVLVYLQEGRGIGLINKLKAY---NLQDDGFDTVLRDYGIGAQILQDLGVRKMRLMTNNPKKV
RIBBA_BACCZ     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBBA_BACC1     QIEREGKGVLLYMRQEGRGGLLNKLRAYKEEGFTVEANEKLLRDYGIGAQILKDLGLQHLRLLTNNPRKI
RIBB_NEIMA      RVQQAESGVVILLHRTGASLLDRTLP--KGANQAYKWDSK---SYGIGAQILAGLNVKKLRVLGQP-SSF
RIBBA_BREBN     QIEANGRGILLYMRQEGRGGLINKLRAYKLQEDTVEANEKLLRDYGIGAQILRDLGVQRMRLLTNNPRKI
RIBBA_GEOSW     QIEEEGRGVLLYMRQEGRGGLINKLRAYKQEQGYDEANERLLRDYGIGAQILKDLGVTKMRLLTNNPRKI
RIBBA_SYNY3     MLENHGLGVVVYLRQEGRGGLVNKLKAYSLQDLTVEANERLLRDYGMGAQMLNDLGVKQIRLITNNPRKI
RIBB_DEHMU      YLQK-SGGVLIFM-DNGTQDMSK------------------IREYGIGAQIIKHLGIENIELLSDSKKEF
RIBBA_CHLPN     YIAEKGTGVLVYLRGQEGRGIGHKVRAYAQDNGYDTVDANLAREYGIGAQILVDLKLTTIKLITHNPQKY
RIBBA_PELLD     MIEKEGRGVLVYLQEGRGIGLINKLKAY---NLQDEGFDTVLRDYGIGAQILQDLGVRKMRLLTNNPKKV
RIBBA_CHLMU     YIAEQGLGVIVYLRGQEGRGIGHKIQAYALQDL---GYDTVAREYGVAAQILKDLRLTSVRLITHNPKKF
RIBBA_CLONN     QINKEGRGALLYMRQEGRGGLINKIKAYKLQD---NGMDTVLRDYGIGAQILKDLGVEKVRLMTNNPKKV
RIBB_WOLSU      KIQEENG--LIIFMDTPQNAAPQ------------------IKDFGIGAQMLRFLGIKNFRLLTEENREY
RIBBA_CYTH3     MIQQEGKGVILYMNQEGRGGLLNKLKAYK---LQEQGRDTVQRDYGTGAQILRDLNISKLRLITNNPVKR
RIBBA_CHLTR     YIAEEGLGVIVYLRGQEGRGIGHKIRAYALQDLYDTVDANLAREYGMAAQVLKDLQLTSVRLITHNPRKF
RIBBA_BACCN     QIEREGRGVLLYMRQEGRGGLLNKLRAYKLQEDTVEANEKLLRDYGIGAQIXXXXXXXXXXXXTNNPRKI
RIBB_HELPY      YL-KHEGGYLIFM------------------NTHSKENN-VVKDFGIGALVLKNLGIKDFRLLSSEDRQY
RIBBA_SALTO     LVAKEGRGVVLYIRGHEGRGI-GLLHKLRAYQLQDKGRDTVARDYGTGAQVLYDLGVRSMRLLTNNPAKR
RIBB_HELPJ      YLKR-EGGYLIFM------------------NTHSEQNN-IVKDFGIGALVLKNLGVKDFRLLSSEDRQY
RIBBA_STAES     YIDEHGGMIIYLPQEGRGIGLINKLRAYEEKGYLALGFDEDLRDYHVAAEILKYFDISEINLLSNNPKKF
RIBBA_STAEQ     YIDEHGGMIIYLPQEGRGIGLINKLRAYEEKGYLALGFDEDLRDYHVAAEILKYFDISEINLLSNNPKKF
RIBBA_BACFR     MIEAAGKGVIVYMRGIGLMNKIAAYKDTVDANLH-LGFDADERDYGVGAQILREIGVKKMKLMTNNPVKR
RIBBA_BACFN     MIEAAGKGVIVYMRGIGLMNKIAAYKDTVDANLH-LGFDADERDYGVGAQILREIGVKKMKLMTNNPVKR
RIBBA_ACTPJ     QIEQEGRGVILYLRQEGRGGLINKLRAYELQD---KGMDTVEREYYIGAQMFQQLGVKSIRLLTNNPAKI
RIBBA_ACTP7     QIEQEGRGVILYLRQEGRGGLINKLRAYELQD---KGMDTVEREYYIGAQMFQQLGVKSIRLLTNNPAKI
RIBB_CAMJE      QIKSENGGVIVFMQG-------------------EKSSTTQYKNYGIGAQILRYFGIEEIKLLSQSCKDY
RIBB_PSEAE      KVAEAGSGVVLLLHQIGGDDLLAHVREIXXXXXXXXXXXXXYSTVGAGSQILRDLGVRKMRLLSAPM-RF
RIBB_HELHP      CLKE-KGGYLVFL---------NTHSEYANSS--KTCGD--IKDFGIGAQILKRLGIEDFVLLSSSKGEY
RIBBA_ACTPL     QIEQEGRGVILYLRQEGRGGLINKLRAYELQD---KGMDTVEREYYIGAQMFQQLGVKSIRLLTNNPAKI
RIBBA_ACTP2     QIEQEGRGVILYLRQEGRGGLINKLRAYELQD---KGMDTVEREYYIGAQMFQQLGVKSIRLLTNNPAKI
RIBBA_SALAI     QVAREGRGVVLYVRGHEGRGILHKLQAYQLQDTGRDTVDANLRDYGTGAQILYDLGVRSMRLLTNNPAKR
RIBBA_PELPB     MIEKEGRGVLIYLQEGRGIGLINKLKAY---NLQDQGNEKLLRDYGIGAQILKDLGVRKMKLMTNNPKKV
RIBBA_MYCUA     MVAREGRGVVLYMRGHEGRGITYQLQDAGDDTVLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAKR
RIBBA_PROA2     QIEKAGKGVLIYLQEGRGIGLINKLKAY---NLQDQGFDTVLRDYGIGAQILQDLGVKKMRLLTNNPKKI
RIBBA_STAHJ     YINEHGGMIIYLPQEGRGIGLINKLRAYE---LIEQGHDTVLRDYHIAAQILNYFNVQQVNLLSNNPKKF
RIBBA_MYCMM     MVAREGRGVVLYMRGHEGRGILHKLQAYQLQDALKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAKR
RIBBA_BACV8     MIEKEGKGAVVYLNQEGRGGLMEKMKAYKLQENILLGHQADERDYGVGAQILRSIGVTQMRLLTNNPVKR
RIBBA_MYCTU     MVAREGRGVVLYMRGHEGRGIMHKLQAYQLQDALKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAKR
RIBBA_MYCTA     MVAREGRGVVLYMRGHEGRGIMHKLQAYQLQDALKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAKR
RIBBA_MYCBT     MVAREGRGVVLYMRGHEGRGIMHKLQAYQLQDALKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAKR
RIBBA_MYCBP     MVAREGRGVVLYMRGHEGRGIMHKLQAYQLQDALKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAKR
RIBBA_MYCBO     MVAREGRGVVLYMRGHEGRGIMHKLQAYQLQDALKLGLPADARDYGIGAQI