[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for pubi0:AAZ21852.1

[Show Plain Result]


## Summary of Sequence Search
    1::351
    6::315     4e-38  32%  361 aa  RIBD_BACSU RecName: Full=Riboflavin biosynthesis protein
    6::311     3e-35  32%  371 aa  RIBD_BACAM RecName: Full=Riboflavin biosynthesis protein
   10::246     4e-33  34%  356 aa  RIBD_AQUAE RecName: Full=Riboflavin biosynthesis protein
   19::329     1e-32  29%  376 aa  RIBD_ACTPL RecName: Full=Riboflavin biosynthesis protein
   29::320     9e-32  30%  375 aa  RIBD_CHLTR RecName: Full=Riboflavin biosynthesis protein
   29::321     3e-30  28%  376 aa  RIBD_CHLPN RecName: Full=Riboflavin biosynthesis protein
   12::329     2e-29  31%  372 aa  RIBD_HAEIN RecName: Full=Riboflavin biosynthesis protein
   29::320     3e-29  29%  371 aa  RIBD_CHLMU RecName: Full=Riboflavin biosynthesis protein
    7::326     6e-28  28%  367 aa  RIBD_ECOLI RecName: Full=Riboflavin biosynthesis protein
    8::226     1e-25  30%  368 aa  RIBD_SYNY3 RecName: Full=Riboflavin biosynthesis protein
    7::328     1e-24  29%  372 aa  RIBD_BUCBP RecName: Full=Riboflavin biosynthesis protein
    7::147     2e-24  40%  147 aa  RIBD1_BUCAP RecName:
    7::143     1e-23  43%  147 aa  RIBD1_BUCAI RecName:
   31::301     9e-16  29%  337 aa  RIBD_CORAM RecName: Full=Riboflavin biosynthesis protein
   13::232     2e-13  29%  339 aa  RIBD_MYCTU RecName: Full=Riboflavin biosynthesis protein
    6::194     3e-12  32%  247 aa  RIB7_DEBHA RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
    6::197     1e-10  32%  249 aa  RIB7_KLUMA RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
  281::387     9e-10  41%  405 aa  RIB2_SCHPO RecName:
   30::172     8e-09  33%  217 aa  RIBD2_BUCAP RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
    6::128     8e-09  40%  252 aa  RIB7_KLULA RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
   25::114     2e-08  44%  244 aa  RIB7_CANGA RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
    9::179     3e-08  26%  224 aa  RIB7_METJA RecName: Full=Putative
   17::111     3e-07  40%  246 aa  RIB7_ASHGO RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
   38::160     2e-06  27%  213 aa  RIB7_SULSO RecName: Full=Putative
    3::163     6e-06  25%  216 aa  RIB7_METTH RecName: Full=Putative
   42::194     1e-05  32%  268 aa  RIB7_SCHPO RecName: Full=Putative
   26::120     2e-05  33%  161 aa  TADA_BACSU RecName: Full=tRNA-specific adenosine deaminase;        
   26::140     4e-05  37%  191 aa  ADAT2_HUMAN RecName: Full=tRNA-specific adenosine deaminase 2;     
   54::106     7e-05  38%  244 aa  RIB7_YEAST RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil
    7::82      9e-05  39%  151 aa  TADA_AQUAE RecName: Full=tRNA-specific adenosine deaminase;      
  100::181     1e-04  43%  193 aa  DCTD_BPT4 RecName: Full=Deoxycytidylate deaminase;       
   26::140     1e-04  37%  191 aa  ADAT2_MOUSE RecName: Full=tRNA-specific adenosine deaminase 2;     
   12::156     2e-04  27%  167 aa  TADA_SHIFL RecName: Full=tRNA-specific adenosine deaminase;        
   12::156     2e-04  27%  167 aa  TADA_ECOLI RecName: Full=tRNA-specific adenosine deaminase;        
   27::92      3e-04  47%  147 aa  YLXG_VIBFI RecName: Full=Uncharacterized deaminase in luxG
   30::156     3e-04  26%  167 aa  TADA_ECOL6 RecName: Full=tRNA-specific adenosine deaminase;        
   30::156     3e-04  26%  167 aa  TADA_ECO57 RecName: Full=tRNA-specific adenosine deaminase;        
   26::107     3e-04  40%  191 aa  ADAT2_BOVIN RecName: Full=tRNA-specific adenosine deaminase 2;     
   69::144     3e-04  55%  197 aa  DCTD_CAEEL RecName: Full=Probable deoxycytidylate deaminase;       
   16::108     4e-04  33%  159 aa  Y196_STRP8 RecName: Full=Uncharacterized deaminase spyM18_0196;    
   16::108     4e-04  33%  171 aa  TADA_STRP6 RecName: Full=tRNA-specific adenosine deaminase;        
   16::108     4e-04  33%  171 aa  TADA_STRP3 RecName: Full=tRNA-specific adenosine deaminase;        
   16::108     4e-04  33%  171 aa  TADA_STRP1 RecName: Full=tRNA-specific adenosine deaminase;        
    9::151     6e-04  27%  162 aa  Y236_BUCBP RecName: Full=Uncharacterized protein bbp_236;
   15::158     6e-04  31%  173 aa  TADA_HAEIN RecName: Full=tRNA-specific adenosine deaminase;        
   12::156     8e-04  27%  172 aa  TADA_SALTY RecName: Full=tRNA-specific adenosine deaminase;        
   12::156     8e-04  27%  172 aa  TADA_SALTI RecName: Full=tRNA-specific adenosine deaminase;        
   34::115     8e-04  44%  178 aa  DCTD_PONAB RecName: Full=Deoxycytidylate deaminase;       
   34::115     8e-04  44%  178 aa  DCTD_HUMAN RecName: Full=Deoxycytidylate deaminase;       
  100::159     8e-04  46%  188 aa  DCTD_BPT2 RecName: Full=Deoxycytidylate deaminase;       
    1::351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCS
RIBD_BACSU      MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGADIYVTLEPCS
RIBD_BACAM      MNTAIELARRGEGQTQPNPLVGAVVVKKRQIVGMGAHLQYGEAHAEVHAINMAGSLAKGADLYVTLEPCS
RIBD_AQUAE      MKLALSLAKKRKGYTHPNPTVGAVVVKEGKIVGLGYHEKAGKPHAEVMALGQAGEKAKGATLYVTLEPCT
RIBD_ACTPL      MRRAIALAKQGLGWTNPNPLVGCVIVKNGEIVAEGYHEKIGGWHAERNAVLHCKEDLSGATAYVTLEPCC
RIBD_CHLTR      -----------------NPWVGCVIVKNGCVIGEGWHQGIGSPHAEVCAVQDQKCSLEGAEVFVTLEPCC
RIBD_CHLPN      -----------------NPWVGCVVVQENRIIGEGFHAYAGGPHAEELAIQNASMPISGSDVYVSLEPCS
RIBD_HAEIN      MQRALDLAAKGQYTTTPNPSVGCVLVKNGEIVGEGFHFKAGQPHAERVALAQAGENAKGATAYVTLEPCA
RIBD_CHLMU      -----------------NPWVGCVIVKNGCIIGRGWHKGIGSPHAEVCAFQDQTSSLVGADVYVTLEPCC
RIBD_ECOLI      MARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALRMAGEKAKGATAYVTLEPCS
RIBD_SYNY3      MRRCLTLAKTAIGKTAPNPLVGSVIVQGDEIVGQGFHPQAGQPHGEIFALWEAGDRAKGATLYVNLEPCN
RIBD_BUCBP      MKKAIKLAKKGSLTTSPNPXXXXXXXXXXXXXXXXWHKKTGMKHAEIYALKTSGEKAKGATAYITLEPCS
RIBD1_BUCAP     MTRAIKLSKLGEFTTSPNPNVGCVIVQNKKIVGEGWHKKYGENHAEINALNMAGEKAKGSTAYITLEPCN
RIBD1_BUCAI     MKRAIELSKLGEFTTAPNPNVGCVIVKNNIIVGEGWHEQAGKNHAEINALIMAGEKAQGGTAYVTLEPCN
RIBD_CORAM      ------------GTTSPNPPVGAVIISTSEIVGTGATQPVGGVHAEVQALADAAGKTEGATAVVTLEPCR
RIBD_MYCTU      MGLAIEHSYQVKGTTYPKPPVGAVIVDNGRIVGAGGTEPAGGDHAEXXXXXXXXXXXXXXXXXXTMEPCN
RIB7_DEBHA      ----------------------------------------------------------------------
RIB7_KLUMA      ----------------------------------------------------------------------
RIB2_SCHPO      --------------------VGAVIVQNGKIVSTGYSRERGNTHAEECAIKNPTDSLEGAIMYSTMEPCS
RIBD2_BUCAP     ----------------------------------------------------------------------
RIB7_KLULA      ----------------------------------------------------------------------
RIB7_CANGA      ----------------------------------------------------------------------
RIB7_METJA      ----------------------------------------------------------------------
RIB7_ASHGO      ----------------------------------------------------------------------
RIB7_SULSO      ----------------------------------------------------------------------
RIB7_METTH      ----------------------------------------------------------------------
RIB7_SCHPO      ----------------------------------------------------------------------
TADA_BACSU      --------------------IGAVLVINGEIIALRETEQRSIAHAEMLVIDEACKRLEGATLYVTLEPC-
ADAT2_HUMAN     MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNATRHAEMVAIKSPSEVFEHTVLYVTVEPCI
RIB7_YEAST      ----------------------------------------------------------------------
TADA_AQUAE      --LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEETAHAEMLAIKEACRRLEGCELYVTLEPC-
DCTD_BPT4       ---------------------------------------KNEIHAELNAILFAARNIEGATMYVTLSPC-
ADAT2_MOUSE     MEEAMRMAK--EALENIEVPVGCLMVYNNEVVGKGRNEVNATRHAEMVAIDQCHQHFEHTVLYVTVEPCI
TADA_SHIFL      MRHALTLAKRAWDEREV--PVGAVLVHNNRVIGEGWNRPIGTAHAEIMALRQGNYRLIDATLYVTLEPC-
TADA_ECOLI      MRHALTLAKRAWDEREV--PVGAVLVHNNRVIGEGWNRPIGTAHAEIMALRQGNYRLIDATLYVTLEPC-
YLXG_VIBFI      --------------------VGAVITKHNRIVSVGFNGYPHTLHAEENAILFAKRDLEGCDIWVTHFPC-
TADA_ECOL6      --------------------VGAVLVHNNRVIGEGWNRPIGTAHAEIMALRQGNYRLIDATLYVTLEPC-
TADA_ECO57      --------------------VGAVLVHNNRVIGEGWNRPIGTAHAEIMALRQGNYRLIDATLYVTLEPC-
ADAT2_BOVIN     MEQAMQMAK--DALDNTEVPVGCLMVYNNEVVGKGRNEVNATRHAEMVAIRSPSEVFEHTVLYVTVEPC-
DCTD_CAEEL      -----------------NTQVGCVIVKDNCIVSVGYNGFKEDPHAEMNAIINKRTTLHDCTVYVTLFPCN
Y196_STRP8      ------LKEAEKSLQKAEIPIGCVIVKDGEIIGRGEESNQAIMHAEMMAINNAHERLLDTTLFVTIEPC-
TADA_STRP6      ------LKEAEKSLQKAEIPIGCVIVKDGEIIGRGEESNQAIMHAEMMAINNAHERLLDTTLFVTIEPC-
TADA_STRP3      ------LKEAEKSLQKAEIPIGCVIVKDGEIIGRGEESNQAIMHAEMMAINNAHERLLDTTLFVTIEPC-
TADA_STRP1      ------LKEAEKSLQKAEIPIGCVIVKDGEIIGRGEESNQAIMHAEMMAINNAHERLLDTTLFVTIEPC-
Y236_BUCBP      MKCAIFLAKISEMIGEV--PVGAVLVFNNTIIGKGLNSHDPTAHAEIKALRNGAKFLKNYRLYVTLEPCI
TADA_HAEIN      MRYALELADKAEALGEI--PVGAVLVDDARNLSIVQSD--PTAHAEIIALRNGAKNIQNSTLYVTLEPCT
TADA_SALTY      MRHALTLAKRAWDEREV--PVGAVLVHNHRVIGEGWNRPIGTAHAEIMALRQGNYRLLDTTLYVTLEPC-
TADA_SALTI      MRHALTLAKRAWDEREV--PVGAVLVHNHRVIGEGWNRPIGTAHAEIMALRQGNYRLLDTTLYVTLEPC-
DCTD_PONAB      -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMNKNSDVKGCSMYVALFPCN
DCTD_HUMAN      -----------------NSQVGCIVNSENKIVGIGYNGMPNVCHAELNAIMNKNSDVKGCSMYVALFPCN
DCTD_BPT2       ---------------------------------------KNEIHAELNAILFAARNIEGATMYVTLSPC-


                         .         .         *         .         .         .         .:140
query           HYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLKKQINKFYAPYFFNRKKNL
RIBD_BACSU      HYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGILADQAERLNEKFLHFMRTGL
RIBD_BACAM      HYGKTPPCAELIMKSGIKRVFIAVEDPNPLVAGKGITMLEEAGIEVKTGLLRQQAEELNKMFLHFMRTGL
RIBD_AQUAE      HFGRTPPCTDAIIRSGIKRVVVATLDPNPLMSGKGVEKLRNAGIEVDVGVCEEEARELNEDFFTYITQER
RIBD_ACTPL      HHGRTPPCSDLLIERGIKKVFIGSSDPNPLVAGRGANQLRQAXXXXXXXXXXXXCDALNPIFFHYIQTKR
RIBD_CHLTR      HFGRTPPCVDLLIKSKVAAVYVGLLDPDPRVCKKGVARLQAAGIPVYVGVGSQEAKTSLQPYLYQRERGL
RIBD_CHLPN      HFGSCPPCANLLIKHKVSRVFVALVDPDPKVAGQGIAMLRQAGIQVYVGIGESEAQASLQPYLYQRTHNF
RIBD_HAEIN      HYGRTPPCALGLIEAGVVKVIAAMQDPNPQVAGKGLKMLSDAGIESTVNLLNDQAEKINKGFLKRMRQGM
RIBD_CHLMU      HFGRTPPCVDLLIKSKVSSVYIALLDPDPRVCKRGVARLKEAGISVYVGIGHEEAKASLQPYLHQRETGL
RIBD_ECOLI      HHGRTPPCCDALIAAGVARVVASMQDPNPQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGF
RIBD_SYNY3      HQGRTPPCTEAIIQAGIAKVVVGMVDPNPLVAGKGISRLRQAGIEVKVGVEEEACQRLNEAFCFRIKHQR
RIBD_BUCBP      HFGKTPPCCVALTKYGISRVVIATLDPNPKVSGNGVKWLKKHGILVTIGTLSKESIKINKGFFQRMTTGI
RIBD1_BUCAP     HFGKTPPCCDAIIQSGIKNVIISSLDPNPKVSGKGVLYLRKKGISVKIGLMSKESQKYNKGFFKRMRTGL
RIBD1_BUCAI     HFGKTPPCCNALIKSGINRVVISNIDPNPKISGNGILYLKKHGICVKTGLLSKE-SKQYNKGFFKRMK--
RIBD_CORAM      HTGRTGPCTQALIEAGIKDVLFLHSDPNPSAGGGE-QVLVDAGINVVQLPSPEGVPDALIPWLKSVQLRR
RIBD_MYCTU      HYGKTPPCVNALIEARVGTVVYAV-XXXXXXXXXXXXXXXXXXLQVRSGVLAEQVAAGLREWLHKQRTGL
RIB7_DEBHA      --------------------------------------------------LTPSLRPFLEEYLPRPCSNR
RIB7_KLUMA      --------------------------------------------------LKKDLVPFLEPYLPDEEKEK
RIB2_SCHPO      RLSKKVSCTDLIVKQKFSTVVLGSLEPDIFVKCEGVDLLKKAGIVVIEKL--------------------
RIBD2_BUCAP     ----------------------------------------------------------------------
RIB7_KLULA      --------------------------------------------------LKKELVSFLEPYMPENEQEK
RIB7_CANGA      ----------------------------------------------------------------------
RIB7_METJA      ----------------------------------------------------------------------
RIB7_ASHGO      ----------------------------------------------------------YLPTPPDSSARL
RIB7_SULSO      ----------------------------------------------------------------------
RIB7_METTH      ----------------------------------------------------------------------
RIB7_SCHPO      ----------------------------------------------------------------------
TADA_BACSU      -----PMCAGAVVLSRVEKVVFGAFDPKGGCSGTLMNLLQEE----------------------------
ADAT2_HUMAN     ------MCAAALRLMKIPLVVYGCQNERFGGCGSVLNI--------------------------------
RIB7_YEAST      ----------------------------------------------------------------------
TADA_AQUAE      ----------------------------------------------------------------------
DCTD_BPT4       -----PDCAKAIAQSGIKKLVY-CETYDKNKPGWD-DILRNAGIEV-FNVPKKNLNK-------------
ADAT2_MOUSE     ------MCAAALRLMKIPLVVYGCQNERFGGCGSVLNI--------------------------------
TADA_SHIFL      -----VMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLMNHRVEITEGILADECAALLSDFFRMRRQEI
TADA_ECOLI      -----VMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLMNHRVEITEGILADECAALLSDFFRMRRQEI
YLXG_VIBFI      ----------------------------------------------------------------------
TADA_ECOL6      -----VMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLMNHRVEITEGILADECAALLSDFFRMRRQEI
TADA_ECO57      -----VMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLMNHRVEITEGILADECAALLSDFFRMRRQEI
ADAT2_BOVIN     ----------------------------------------------------------------------
DCTD_CAEEL      ----------------------------------------------------------------------
Y196_STRP8      -----VMCSGAIGLARIPHVIYGASN--------------------------------------------
TADA_STRP6      -----VMCSGAIGLARIPHVIYGASN--------------------------------------------
TADA_STRP3      -----VMCSGAIGLARIPHVIYGASN--------------------------------------------
TADA_STRP1      -----VMCSGAIGLARIPHVIYGASN--------------------------------------------
Y236_BUCBP      ------MCYGAIIHSRISRLVFGAKNLQKYICCKNHFFINKRKISITQEVLESECSNLLSSFFKRKRK--
TADA_HAEIN      ------MCAGAILHSRIKRLVFGASDYKTGAIGSRFHFFMNHTLEVTSGVLAEECSQKLSTFFQKRRE--
TADA_SALTY      -----VMCAGAMVHSRIGRVVFGARDAKTGAAGSLIDVLMNHRVEIIEGVLRDECATLLSDFFRMRRQEI
TADA_SALTI      -----VMCAGAMVHSRIGRVVFGARDAKTGAAGSLIDVLMNHRVEIIEGVLRDECATLLSDFFRMRRQEI
DCTD_PONAB      ECAK------------------------------------------------------------------
DCTD_HUMAN      ECAK------------------------------------------------------------------
DCTD_BPT2       -----PDCAKAIAQSGIKKLVY-CETYDKNKPG-------------------------------------


                         +         .         .         .         .         *         .:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
RIBD_BACSU      PYVTLKAAASLDGKIATSDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTK-QPVR
RIBD_BACAM      PYVTLKAAASLDGKTATEDSKWITSEAARLDAQQYRKSHQRILVGAGTVKADNPSLTCRLPDAVK-QPVR
RIBD_AQUAE      PYITLKWAQTLDGKLLTGSSKWITSKESRKVAHILRREATAVLVGVNTVIKDDPHLTVRFVPTEK-QPVR
RIBD_ACTPL      PYVLMKYAMTADGKIASGESKWITGESARARVQQTRHQYSAIMVGVDTVLADNPMLNSRMPNAKQ--PVR
RIBD_CHLTR      PWVVMKTAASLDGQTADRSSQWISGELARADVGKLRAESQAIIVGARTVCLDNPRLSARFPDLYERQPLR
RIBD_CHLPN      PWTILKSAASVDGQVADSQGKSITCPEARHDVGKLRAESQAILVGSRTVLSDDPWLTARQPQLYPKQPLR
RIBD_HAEIN      PFVQLKLAMSLDTAMASGESKWITGPDARSDVQKMRAKXXXXXXXXXXVIADDPSLNVRWDEFPERQPVR
RIBD_CHLMU      PWVVMKTAASLDG--QTSDRRGISQWISGEQARLLRAESQAVIVGSRTVCLDNPRLSARMPSLYERQPLR
RIBD_ECOLI      PYIQLKLGASLDTAMASGESQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDEQTPIR
RIBD_SYNY3      PFGIFKYAMTLDGKIATAQSSWVTSSSARHWVHQLRSQCQAVIIGGNTVRRDNPLLT--NHGVGEVNPLR
RIBD_BUCBP      PWIKLKLAIDGRTALNNGKSKWITSDKARHDVQHVREKSDAIISSSETILFDNPLLTVRXQKLLKHSPIR
RIBD1_BUCAP     P---------------------------------------------------------------------
RIBD1_BUCAI     ----------------------------------------------------------------------
RIBD_CORAM      PHVTLKFAQTIDGFTAAADSQWITGEMARDYVHADREHRDAIIIGTGTALIDNPSLTARYDGTQRHQPRR
RIBD_MYCTU      PHVTWKYATSIDGRSAAADSQWISSEAARLDLHRRRAIADAILVGTGTVLADDPALTARLASLAPQQPLR
RIB7_DEBHA      PFVTLTYAQSLDSRIAAKEQTKISHLETKTMTHYIRSKHDGIMVGIGTVLADDPKLNCRFEAENISTPRP
RIB7_KLUMA      PYVILTYAQSLDSRIAKKGTRTISHEETKTMTHYLRYKFDAIMLGCGTVMIDDPGLNCKWEHLAGISPRP
RIB2_SCHPO      ----------------------------------------------------------------------
RIBD2_BUCAP     -----------------------------------RAKSSAILTSSATILNDDPLLNVRYKKFDKNTPIR
RIB7_KLULA      PYVILTYAQSLDARIAKKGTRTISHQETNTMTHYLRYKFDGIMLGCGTVLVDDPGLNCKWEHFAEHSPRP
RIB7_CANGA      PFVTLTYAQSIDAKIAKQRGVRISHIETKEMTHYLRYFHDGILIGSGTVLADDPGLNCKWESMEEKSPRP
RIB7_METJA      PYIISNVGMTLDGKLATNNDSRISCEEDLIRVHKIRANVDGIMVGIGTVLKDDPRLTVH-KIKSDRNPVR
RIB7_ASHGO      PFVTLTYAQSLDARIAKQKGERISHEETKTMTHYLRYHHSGILIGSGTALADDPGLNCRADCTEQSSPRP
RIB7_SULSO      --------------------------------HEIRSEVDAVMVGANTVRVDNPSLTVKY-GKNRRNPIR
RIB7_METTH      PYVILNAAMTLDGKIATATSSEISGEEDLRRVHELRRECDAIMVGINTVLADDPRLTVRVDAAPGDNPVR
RIB7_SCHPO      ---------------------RLSSKESFVMTHLLRTKFDGIMVGSRTAENDNPSLTAKLPDLNK-QPIP
TADA_BACSU      ----------------------------------------------------------------------
ADAT2_HUMAN     ----------------------------------------------------------------------
RIB7_YEAST      ----------------------ISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWPDPAANSPRP
TADA_AQUAE      ----------------------------------------------------------------------
DCTD_BPT4       ----------------------------------------------------------------------
ADAT2_MOUSE     ----------------------------------------------------------------------
TADA_SHIFL      ----------------------------------------------------------------------
TADA_ECOLI      ----------------------------------------------------------------------
YLXG_VIBFI      ----------------------------------------------------------------------
TADA_ECOL6      ----------------------------------------------------------------------
TADA_ECO57      ----------------------------------------------------------------------
ADAT2_BOVIN     ----------------------------------------------------------------------
DCTD_CAEEL      ----------------------------------------------------------------------
Y196_STRP8      ----------------------------------------------------------------------
TADA_STRP6      ----------------------------------------------------------------------
TADA_STRP3      ----------------------------------------------------------------------
TADA_STRP1      ----------------------------------------------------------------------
Y236_BUCBP      ----------------------------------------------------------------------
TADA_HAEIN      ----------------------------------------------------------------------
TADA_SALTY      ----------------------------------------------------------------------
TADA_SALTI      ----------------------------------------------------------------------
DCTD_PONAB      ----------------------------------------------------------------------
DCTD_HUMAN      ----------------------------------------------------------------------
DCTD_BPT2       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
RIBD_BACSU      VILDTVLSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGI
RIBD_BACAM      VILDTKLTVPETANVLTDGAAPTWIFTAAGSDVRKKDRLTALGIKVF--TLETDRIHIPEVLSILAENGI
RIBD_AQUAE      IILDPELEVPLSAKVLNTEEAPTIVI--------------------------------------------
RIBD_ACTPL      IVCDSQLRTPLDCQLVQTAKEYRTVIATVSDDLQKIEQFRPLGVDVLVCKARNKRVDLQDLLQKLGEMQI
RIBD_CHLTR      VVVDSRGTVPLESRVFDLSSGSTLFATTQQCPKEYIQKLKDLGVEVWES--SSHQVDLKGLLRYLAERGC
RIBD_CHLPN      VVLDSRGSVPPTSKVFDKTSPTLYVTTERCPENYIK-VLDSLDVPVLLTESTPSGVDLHKVYEYLAQKKI
RIBD_HAEIN      VILDSQHRIQPTHKLFLT----HSPVWLVSSEPRDLTGFPDFCEQIIFPKENL----LKELMRELGKRQI
RIBD_CHLMU      VVVDSRGSVPLDARVWNPDSGNVLLATTEQCSKEHIQKLEDRGVEVWKS--SPQQVDLKRLLQYLAEKGC
RIBD_ECOLI      IVIDSQNRVTPVHRIVQQPGET------WFARTQEDSREWPETVRTLLIPEHKGHLDLVVLMMQLGKQQI
RIBD_SYNY3      VVLSRSLDL-------------------------------------------------------------
RIBD_BUCBP      VIIDSKNRITPSHKCIKQPG----LLFLIRIHSDNNIWPSHIKQIILNNKSKK--IDLIDLVKMLAKYQI
RIBD1_BUCAP     ----------------------------------------------------------------------
RIBD1_BUCAI     ----------------------------------------------------------------------
RIBD_CORAM      VVIGRR----------NIADAGDA-----------------------ASNLNRLGFEIDEALAELYATGA
RIBD_MYCTU      VVVGK-----------------------------------------------------------------
RIB7_DEBHA      IILDPTGKWAYHKSQLRSVCDNNKGLAPFTPRNEDVEVLDKQDGAFVRLPLLRNADKVGNILKKLFQLGI
RIB7_KLUMA      IILDPNCKWKKMKKLYEAGDGKAPIIVVKELPSE-----PEEGVDYLVMRTNTGKMDWSDMLVQLSKFNV
RIB2_SCHPO      ----------------------------------------------------------------------
RIBD2_BUCAP     IIIDSKNRVKKSHKIIQTKEK----ILLMRLKLDKEIWPENTKQIIIKP--YKENIDLLCVLKFLGNLEI
RIB7_KLULA      IILDPNGKWKFEGSKMKT----------------------------------------------------
RIB7_CANGA      IILDPKLKWK------------------------------------------------------------
RIB7_METJA      IVVDSKLRVPLNARVL---NKDAKTIIATTEDTNXXXXXXXXGVEVVKC--GRGKVDLKKLMDILYDKGI
RIB7_ASHGO      IILD------------------------------------------------------------------
RIB7_SULSO      VVVTRSFNLDPSYKIFTTP--PSTVIYTSNYESEKVEEFIRKGVIVRKFXXXXXXXXXXXXNFNV-----
RIB7_METTH      VVVD---SMARTPPHFRVLNDEAPTVIGVSESAERVAELRKRAEVVV---AGTRRVDLHLLLERLHGMGI
RIB7_SCHPO      IIVDSNLRLDKPPLIIVAPSIWQQVQHDSKLKEAVKLIQSVGGRCIIRNEDSPDSWSDYVALDKLLQNGV
TADA_BACSU      ----------------------------------------------------------------------
ADAT2_HUMAN     ----------------------------------------------------------------------
RIB7_YEAST      IIID------------------------------------------------------------------
TADA_AQUAE      ----------------------------------------------------------------------
DCTD_BPT4       ----------------------------------------------------------------------
ADAT2_MOUSE     ----------------------------------------------------------------------
TADA_SHIFL      ----------------------------------------------------------------------
TADA_ECOLI      ----------------------------------------------------------------------
YLXG_VIBFI      ----------------------------------------------------------------------
TADA_ECOL6      ----------------------------------------------------------------------
TADA_ECO57      ----------------------------------------------------------------------
ADAT2_BOVIN     ----------------------------------------------------------------------
DCTD_CAEEL      ----------------------------------------------------------------------
Y196_STRP8      ----------------------------------------------------------------------
TADA_STRP6      ----------------------------------------------------------------------
TADA_STRP3      ----------------------------------------------------------------------
TADA_STRP1      ----------------------------------------------------------------------
Y236_BUCBP      ----------------------------------------------------------------------
TADA_HAEIN      ----------------------------------------------------------------------
TADA_SALTY      ----------------------------------------------------------------------
TADA_SALTI      ----------------------------------------------------------------------
DCTD_PONAB      ----------------------------------------------------------------------
DCTD_HUMAN      ----------------------------------------------------------------------
DCTD_BPT2       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLYKCSKSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RIBD_BACSU      MSVYVEGGSAVHGSFVKEGCFQEIIFYFAPK---------------------------------------
RIBD_BACAM      MSVYVEGGASVHGSFVKAGCFDELHFY-------------------------------------------
RIBD_AQUAE      ----------------------------------------------------------------------
RIBD_ACTPL      DSLLLEGGSSLNFSALESGIVNRVHCYIAPK---------------------------------------
RIBD_CHLTR      LQVLVEGGAQLHSAFWQQKLVNAGVIY-------------------------------------------
RIBD_CHLPN      LQVLVEGGTTLHTSLLKERFVNSLVLY-------------------------------------------
RIBD_HAEIN      NTLWVEAGANLSGSLIDAKLVDELIIYIAPKLL-------------------------------------
RIBD_CHLMU      LQVLVEGGARLHSAFWREHLVNAGVIY-------------------------------------------
RIBD_ECOLI      NSIWVEAGPTLAGALLQAGLVDELIVYIAPKLL-------------------------------------
RIBD_SYNY3      ----------------------------------------------------------------------
RIBD_BUCBP      NNILIEAGPSLSSSFLKLNIINELIIYIAPKIL-------------------------------------
RIBD1_BUCAP     ----------------------------------------------------------------------
RIBD1_BUCAI     ----------------------------------------------------------------------
RIBD_CORAM      RDVLVEGGAGLASGFANQGLVDWLQVYQ------------------------------------------
RIBD_MYCTU      ----------------------------------------------------------------------
RIB7_DEBHA      KSIMVEGGNDL-----------------------------------------------------------
RIB7_KLUMA      KSVMVEGGGIVINDLLQR----------------------------------------------------
RIB2_SCHPO      ----------------------------------------------------------------------
RIBD2_BUCAP     NNLWIEAGSTLSGCFLKLELIDEIIIYIAPKIL-------------------------------------
RIB7_KLULA      ----------------------------------------------------------------------
RIB7_CANGA      ----------------------------------------------------------------------
RIB7_METJA      KSILLEGGGTLNWGMFKEGLVDEVSVYIAPK---------------------------------------
RIB7_ASHGO      ----------------------------------------------------------------------
RIB7_SULSO      RRLMVEGGGHLIWWFIKDNLYDE-----------------------------------------------
RIB7_METTH      ERLMLEGGSTLNYSMLTGGLVDE-----------------------------------------------
RIB7_SCHPO      NRIMVEGGAEL-----------------------------------------------------------
TADA_BACSU      ----------------------------------------------------------------------
ADAT2_HUMAN     ----------------------------------------------------------------------
RIB7_YEAST      ----------------------------------------------------------------------
TADA_AQUAE      ----------------------------------------------------------------------
DCTD_BPT4       ----------------------------------------------------------------------
ADAT2_MOUSE     ----------------------------------------------------------------------
TADA_SHIFL      ----------------------------------------------------------------------
TADA_ECOLI      ----------------------------------------------------------------------
YLXG_VIBFI      ----------------------------------------------------------------------
TADA_ECOL6      ----------------------------------------------------------------------
TADA_ECO57      ----------------------------------------------------------------------
ADAT2_BOVIN     ----------------------------------------------------------------------
DCTD_CAEEL      ----------------------------------------------------------------------
Y196_STRP8      ----------------------------------------------------------------------
TADA_STRP6      ----------------------------------------------------------------------
TADA_STRP3      ----------------------------------------------------------------------
TADA_STRP1      ----------------------------------------------------------------------
Y236_BUCBP      ----------------------------------------------------------------------
TADA_HAEIN      ----------------------------------------------------------------------
TADA_SALTY      ----------------------------------------------------------------------
TADA_SALTI      ----------------------------------------------------------------------
DCTD_PONAB      ----------------------------------------------------------------------
DCTD_HUMAN      ----------------------------------------------------------------------
DCTD_BPT2       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
RIBD_BACSU      -
RIBD_BACAM      -
RIBD_AQUAE      -
RIBD_ACTPL      -
RIBD_CHLTR      -
RIBD_CHLPN      -
RIBD_HAEIN      -
RIBD_CHLMU      -
RIBD_ECOLI      -
RIBD_SYNY3      -
RIBD_BUCBP      -
RIBD1_BUCAP     -
RIBD1_BUCAI     -
RIBD_CORAM      -
RIBD_MYCTU      -
RIB7_DEBHA      -
RIB7_KLUMA      -
RIB2_SCHPO      -
RIBD2_BUCAP     -
RIB7_KLULA      -
RIB7_CANGA      -
RIB7_METJA      -
RIB7_ASHGO      -
RIB7_SULSO      -
RIB7_METTH      -
RIB7_SCHPO      -
TADA_BACSU      -
ADAT2_HUMAN     -
RIB7_YEAST      -
TADA_AQUAE      -
DCTD_BPT4       -
ADAT2_MOUSE     -
TADA_SHIFL      -
TADA_ECOLI      -
YLXG_VIBFI      -
TADA_ECOL6      -
TADA_ECO57      -
ADAT2_BOVIN     -
DCTD_CAEEL      -
Y196_STRP8      -
TADA_STRP6      -
TADA_STRP3      -
TADA_STRP1      -
Y236_BUCBP      -
TADA_HAEIN      -
TADA_SALTY      -
TADA_SALTI      -
DCTD_PONAB      -
DCTD_HUMAN      -
DCTD_BPT2       -